A0A096LNR0_HUMAN Loading...

Solute carrier family 30 member 8

AlphaFold DB , UniProt , Accession A0A096LNR0, Species HUMAN (Homo sapiens, Human), Gene SLC30A8, Length 36 aa.

						>A0A096LNR0_HUMAN|A0A096LNR0|SLC30A8
MYHCHSGSKPTEKGANEYAYAKWKLCSASAICFIFM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53	Low	59	Low	243 Å²	243	139.4 Å²	139.4	100%	1.197	75%	0.751	S	S	*	*				0	94.7	0	-71	149.6	178.4	0	107.5	H3	M1-H3 PolarHBondContact O-N 3.37Å; M1-H3 VanDerWaalsContact O-N 3.08Å
2	Y	60.9	Low	58.8	Low	241 Å²	241	142 Å²	142	95%	0.945	76%	0.755	S	S	*	*			trans	-72	96.7	175.9	-89.5	-95.8	0	0	108	C4	Y2-C4 PolarHBondContact O-N 3.15Å
3	H	65.1	Low	58.6	Low	163 Å²	163	142.9 Å²	142.9	76%	0.755	75%	0.749	S	S	*	*			trans	-77.9	85.1	170.1	-171.3	-149.6	0	0	107.5	M1 H5	M1-H3 PolarHBondContact O-N 3.37Å; M1-H3 VanDerWaalsContact O-N 3.08Å; H3-H5 PolarHBondContact O-N 2.98Å
4	C	58.2	Low	58.9	Low	98 Å²	98	134.3 Å²	134.3	66%	0.662	71%	0.711	S	S	*	*			trans	-71.2	99.7	170.1	-155.5	0	0	0	106.7	Y2 S6	Y2-C4 PolarHBondContact O-N 3.15Å; C4-S6 PolarHBondContact O-N 3.24Å
5	H	62	Low	59.3	Low	168 Å²	168	128.7 Å²	128.7	78%	0.778	69%	0.692	S	S	*	*			trans	-66.7	85.5	156.7	-118.6	160.4	0	0	105.1	H3 G7	H3-H5 PolarHBondContact O-N 2.98Å; H5-G7 PolarHBondContact O-N 3.28Å
6	S	57.5	Low	60	Low	93 Å²	93	127.4 Å²	127.4	65%	0.65	69%	0.685	S	S	*	*			trans	-66.1	73.2	166.3	-71.1	0	0	0	107.1	C4 S8	C4-S6 PolarHBondContact O-N 3.24Å; S6-S8 PolarHBondContact O-N 3.41Å
7	G	58.2	Low	61	Low	59 Å²	59	126.5 Å²	126.5	61%	0.608	68%	0.675	S	S	*	*			trans	-65.6	55.6	150.2	0	0	0	0	108.5	H5 K9	H5-G7 PolarHBondContact O-N 3.28Å; G7-K9 PolarHBondContact O-N 3.07Å
8	S	58.7	Low	61.6	Low	98 Å²	98	130.3 Å²	130.3	69%	0.685	68%	0.68	S	S	*	*			trans	-68.3	66.3	157.5	164.7	0	0	0	105.8	S6 P10	S6-S8 PolarHBondContact O-N 3.41Å; S8-P10 WeakPolarHBondContact O-CD 3.33Å; S8-P10 VanDerWaalsContact O-N 3.14Å
9	K	60	Low	62.5	Low	179 Å²	179	125.5 Å²	125.5	78%	0.778	66%	0.661	S	S	*	*			trans	-57.6	117.9	158.9	-56.5	179.2	-174.8	178.7	102.9	G7 T11	G7-K9 PolarHBondContact O-N 3.07Å; K9-T11 VanDerWaalsContact C-N 3.34Å; K9-T11 PolarHBondContact O-N 3.07Å
10	P	57.6	Low	63.4	Low	95 Å²	95	126.8 Å²	126.8	62%	0.617	66%	0.658	S	S	*	*			trans	-56.7	109.9	176.3	22.4	-29.5	0	0	105.3	S8 E12 A15	S8-P10 WeakPolarHBondContact O-CD 3.33Å; S8-P10 VanDerWaalsContact O-N 3.14Å; P10-E12 PolarHBondContact O-N 3.4Å; P10-A15 HydrophobicContact CB-CB 4.5Å
11	T	57.7	Low	64.3	Low	96 Å²	96	123 Å²	123	59%	0.589	65%	0.645	S	S	*	*			trans	-51.7	138.1	168.9	-171.2	0	0	0	105.3	K9 K13 G14 A15	K9-T11 VanDerWaalsContact C-N 3.34Å; K9-T11 PolarHBondContact O-N 3.07Å; T11-K13 HydrophobicContact CG2-CB 4.01Å; T11-K13 CarbonylContact O-C 3.48Å; T11-K13 PolarHBondContact O-N 3.25Å; T11-G14 WeakPolarHBondContact O-CA 3.26Å; T11-G14 PolarHBondContact O-N 3.17Å; T11-A15 PolarHBondContact O-N 3.38Å; T11-A15 VanDerWaalsContact O-N 3.16Å
12	E	57.1	Low	65.7	Low	171 Å²	171	118.1 Å²	118.1	80%	0.799	62%	0.617	S	S	*	*	H	α-helix	trans	-52.2	-28.3	-172.5	-60.5	151.7	97.2	0	111.5	P10 A15 N16	P10-E12 PolarHBondContact O-N 3.4Å; E12-A15 PolarHBondContact O-N 2.92Å; E12-N16 WeakPolarHBondContact O-CB 3.41Å; E12-N16 PolarHBondContact O-N 3.46Å
13	K	56	Low	66.6	Low	154 Å²	154	116.1 Å²	116.1	67%	0.67	61%	0.608	S	S	*	*	H	α-helix	trans	-58.8	-47.2	168.4	-173.5	170.6	-177.3	-71.3	113.5	T11 N16 E17	T11-K13 HydrophobicContact CG2-CB 4.01Å; T11-K13 CarbonylContact O-C 3.48Å; T11-K13 PolarHBondContact O-N 3.25Å; K13-N16 PolarHBondContact O-N 3.43Å; K13-E17 WeakPolarHBondContact O-CG 3.45Å; K13-E17 PolarHBondContact O-N 2.98Å
14	G	63.2	Low	67.5	Low	22 Å²	22	115.2 Å²	115.2	23%	0.227	60%	0.602	C	S	.	*	H	α-helix	trans	-67.4	-36.6	174.2	0	0	0	0	113.5	T11 N16 E17 Y18	T11-G14 WeakPolarHBondContact O-CA 3.26Å; T11-G14 PolarHBondContact O-N 3.17Å; G14-N16 VanDerWaalsContact C-N 3.32Å; G14-N16 PolarHBondContact O-N 3.16Å; G14-E17 PolarHBondContact O-N 3.27Å; G14-Y18 WeakPolarHBondContact O-CB 3.14Å; G14-Y18 VanDerWaalsContact O-CD2 3.27Å; G14-Y18 WeakPolarHBondContact O-CD2 3.4Å; G14-Y18 PolarHBondContact O-N 2.96Å
15	A	64.9	Low	68.6	Low	51 Å²	51	116.6 Å²	116.6	42%	0.421	60%	0.602	S	S	.	*	H	α-helix	trans	-64.9	-37.9	173.5	0	0	0	0	111.8	P10 T11 E12 A19	P10-A15 HydrophobicContact CB-CB 4.5Å; T11-A15 PolarHBondContact O-N 3.38Å; T11-A15 VanDerWaalsContact O-N 3.16Å; E12-A15 PolarHBondContact O-N 2.92Å; A15-A19 VanDerWaalsContact O-CB 3.3Å; A15-A19 WeakPolarHBondContact O-CB 3.49Å; A15-A19 PolarHBondContact O-N 3Å
16	N	70.4	Confident	69.6	Low	107 Å²	107	112 Å²	112	57%	0.572	59%	0.588	S	S	*	*	H	α-helix	trans	-67.1	-43.7	175.2	-168.1	-89	0	0	112.1	E12 K13 G14 Y18 A19 Y20	E12-N16 WeakPolarHBondContact O-CB 3.41Å; E12-N16 PolarHBondContact O-N 3.46Å; K13-N16 PolarHBondContact O-N 3.43Å; G14-N16 VanDerWaalsContact C-N 3.32Å; G14-N16 PolarHBondContact O-N 3.16Å; N16-Y18 PolarHBondContact O-N 3.3Å; N16-A19 PolarHBondContact O-N 3.43Å; N16-Y20 WeakPolarHBondContact O-CB 3.49Å; N16-Y20 PolarHBondContact O-N 3.03Å
17	E	76.3	Confident	71	Confident	113 Å²	113	110.7 Å²	110.7	53%	0.528	58%	0.579	S	S	.	*	H	α-helix	trans	-63.9	-41.1	176.3	-64.1	-75.4	114	0	111.8	K13 G14 Y20 A21	K13-E17 WeakPolarHBondContact O-CG 3.45Å; K13-E17 PolarHBondContact O-N 2.98Å; G14-E17 PolarHBondContact O-N 3.27Å; E17-Y20 PolarHBondContact O-N 3.48Å; E17-A21 VanDerWaalsContact O-CB 3.32Å; E17-A21 WeakPolarHBondContact O-CB 3.31Å; E17-A21 PolarHBondContact O-N 2.92Å
18	Y	72.3	Confident	72.4	Confident	194 Å²	194	110.2 Å²	110.2	76%	0.761	57%	0.57	S	S	*	*	H	α-helix	trans	-65.3	-41.7	173.8	-94.7	-99.3	0	0	112.1	G14 N16 K22	G14-Y18 WeakPolarHBondContact O-CB 3.14Å; G14-Y18 VanDerWaalsContact O-CD2 3.27Å; G14-Y18 WeakPolarHBondContact O-CD2 3.4Å; G14-Y18 PolarHBondContact O-N 2.96Å; N16-Y18 PolarHBondContact O-N 3.3Å; Y18-K22 VanDerWaalsContact O-CB 3.25Å; Y18-K22 WeakPolarHBondContact O-CB 3.5Å; Y18-K22 PolarHBondContact O-N 3.4Å
19	A	78.1	Confident	73.6	Confident	39 Å²	39	108.7 Å²	108.7	32%	0.322	56%	0.559	S	S	.	*	H	α-helix	trans	-62.2	-50.5	174.7	0	0	0	0	110.2	A15 N16 A21 K22 W23	A15-A19 VanDerWaalsContact O-CB 3.3Å; A15-A19 WeakPolarHBondContact O-CB 3.49Å; A15-A19 PolarHBondContact O-N 3Å; N16-A19 PolarHBondContact O-N 3.43Å; A19-A21 PolarHBondContact O-N 2.93Å; A19-K22 CarbonylContact O-C 3.59Å; A19-K22 WeakPolarHBondContact O-CA 3.43Å; A19-K22 WeakPolarHBondContact O-CB 3.5Å; A19-K22 PolarHBondContact O-N 3.34Å; A19-W23 PolarHBondContact O-N 3.37Å
20	Y	79.9	Confident	74.8	Confident	152 Å²	152	102.8 Å²	102.8	60%	0.596	54%	0.543	S	S	*	.	H	α-helix	trans	-56.8	-46.6	178.5	179.8	-105.4	0	0	112.1	N16 E17 K22 W23 K24	N16-Y20 WeakPolarHBondContact O-CB 3.49Å; N16-Y20 PolarHBondContact O-N 3.03Å; E17-Y20 PolarHBondContact O-N 3.48Å; Y20-K22 VanDerWaalsContact C-N 3.34Å; Y20-K22 PolarHBondContact O-N 2.95Å; Y20-W23 PolarHBondContact O-N 2.82Å; Y20-K24 WeakPolarHBondContact O-CB 3.44Å; Y20-K24 PolarHBondContact O-N 3.44Å
21	A	82.3	Confident	76.4	Confident	47 Å²	47	102.3 Å²	102.3	39%	0.388	54%	0.535	S	S	.	.	H	α-helix	trans	-60	-43	174.4	0	0	0	0	112	E17 A19 K24 L25	E17-A21 VanDerWaalsContact O-CB 3.32Å; E17-A21 WeakPolarHBondContact O-CB 3.31Å; E17-A21 PolarHBondContact O-N 2.92Å; A19-A21 PolarHBondContact O-N 2.93Å; A21-K24 PolarHBondContact O-N 3.07Å; A21-L25 WeakPolarHBondContact O-CG 3.25Å; A21-L25 PolarHBondContact O-N 3.39Å
22	K	82.5	Confident	77.6	Confident	140 Å²	140	101.7 Å²	101.7	61%	0.609	53%	0.533	S	S	*	.	H	α-helix	trans	-64.6	-43.3	178	-171.5	174.5	-172.3	-69.4	112.2	Y18 A19 Y20 K24 L25 C26	Y18-K22 VanDerWaalsContact O-CB 3.25Å; Y18-K22 WeakPolarHBondContact O-CB 3.5Å; Y18-K22 PolarHBondContact O-N 3.4Å; A19-K22 CarbonylContact O-C 3.59Å; A19-K22 WeakPolarHBondContact O-CA 3.43Å; A19-K22 WeakPolarHBondContact O-CB 3.5Å; A19-K22 PolarHBondContact O-N 3.34Å; Y20-K22 VanDerWaalsContact C-N 3.34Å; Y20-K22 PolarHBondContact O-N 2.95Å; K22-K24 VanDerWaalsContact C-N 3.35Å; K22-L25 PolarHBondContact O-N 2.9Å; K22-C26 WeakPolarHBondContact O-CB 3.35Å; K22-C26 PolarHBondContact O-N 3.01Å; K22-C26 PolarHBondContact O-SG 2.8Å; K22-C26 VanDerWaalsContact O-SG 3.38Å
23	W	80.9	Confident	78.5	Confident	200 Å²	200	101.4 Å²	101.4	76%	0.758	53%	0.53	S	S	*	.	H	α-helix	trans	-63.6	-40.6	175.6	-79.5	100.6	0	0	111.4	A19 Y20 C26 S27	A19-W23 PolarHBondContact O-N 3.37Å; Y20-W23 PolarHBondContact O-N 2.82Å; W23-C26 PolarHBondContact O-N 2.71Å; W23-S27 WeakPolarHBondContact O-CB 3.3Å; W23-S27 PolarHBondContact O-N 2.81Å
24	K	83.7	Confident	79.9	Confident	143 Å²	143	100.6 Å²	100.6	62%	0.622	53%	0.531	S	S	*	.	H	α-helix	trans	-64.5	-42.8	177	-161.2	-178.3	-174.9	-160.6	112.4	Y20 A21 K22 A28	Y20-K24 WeakPolarHBondContact O-CB 3.44Å; Y20-K24 PolarHBondContact O-N 3.44Å; A21-K24 PolarHBondContact O-N 3.07Å; K22-K24 VanDerWaalsContact C-N 3.35Å; K24-A28 WeakPolarHBondContact O-CB 3.43Å; K24-A28 PolarHBondContact O-N 3.16Å
25	L	81.4	Confident	80.7	Confident	128 Å²	128	107.8 Å²	107.8	67%	0.67	56%	0.557	S	S	*	*	H	α-helix	trans	-65.7	-44.9	175.6	-80.3	158.4	0	0	112.1	A21 K22 S27 A28 S29	A21-L25 WeakPolarHBondContact O-CG 3.25Å; A21-L25 PolarHBondContact O-N 3.39Å; K22-L25 PolarHBondContact O-N 2.9Å; L25-S27 VanDerWaalsContact C-N 3.34Å; L25-S27 PolarHBondContact O-N 3.4Å; L25-A28 PolarHBondContact O-N 2.96Å; L25-S29 PolarHBondContact O-N 2.79Å
26	C	83.3	Confident	80.9	Confident	70 Å²	70	115.9 Å²	115.9	47%	0.473	59%	0.589	S	S	.	*	H	α-helix	trans	-62.2	-41.4	176.3	-76.3	0	0	0	111.9	K22 W23 S29 A30	K22-C26 WeakPolarHBondContact O-CB 3.35Å; K22-C26 PolarHBondContact O-N 3.01Å; K22-C26 PolarHBondContact O-SG 2.8Å; K22-C26 VanDerWaalsContact O-SG 3.38Å; W23-C26 PolarHBondContact O-N 2.71Å; C26-S29 PolarHBondContact O-N 3.27Å; C26-A30 WeakPolarHBondContact O-CB 3.37Å; C26-A30 PolarHBondContact O-N 3.37Å
27	S	86.9	Confident	81.4	Confident	66 Å²	66	116.4 Å²	116.4	46%	0.462	59%	0.589	S	S	.	*	H	α-helix	trans	-63.1	-49.8	176.7	-173	0	0	0	111.4	W23 L25 S29 A30 I31	W23-S27 WeakPolarHBondContact O-CB 3.3Å; W23-S27 PolarHBondContact O-N 2.81Å; L25-S27 VanDerWaalsContact C-N 3.34Å; L25-S27 PolarHBondContact O-N 3.4Å; S27-S29 VanDerWaalsContact C-N 3.29Å; S27-S29 PolarHBondContact O-N 2.91Å; S27-A30 PolarHBondContact O-N 2.94Å; S27-A30 VanDerWaalsContact O-N 3.15Å; S27-I31 VanDerWaalsContact O-CD1 3.31Å; S27-I31 WeakPolarHBondContact O-CD1 3.27Å; S27-I31 WeakPolarHBondContact O-CG1 3.33Å; S27-I31 PolarHBondContact O-N 3.06Å
28	A	87.6	Confident	81.7	Confident	50 Å²	50	116.5 Å²	116.5	41%	0.413	59%	0.593	S	S	.	*	H	α-helix	trans	-55.8	-43.2	176	0	0	0	0	112.4	K24 L25 I31 C32	K24-A28 WeakPolarHBondContact O-CB 3.43Å; K24-A28 PolarHBondContact O-N 3.16Å; L25-A28 PolarHBondContact O-N 2.96Å; A28-I31 PolarHBondContact O-N 3.43Å; A28-C32 PolarHBondContact O-N 3.5Å; A28-C32 VanDerWaalsContact O-N 3.07Å; A28-C32 PolarHBondContact O-SG 3.46Å
29	S	83.1	Confident	82.2	Confident	66 Å²	66	112.2 Å²	112.2	46%	0.462	58%	0.583	S	S	.	*	H	α-helix	trans	-65	-41.3	177.4	-172.3	0	0	0	112.9	L25 C26 S27 I31 C32 F33	L25-S29 PolarHBondContact O-N 2.79Å; C26-S29 PolarHBondContact O-N 3.27Å; S27-S29 VanDerWaalsContact C-N 3.29Å; S27-S29 PolarHBondContact O-N 2.91Å; S29-I31 VanDerWaalsContact C-N 3.35Å; S29-C32 PolarHBondContact O-N 3.5Å; S29-F33 PolarHBondContact O-N 2.99Å
30	A	86.8	Confident	82.4	Confident	55 Å²	55	116.5 Å²	116.5	46%	0.455	60%	0.599	S	S	.	*	H	α-helix	trans	-65.8	-39.4	177.9	0	0	0	0	111.5	C26 S27 F33 I34	C26-A30 WeakPolarHBondContact O-CB 3.37Å; C26-A30 PolarHBondContact O-N 3.37Å; S27-A30 PolarHBondContact O-N 2.94Å; S27-A30 VanDerWaalsContact O-N 3.15Å; A30-F33 WeakPolarHBondContact O-CB 3.33Å; A30-F33 PolarHBondContact O-N 2.79Å; A30-F33 VanDerWaalsContact O-N 3.16Å; A30-I34 WeakPolarHBondContact O-CG1 3.16Å; A30-I34 PolarHBondContact O-N 2.68Å
31	I	89.6	Confident	82.6	Confident	85 Å²	85	114.3 Å²	114.3	44%	0.436	60%	0.599	S	S	.	*	H	α-helix	trans	-61.4	-47	176.1	-61.3	158.2	0	0	109.8	S27 A28 S29 F33 I34 F35	S27-I31 VanDerWaalsContact O-CD1 3.31Å; S27-I31 WeakPolarHBondContact O-CD1 3.27Å; S27-I31 WeakPolarHBondContact O-CG1 3.33Å; S27-I31 PolarHBondContact O-N 3.06Å; A28-I31 PolarHBondContact O-N 3.43Å; S29-I31 VanDerWaalsContact C-N 3.35Å; I31-F33 PolarHBondContact O-N 3.35Å; I31-I34 PolarHBondContact O-N 2.89Å; I31-I34 VanDerWaalsContact O-N 3.07Å; I31-F35 HydrophobicContact CG2-CD2 3.65Å; I31-F35 HydrophobicContact CG2-CE2 3.67Å; I31-F35 VanDerWaalsContact O-CD2 3.26Å; I31-F35 WeakPolarHBondContact O-CD2 3.32Å; I31-F35 PolarHBondContact O-N 2.84Å
32	C	82.8	Confident	82.6	Confident	83 Å²	83	118.8 Å²	118.8	56%	0.561	61%	0.613	S	S	*	*	H	α-helix	trans	-58.4	-29.5	176.2	-67.2	0	0	0	113.7	A28 S29 M36	A28-C32 PolarHBondContact O-N 3.5Å; A28-C32 VanDerWaalsContact O-N 3.07Å; A28-C32 PolarHBondContact O-SG 3.46Å; S29-C32 PolarHBondContact O-N 3.5Å; C32-M36 WeakPolarHBondContact O-CG 3.39Å; C32-M36 PolarHBondContact O-N 3.08Å
33	F	77.1	Confident	82.6	Confident	164 Å²	164	117.3 Å²	117.3	72%	0.719	61%	0.613	S	S	*	*	H	α-helix	trans	-76.2	-26.3	176.5	-102.8	-81.2	0	0	114.3	S29 A30 I31	S29-F33 PolarHBondContact O-N 2.99Å; A30-F33 WeakPolarHBondContact O-CB 3.33Å; A30-F33 PolarHBondContact O-N 2.79Å; A30-F33 VanDerWaalsContact O-N 3.16Å; I31-F33 PolarHBondContact O-N 3.35Å
34	I	85.4	Confident	82.7	Confident	137 Å²	137	110.9 Å²	110.9	70%	0.703	60%	0.602	S	S	*	*	H	α-helix	trans	-81.1	-30.7	179.2	-62.9	-76.7	0	0	111.1	A30 I31	A30-I34 WeakPolarHBondContact O-CG1 3.16Å; A30-I34 PolarHBondContact O-N 2.68Å; I31-I34 PolarHBondContact O-N 2.89Å; I31-I34 VanDerWaalsContact O-N 3.07Å
35	F	79.8	Confident	82.6	Confident	174 Å²	174	108.3 Å²	108.3	76%	0.763	60%	0.6	S	S	*	*			trans	-96.4	-0.4	-176.9	-71.4	-76.8	0	0	114.2	I31	I31-F35 HydrophobicContact CG2-CD2 3.65Å; I31-F35 HydrophobicContact CG2-CE2 3.67Å; I31-F35 VanDerWaalsContact O-CD2 3.26Å; I31-F35 WeakPolarHBondContact O-CD2 3.32Å; I31-F35 PolarHBondContact O-N 2.84Å
36	M	68.1	Low	82.7	Confident	221 Å²	221	106.5 Å²	106.5	100%	1.089	59%	0.594	S	S	*	*			trans	-92.4	0	164.5	-82	-84.1	-169	0	109.2	C32	C32-M36 WeakPolarHBondContact O-CG 3.39Å; C32-M36 PolarHBondContact O-N 3.08Å

Retrieved 36 of 36 residues in 29.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).