A0A096LNU3_HUMAN Loading...

Aquaporin 7

AlphaFold DB , UniProt , Accession A0A096LNU3, Species HUMAN (Homo sapiens, Human), Gene AQP7, Length 51 aa.

						>A0A096LNU3_HUMAN|A0A096LNU3|AQP7
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMEPT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.8	Very low	57.3	Low	247 Å²	247	154.5 Å²	154.5	100%	1.217	84%	0.837	S	S	*	*				0	109.9	0	-86.7	170	137.2	0	0	108.3
2	V	50.3	Low	58.1	Low	137 Å²	137	160.8 Å²	160.8	83%	0.83	84%	0.839	S	S	*	*			trans	-83.2	120.9	178.6	167.1	0	0	0	0	107.9	A4	V2-A4 HydrophobicContact CG1-CB 4.33Å
3	Q	49.2	Very low	58.4	Low	193 Å²	193	153.4 Å²	153.4	90%	0.902	83%	0.826	S	S	*	*			trans	-109.9	90.7	158.7	-80.4	-169	48.5	0	0	107.5	S5	Q3-S5 PolarHBondContact O-N 3.37Å; Q3-S5 VanDerWaalsContact O-N 3.16Å
4	A	55.6	Low	59.1	Low	86 Å²	86	150.1 Å²	150.1	71%	0.711	82%	0.821	S	S	*	*			trans	-65.9	108.7	164.3	0	0	0	0	0	106.9	V2 G6	V2-A4 HydrophobicContact CG1-CB 4.33Å; A4-G6 VanDerWaalsContact C-N 3.33Å; A4-G6 PolarHBondContact O-N 2.87Å
5	S	59.1	Low	60	Low	118 Å²	118	153.7 Å²	153.7	83%	0.825	83%	0.825	S	S	*	*			trans	-60	97.4	173.2	42.6	0	0	0	0	108.6	Q3 H7	Q3-S5 PolarHBondContact O-N 3.37Å; Q3-S5 VanDerWaalsContact O-N 3.16Å; S5-H7 PolarHBondContact O-N 3.49Å
6	G	58.8	Low	61	Low	70 Å²	70	154.8 Å²	154.8	72%	0.722	83%	0.826	S	S	*	*			trans	-54.3	112.2	-179	0	0	0	0	0	110.2	A4 R8	A4-G6 VanDerWaalsContact C-N 3.33Å; A4-G6 PolarHBondContact O-N 2.87Å; G6-R8 PolarHBondContact O-N 3.31Å
7	H	60.8	Low	62	Low	159 Å²	159	150.8 Å²	150.8	74%	0.736	81%	0.808	S	S	*	*			trans	-59.4	88.2	168.9	-175.9	79.8	0	0	0	108.5	S5 R9	S5-H7 PolarHBondContact O-N 3.49Å; H7-R9 VanDerWaalsContact C-N 3.26Å; H7-R9 PolarHBondContact O-N 3.44Å
8	R	62.6	Low	63.3	Low	242 Å²	242	146.1 Å²	146.1	91%	0.913	79%	0.789	S	S	*	*			trans	-64.6	92.9	167.7	-102.4	-173.3	170.5	-162.2	-1.1	106.4	G6 S10	G6-R8 PolarHBondContact O-N 3.31Å; R8-S10 VanDerWaalsContact C-N 3.35Å; R8-S10 PolarHBondContact O-N 3.39Å
9	R	66.3	Low	64.7	Low	208 Å²	208	148.8 Å²	148.8	79%	0.785	79%	0.787	S	S	*	*			trans	-52.9	107.2	161.3	-77.5	-176.8	-161.3	120.3	5	106.2	H7 T11	H7-R9 VanDerWaalsContact C-N 3.26Å; H7-R9 PolarHBondContact O-N 3.44Å; R9-T11 VanDerWaalsContact C-N 3.3Å; R9-T11 PolarHBondContact O-N 3Å
10	S	66.3	Low	65.9	Low	106 Å²	106	145.5 Å²	145.5	74%	0.741	78%	0.776	S	S	*	*			trans	-60.9	101.2	164.6	179.5	0	0	0	0	105.8	R8 R12	R8-S10 VanDerWaalsContact C-N 3.35Å; R8-S10 PolarHBondContact O-N 3.39Å; S10-R12 PolarHBondContact O-N 2.91Å
11	T	66.1	Low	67	Low	134 Å²	134	141.6 Å²	141.6	82%	0.822	76%	0.758	S	S	*	*			trans	-65.6	79.6	159.1	34.8	0	0	0	0	105.7	R9 G13	R9-T11 VanDerWaalsContact C-N 3.3Å; R9-T11 PolarHBondContact O-N 3Å; T11-G13 VanDerWaalsContact C-N 3.31Å; T11-G13 WeakPolarHBondContact O-CA 3.06Å; T11-G13 PolarHBondContact O-N 3.02Å
12	R	67	Low	69.6	Low	230 Å²	230	132.9 Å²	132.9	87%	0.868	72%	0.715	S	S	*	*			trans	-49.7	102.1	170.5	178.4	-179.9	175.2	-175.5	-0.5	105.7	S10 S14	S10-R12 PolarHBondContact O-N 2.91Å; R12-S14 PolarHBondContact O-N 2.89Å
13	G	62.7	Low	71.6	Confident	64 Å²	64	128.3 Å²	128.3	66%	0.66	69%	0.692	S	S	*	*			trans	-50.8	108.5	-164.3	0	0	0	0	0	110.4	T11 K15	T11-G13 VanDerWaalsContact C-N 3.31Å; T11-G13 WeakPolarHBondContact O-CA 3.06Å; T11-G13 PolarHBondContact O-N 3.02Å; G13-K15 PolarHBondContact O-N 3.33Å
14	S	67.9	Low	73.7	Confident	108 Å²	108	125.7 Å²	125.7	76%	0.755	68%	0.678	S	S	*	*			trans	-62.1	107.6	165.4	-176.1	0	0	0	0	105.2	R12 M16	R12-S14 PolarHBondContact O-N 2.89Å; S14-M16 VanDerWaalsContact C-N 3.25Å; S14-M16 PolarHBondContact O-N 3.44Å
15	K	72.4	Confident	75.3	Confident	203 Å²	203	125.8 Å²	125.8	88%	0.883	67%	0.665	S	S	*	*			trans	-66.3	93.7	176.3	-71.3	-176.9	178.2	-178.5	0	106.5	G13 V17	G13-K15 PolarHBondContact O-N 3.33Å; K15-V17 PolarHBondContact O-N 3.36Å
16	M	76.3	Confident	76.7	Confident	172 Å²	172	125.2 Å²	125.2	85%	0.847	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-60.4	124.9	172.5	-78	178.8	71.2	0	0	107.7	S14 S18	S14-M16 VanDerWaalsContact C-N 3.25Å; S14-M16 PolarHBondContact O-N 3.44Å; M16-S18 PolarHBondContact O-N 3Å
17	V	78.6	Confident	78.4	Confident	86 Å²	86	126.2 Å²	126.2	52%	0.521	64%	0.635	S	S	.	*	P	Polyproline II helix	trans	-56.1	132.4	172.6	171.3	0	0	0	0	107.8	K15 V21 I22	K15-V17 PolarHBondContact O-N 3.36Å; V17-V21 HydrophobicContact CG1-CB 3.52Å; V17-V21 HydrophobicContact CG1-CG1 3.41Å; V17-V21 VanDerWaalsContact CG1-CG1 3.41Å; V17-I22 HydrophobicContact CB-CG1 4.49Å; V17-I22 HydrophobicContact CG1-CG1 3.92Å
18	S	85.3	Confident	79.8	Confident	66 Å²	66	123.2 Å²	123.2	46%	0.462	62%	0.624	S	S	.	*	P	Polyproline II helix	trans	-63.4	147.8	-179.2	64.5	0	0	0	0	110.6	M16 S20 V21 I22	M16-S18 PolarHBondContact O-N 3Å; S18-S20 PolarHBondContact O-N 3.19Å; S18-S20 VanDerWaalsContact O-N 3.15Å; S18-V21 WeakPolarHBondContact O-CB 3.4Å; S18-V21 PolarHBondContact O-N 3.37Å; S18-V21 WeakPolarHBondContact OG-CG2 3.42Å; S18-I22 PolarHBondContact O-N 3.4Å
19	W	88.3	Confident	80.9	Confident	199 Å²	199	116.1 Å²	116.1	75%	0.754	60%	0.603	S	S	*	*	H	α-helix	trans	-51.6	-38.9	177.6	-177.4	-104.8	0	0	0	112.8	V21 I22 A23	W19-V21 VanDerWaalsContact C-N 3.28Å; W19-V21 PolarHBondContact O-N 2.87Å; W19-I22 PolarHBondContact O-N 2.89Å; W19-A23 PolarHBondContact O-N 3.01Å
20	S	89.5	Confident	82	Confident	81 Å²	81	112.1 Å²	112.1	57%	0.566	59%	0.594	S	S	*	*	H	α-helix	trans	-60.8	-34.7	177.1	-46.7	0	0	0	0	113.4	S18 K24	S18-S20 PolarHBondContact O-N 3.19Å; S18-S20 VanDerWaalsContact O-N 3.15Å; S20-K24 WeakPolarHBondContact O-CG 3.08Å; S20-K24 PolarHBondContact O-N 2.91Å
21	V	89.3	Confident	83.1	Confident	65 Å²	65	114.8 Å²	114.8	39%	0.394	59%	0.587	S	S	.	*	H	α-helix	trans	-75.1	-38.2	177	172.1	0	0	0	0	110.3	V17 S18 W19 K24 I25	V17-V21 HydrophobicContact CG1-CB 3.52Å; V17-V21 HydrophobicContact CG1-CG1 3.41Å; V17-V21 VanDerWaalsContact CG1-CG1 3.41Å; S18-V21 WeakPolarHBondContact O-CB 3.4Å; S18-V21 PolarHBondContact O-N 3.37Å; S18-V21 WeakPolarHBondContact OG-CG2 3.42Å; W19-V21 VanDerWaalsContact C-N 3.28Å; W19-V21 PolarHBondContact O-N 2.87Å; V21-K24 PolarHBondContact O-N 2.96Å; V21-I25 HydrophobicContact CG1-CD1 3.86Å; V21-I25 HydrophobicContact CG1-CG1 4.48Å; V21-I25 VanDerWaalsContact O-CG1 3.28Å; V21-I25 WeakPolarHBondContact O-CG1 3.43Å; V21-I25 PolarHBondContact O-N 3.11Å
22	I	89.4	Confident	84	Confident	64 Å²	64	114.3 Å²	114.3	33%	0.328	57%	0.574	S	S	.	*	H	α-helix	trans	-60.8	-46.7	174.9	-61	175.4	0	0	0	110.5	V17 S18 W19 K24 I25 Q26	V17-I22 HydrophobicContact CB-CG1 4.49Å; V17-I22 HydrophobicContact CG1-CG1 3.92Å; S18-I22 PolarHBondContact O-N 3.4Å; W19-I22 PolarHBondContact O-N 2.89Å; I22-K24 PolarHBondContact O-N 3.42Å; I22-I25 PolarHBondContact O-N 3.44Å; I22-Q26 WeakPolarHBondContact O-CG 3.24Å; I22-Q26 PolarHBondContact O-N 2.93Å
23	A	91.4	Very high	84.9	Confident	40 Å²	40	108.8 Å²	108.8	33%	0.331	56%	0.559	S	S	.	*	H	α-helix	trans	-59.8	-43.2	177.8	0	0	0	0	0	112.3	W19 I25 Q26 E27	W19-A23 PolarHBondContact O-N 3.01Å; A23-I25 PolarHBondContact O-N 3.46Å; A23-Q26 PolarHBondContact O-N 2.84Å; A23-E27 PolarHBondContact O-N 3.38Å
24	K	93.3	Very high	86	Confident	139 Å²	139	110.2 Å²	110.2	60%	0.604	56%	0.555	S	S	*	*	H	α-helix	trans	-62.4	-41.7	175.6	-77.1	178.8	177.1	-176.4	0	112.5	S20 V21 I22 E27 I28	S20-K24 WeakPolarHBondContact O-CG 3.08Å; S20-K24 PolarHBondContact O-N 2.91Å; V21-K24 PolarHBondContact O-N 2.96Å; I22-K24 PolarHBondContact O-N 3.42Å; K24-E27 PolarHBondContact O-N 3.24Å; K24-I28 WeakPolarHBondContact O-CD1 3Å; K24-I28 VanDerWaalsContact O-CG1 3.28Å; K24-I28 WeakPolarHBondContact O-CG1 3.33Å; K24-I28 PolarHBondContact O-N 2.99Å; K24-I28 VanDerWaalsContact O-N 3.09Å
25	I	90.6	Very high	86.8	Confident	88 Å²	88	114.5 Å²	114.5	45%	0.451	55%	0.554	S	S	.	*	H	α-helix	trans	-63.3	-45.5	177.2	-69.6	165.7	0	0	0	110	V21 I22 A23 E27 I28 L29	V21-I25 HydrophobicContact CG1-CD1 3.86Å; V21-I25 HydrophobicContact CG1-CG1 4.48Å; V21-I25 VanDerWaalsContact O-CG1 3.28Å; V21-I25 WeakPolarHBondContact O-CG1 3.43Å; V21-I25 PolarHBondContact O-N 3.11Å; I22-I25 PolarHBondContact O-N 3.44Å; A23-I25 PolarHBondContact O-N 3.46Å; I25-E27 PolarHBondContact O-N 3.46Å; I25-I28 PolarHBondContact O-N 3.44Å; I25-L29 HydrophobicContact CG2-CD1 3.8Å; I25-L29 HydrophobicContact CG2-CG 4.35Å; I25-L29 WeakPolarHBondContact O-CB 3.31Å; I25-L29 VanDerWaalsContact O-CG 3.27Å; I25-L29 WeakPolarHBondContact O-CG 3.23Å; I25-L29 PolarHBondContact O-N 3.28Å
26	Q	88.9	Confident	87.6	Confident	106 Å²	106	111 Å²	111	50%	0.495	54%	0.542	S	S	.	.	H	α-helix	trans	-60.7	-44.3	177.4	-73.5	177.2	-36.3	0	0	112.1	I22 A23 I28 L29 Q30	I22-Q26 WeakPolarHBondContact O-CG 3.24Å; I22-Q26 PolarHBondContact O-N 2.93Å; A23-Q26 PolarHBondContact O-N 2.84Å; Q26-I28 PolarHBondContact O-N 3.41Å; Q26-L29 PolarHBondContact O-N 2.94Å; Q26-Q30 WeakPolarHBondContact O-CB 3.27Å; Q26-Q30 WeakPolarHBondContact O-CG 3.39Å; Q26-Q30 PolarHBondContact O-N 3.37Å
27	E	93	Very high	87.8	Confident	91 Å²	91	109.3 Å²	109.3	43%	0.425	53%	0.53	S	S	.	.	H	α-helix	trans	-61.1	-44.2	177.8	-172.5	-174.1	171.3	0	0	112.1	A23 K24 I25 Q30 R31	A23-E27 PolarHBondContact O-N 3.38Å; K24-E27 PolarHBondContact O-N 3.24Å; I25-E27 PolarHBondContact O-N 3.46Å; E27-Q30 PolarHBondContact O-N 2.64Å; E27-R31 WeakPolarHBondContact O-CG 3.27Å; E27-R31 PolarHBondContact O-N 3.42Å; E27-R31 IonicContact OE1-CZ 3.24Å; E27-R31 VanDerWaalsContact OE1-CZ 3.24Å; E27-R31 IonicContact OE1-NE 3.42Å; E27-R31 PolarHBondContact OE1-NE 2.95Å; E27-R31 IonicContact OE1-NH2 2.64Å; E27-R31 PolarHBondContact OE1-NH2 3.46Å
28	I	91.1	Very high	88.1	Confident	96 Å²	96	109.9 Å²	109.9	49%	0.492	53%	0.529	S	S	.	.	H	α-helix	trans	-63.8	-44.2	177.7	-68	165.9	0	0	0	110.7	K24 I25 Q26 R31 K32	K24-I28 WeakPolarHBondContact O-CD1 3Å; K24-I28 VanDerWaalsContact O-CG1 3.28Å; K24-I28 WeakPolarHBondContact O-CG1 3.33Å; K24-I28 PolarHBondContact O-N 2.99Å; K24-I28 VanDerWaalsContact O-N 3.09Å; I25-I28 PolarHBondContact O-N 3.44Å; Q26-I28 PolarHBondContact O-N 3.41Å; I28-R31 PolarHBondContact O-N 3.48Å; I28-K32 PolarHBondContact O-N 3.3Å; I28-K32 VanDerWaalsContact O-N 3.09Å
29	L	85.9	Confident	88.2	Confident	93 Å²	93	109.7 Å²	109.7	49%	0.487	53%	0.531	S	S	.	.	H	α-helix	trans	-63.9	-44.4	178.4	-70.9	172.8	0	0	0	111.3	I25 Q26 R31 K32 M33	I25-L29 HydrophobicContact CG2-CD1 3.8Å; I25-L29 HydrophobicContact CG2-CG 4.35Å; I25-L29 WeakPolarHBondContact O-CB 3.31Å; I25-L29 VanDerWaalsContact O-CG 3.27Å; I25-L29 WeakPolarHBondContact O-CG 3.23Å; I25-L29 PolarHBondContact O-N 3.28Å; Q26-L29 PolarHBondContact O-N 2.94Å; L29-R31 PolarHBondContact O-N 3.45Å; L29-K32 PolarHBondContact O-N 2.86Å; L29-M33 WeakPolarHBondContact O-CG 3.25Å; L29-M33 PolarHBondContact O-N 2.93Å
30	Q	88.8	Confident	88.1	Confident	124 Å²	124	106.7 Å²	106.7	58%	0.579	53%	0.526	S	S	*	.	H	α-helix	trans	-60.5	-44.8	176.1	-76.7	-173.6	-34.4	0	0	112.1	Q26 E27 K32 M33 V34	Q26-Q30 WeakPolarHBondContact O-CB 3.27Å; Q26-Q30 WeakPolarHBondContact O-CG 3.39Å; Q26-Q30 PolarHBondContact O-N 3.37Å; E27-Q30 PolarHBondContact O-N 2.64Å; Q30-K32 VanDerWaalsContact C-N 3.3Å; Q30-K32 PolarHBondContact O-N 3.32Å; Q30-M33 HydrophobicContact CG-CE 4.29Å; Q30-M33 PolarHBondContact O-N 3.37Å; Q30-V34 VanDerWaalsContact O-CG2 3.27Å; Q30-V34 WeakPolarHBondContact O-CG2 3.13Å; Q30-V34 PolarHBondContact O-N 3.09Å
31	R	88.6	Confident	87.7	Confident	161 Å²	161	108 Å²	108	61%	0.608	52%	0.522	S	S	*	.	H	α-helix	trans	-61.6	-37.2	176.9	-73.6	177.7	-176	-161.2	2.3	112.7	E27 I28 L29 R35	E27-R31 WeakPolarHBondContact O-CG 3.27Å; E27-R31 PolarHBondContact O-N 3.42Å; E27-R31 IonicContact OE1-CZ 3.24Å; E27-R31 VanDerWaalsContact OE1-CZ 3.24Å; E27-R31 IonicContact OE1-NE 3.42Å; E27-R31 PolarHBondContact OE1-NE 2.95Å; E27-R31 IonicContact OE1-NH2 2.64Å; E27-R31 PolarHBondContact OE1-NH2 3.46Å; I28-R31 PolarHBondContact O-N 3.48Å; L29-R31 PolarHBondContact O-N 3.45Å; R31-R35 WeakPolarHBondContact O-CG 3.5Å; R31-R35 PolarHBondContact O-N 3.43Å
32	K	85.6	Confident	87.5	Confident	124 Å²	124	109 Å²	109	54%	0.539	52%	0.523	S	S	.	.	H	α-helix	trans	-67.8	-48.4	175.6	-76.2	-176.4	172.1	-172.1	0	111.5	I28 L29 Q30 V34 R35 E36	I28-K32 PolarHBondContact O-N 3.3Å; I28-K32 VanDerWaalsContact O-N 3.09Å; L29-K32 PolarHBondContact O-N 2.86Å; Q30-K32 VanDerWaalsContact C-N 3.3Å; Q30-K32 PolarHBondContact O-N 3.32Å; K32-V34 VanDerWaalsContact C-N 3.32Å; K32-V34 PolarHBondContact O-N 3.46Å; K32-R35 PolarHBondContact O-N 2.99Å; K32-R35 VanDerWaalsContact O-N 3.11Å; K32-E36 PolarHBondContact O-N 3.17Å
33	M	87.1	Confident	87.1	Confident	115 Å²	115	109 Å²	109	57%	0.567	53%	0.529	S	S	*	.	H	α-helix	trans	-60.5	-40.4	178.4	-69.7	-170.1	-55.7	0	0	112.2	L29 Q30 R35 E36 F37	L29-M33 WeakPolarHBondContact O-CG 3.25Å; L29-M33 PolarHBondContact O-N 2.93Å; Q30-M33 HydrophobicContact CG-CE 4.29Å; Q30-M33 PolarHBondContact O-N 3.37Å; M33-R35 VanDerWaalsContact C-N 3.31Å; M33-R35 PolarHBondContact O-N 3.24Å; M33-E36 PolarHBondContact O-N 3.23Å; M33-F37 WeakPolarHBondContact O-CB 3.35Å; M33-F37 PolarHBondContact O-N 2.93Å
34	V	85	Confident	86.3	Confident	93 Å²	93	110.5 Å²	110.5	56%	0.564	53%	0.534	S	S	*	.	H	α-helix	trans	-63	-38.3	176.5	170.2	0	0	0	0	111.6	Q30 K32 L38	Q30-V34 VanDerWaalsContact O-CG2 3.27Å; Q30-V34 WeakPolarHBondContact O-CG2 3.13Å; Q30-V34 PolarHBondContact O-N 3.09Å; K32-V34 VanDerWaalsContact C-N 3.32Å; K32-V34 PolarHBondContact O-N 3.46Å; V34-L38 VanDerWaalsContact O-CB 3.24Å; V34-L38 WeakPolarHBondContact O-CB 3.36Å; V34-L38 PolarHBondContact O-N 3.42Å
35	R	85.4	Confident	85.2	Confident	198 Å²	198	111.1 Å²	111.1	75%	0.747	53%	0.533	S	S	*	.	H	α-helix	trans	-68.8	-45	177.6	-75.8	177.6	173.7	-166.1	-2.4	112.2	R31 K32 M33 L38 A39	R31-R35 WeakPolarHBondContact O-CG 3.5Å; R31-R35 PolarHBondContact O-N 3.43Å; K32-R35 PolarHBondContact O-N 2.99Å; K32-R35 VanDerWaalsContact O-N 3.11Å; M33-R35 VanDerWaalsContact C-N 3.31Å; M33-R35 PolarHBondContact O-N 3.24Å; R35-L38 PolarHBondContact O-N 3.34Å; R35-A39 WeakPolarHBondContact O-CB 3.35Å; R35-A39 PolarHBondContact O-N 3.33Å
36	E	87.4	Confident	84.2	Confident	131 Å²	131	111.2 Å²	111.2	61%	0.612	54%	0.538	S	S	*	.	H	α-helix	trans	-64	-45.7	177.3	-71.9	169.6	-170.2	0	0	110.8	K32 M33 L38 A39 E40	K32-E36 PolarHBondContact O-N 3.17Å; M33-E36 PolarHBondContact O-N 3.23Å; E36-L38 PolarHBondContact O-N 3.32Å; E36-A39 PolarHBondContact O-N 3.48Å; E36-E40 WeakPolarHBondContact O-CB 3.35Å; E36-E40 PolarHBondContact O-N 3.34Å
37	F	82.1	Confident	83.3	Confident	136 Å²	136	114 Å²	114	60%	0.596	55%	0.553	S	S	*	*	H	α-helix	trans	-57.9	-47.7	174.6	175.8	-98	0	0	0	112.2	M33 A39 E40 F41	M33-F37 WeakPolarHBondContact O-CB 3.35Å; M33-F37 PolarHBondContact O-N 2.93Å; F37-A39 VanDerWaalsContact C-N 3.32Å; F37-A39 PolarHBondContact O-N 2.94Å; F37-E40 PolarHBondContact O-N 3.09Å; F37-F41 VanDerWaalsContact O-CB 3.27Å; F37-F41 WeakPolarHBondContact O-CB 3.38Å; F37-F41 PolarHBondContact O-N 3.15Å
38	L	85.3	Confident	82.1	Confident	97 Å²	97	116.6 Å²	116.6	51%	0.508	57%	0.567	S	S	.	*	H	α-helix	trans	-65.6	-37	179.3	-175.2	62.7	0	0	0	111.7	V34 R35 E36 M42	V34-L38 VanDerWaalsContact O-CB 3.24Å; V34-L38 WeakPolarHBondContact O-CB 3.36Å; V34-L38 PolarHBondContact O-N 3.42Å; R35-L38 PolarHBondContact O-N 3.34Å; E36-L38 PolarHBondContact O-N 3.32Å; L38-M42 HydrophobicContact CD1-CG 4.14Å; L38-M42 HydrophobicContact CG-CG 4.3Å; L38-M42 VanDerWaalsContact O-CB 3.31Å; L38-M42 WeakPolarHBondContact O-CB 3.4Å; L38-M42 WeakPolarHBondContact O-CG 3.5Å; L38-M42 PolarHBondContact O-N 3.25Å
39	A	87.3	Confident	80.7	Confident	62 Å²	62	118.3 Å²	118.3	51%	0.512	57%	0.573	S	S	.	*	H	α-helix	trans	-65.8	-42.6	176.5	0	0	0	0	0	112	R35 E36 F37 S43	R35-A39 WeakPolarHBondContact O-CB 3.35Å; R35-A39 PolarHBondContact O-N 3.33Å; E36-A39 PolarHBondContact O-N 3.48Å; F37-A39 VanDerWaalsContact C-N 3.32Å; F37-A39 PolarHBondContact O-N 2.94Å; A39-S43 WeakPolarHBondContact O-CB 3.43Å; A39-S43 PolarHBondContact O-N 2.9Å; A39-S43 PolarHBondContact O-OG 3.2Å
40	E	85.4	Confident	79.8	Confident	136 Å²	136	119.6 Å²	119.6	64%	0.636	59%	0.587	S	S	*	*	H	α-helix	trans	-68.4	-39.2	176.2	-173.7	174.1	-172.3	0	0	112.4	E36 F37 S43 T44	E36-E40 WeakPolarHBondContact O-CB 3.35Å; E36-E40 PolarHBondContact O-N 3.34Å; F37-E40 PolarHBondContact O-N 3.09Å; E40-S43 PolarHBondContact O-OG 2.97Å; E40-T44 PolarHBondContact O-N 3Å; E40-T44 PolarHBondContact O-OG1 2.93Å
41	F	80.8	Confident	78.6	Confident	110 Å²	110	123.4 Å²	123.4	48%	0.482	62%	0.619	S	S	.	*	H	α-helix	trans	-62.8	-48.3	174.6	-175.3	-98	0	0	0	111.3	F37 T44 Y45	F37-F41 VanDerWaalsContact O-CB 3.27Å; F37-F41 WeakPolarHBondContact O-CB 3.38Å; F37-F41 PolarHBondContact O-N 3.15Å; F41-T44 PolarHBondContact O-N 3.19Å; F41-Y45 WeakPolarHBondContact O-CB 3.38Å; F41-Y45 PolarHBondContact O-N 3.36Å
42	M	84.7	Confident	78.1	Confident	85 Å²	85	121.5 Å²	121.5	42%	0.419	62%	0.619	S	S	.	*	H	α-helix	trans	-67.9	-36.5	179.4	-67.4	-94.1	76	0	0	112.2	L38 T44 Y45 V46	L38-M42 HydrophobicContact CD1-CG 4.14Å; L38-M42 HydrophobicContact CG-CG 4.3Å; L38-M42 VanDerWaalsContact O-CB 3.31Å; L38-M42 WeakPolarHBondContact O-CB 3.4Å; L38-M42 WeakPolarHBondContact O-CG 3.5Å; L38-M42 PolarHBondContact O-N 3.25Å; M42-T44 VanDerWaalsContact C-N 3.3Å; M42-T44 PolarHBondContact O-N 2.83Å; M42-Y45 HydrophobicContact CE-CD1 4.35Å; M42-Y45 HydrophobicContact CE-CG 4.41Å; M42-Y45 PolarHBondContact O-N 3Å; M42-V46 WeakPolarHBondContact O-CB 3.5Å; M42-V46 VanDerWaalsContact O-CG2 3.23Å; M42-V46 WeakPolarHBondContact O-CG2 3.28Å; M42-V46 PolarHBondContact O-N 2.88Å
43	S	80.6	Confident	77.7	Confident	64 Å²	64	121.4 Å²	121.4	45%	0.448	62%	0.623	S	S	.	*	H	α-helix	trans	-62.7	-40.2	177.2	69.4	0	0	0	0	111.3	A39 E40 M47	A39-S43 WeakPolarHBondContact O-CB 3.43Å; A39-S43 PolarHBondContact O-N 2.9Å; A39-S43 PolarHBondContact O-OG 3.2Å; E40-S43 PolarHBondContact O-OG 2.97Å; S43-M47 VanDerWaalsContact O-CB 3.25Å; S43-M47 WeakPolarHBondContact O-CB 3.28Å; S43-M47 WeakPolarHBondContact O-CG 3.42Å; S43-M47 PolarHBondContact O-N 2.79Å
44	T	74.8	Confident	77.2	Confident	71 Å²	71	121.7 Å²	121.7	44%	0.436	63%	0.626	S	S	.	*	H	α-helix	trans	-69.5	-43.8	176.2	-51.6	0	0	0	0	111.3	E40 F41 M42 V46 M47 M48	E40-T44 PolarHBondContact O-N 3Å; E40-T44 PolarHBondContact O-OG1 2.93Å; F41-T44 PolarHBondContact O-N 3.19Å; M42-T44 VanDerWaalsContact C-N 3.3Å; M42-T44 PolarHBondContact O-N 2.83Å; T44-V46 PolarHBondContact O-N 2.87Å; T44-M47 PolarHBondContact O-N 3.01Å; T44-M48 HydrophobicContact CG2-CE 4.15Å; T44-M48 HydrophobicContact CG2-CG 4.48Å; T44-M48 HydrophobicContact CG2-SD 4.39Å; T44-M48 WeakPolarHBondContact O-CB 3.27Å; T44-M48 WeakPolarHBondContact O-CG 3.48Å; T44-M48 PolarHBondContact O-N 2.79Å
45	Y	72.1	Confident	76.7	Confident	152 Å²	152	123.4 Å²	123.4	60%	0.596	63%	0.63	S	S	*	*	H	α-helix	trans	-62.5	-43.2	-179.8	-164.5	-88.2	0	0	0	112.2	F41 M42 E49	F41-Y45 WeakPolarHBondContact O-CB 3.38Å; F41-Y45 PolarHBondContact O-N 3.36Å; M42-Y45 HydrophobicContact CE-CD1 4.35Å; M42-Y45 HydrophobicContact CE-CG 4.41Å; M42-Y45 PolarHBondContact O-N 3Å; Y45-E49 PolarHBondContact O-N 2.91Å
46	V	68	Low	76.2	Confident	90 Å²	90	118.8 Å²	118.8	55%	0.545	62%	0.623	S	S	.	*	H	α-helix	trans	-69.6	-39.5	176.8	171.7	0	0	0	0	111.7	M42 T44 M48 E49	M42-V46 WeakPolarHBondContact O-CB 3.5Å; M42-V46 VanDerWaalsContact O-CG2 3.23Å; M42-V46 WeakPolarHBondContact O-CG2 3.28Å; M42-V46 PolarHBondContact O-N 2.88Å; T44-V46 PolarHBondContact O-N 2.87Å; V46-M48 VanDerWaalsContact C-N 3.29Å; V46-M48 PolarHBondContact O-N 2.78Å; V46-E49 PolarHBondContact O-N 2.86Å
47	M	69.9	Low	75.5	Confident	165 Å²	165	117.9 Å²	117.9	81%	0.813	62%	0.624	S	S	*	*	H	α-helix	trans	-72.1	-23.1	179.7	-68.4	-71.4	-78.3	0	0	113.3	S43 T44	S43-M47 VanDerWaalsContact O-CB 3.25Å; S43-M47 WeakPolarHBondContact O-CB 3.28Å; S43-M47 WeakPolarHBondContact O-CG 3.42Å; S43-M47 PolarHBondContact O-N 2.79Å; T44-M47 PolarHBondContact O-N 3.01Å
48	M	67.7	Low	75	Confident	146 Å²	146	116.6 Å²	116.6	72%	0.719	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.6	-2.9	176.4	-70.8	-161.2	178.8	0	0	113.8	T44 V46 P50	T44-M48 HydrophobicContact CG2-CE 4.15Å; T44-M48 HydrophobicContact CG2-CG 4.48Å; T44-M48 HydrophobicContact CG2-SD 4.39Å; T44-M48 WeakPolarHBondContact O-CB 3.27Å; T44-M48 WeakPolarHBondContact O-CG 3.48Å; T44-M48 PolarHBondContact O-N 2.79Å; V46-M48 VanDerWaalsContact C-N 3.29Å; V46-M48 PolarHBondContact O-N 2.78Å; M48-P50 WeakPolarHBondContact O-CD 3.49Å
49	E	62.9	Low	74.2	Confident	131 Å²	131	118.2 Å²	118.2	61%	0.612	64%	0.635	S	S	*	*			trans	-70.8	105.8	176.6	-168.6	177.4	-165.9	0	0	109.4	Y45 V46 T51	Y45-E49 PolarHBondContact O-N 2.91Å; V46-E49 PolarHBondContact O-N 2.86Å; E49-T51 PolarHBondContact O-N 3.16Å
50	P	66.1	Low	73.1	Confident	120 Å²	120	122.8 Å²	122.8	78%	0.779	65%	0.645	S	S	*	*			trans	-84.3	109.7	176.9	16.4	3	0	0	0	107.4	M48	M48-P50 WeakPolarHBondContact O-CD 3.49Å
51	T	64.4	Low	72	Confident	204 Å²	204	121.6 Å²	121.6	100%	1.252	65%	0.646	S	S	*	*			trans	-68.9	0	164.6	52.6	0	0	0	0	111.6	E49	E49-T51 PolarHBondContact O-N 3.16Å

Retrieved 51 of 51 residues in 34.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).