A0A096LNV7_HUMAN Loading...

Aquaporin 7

AlphaFold DB , UniProt , Accession A0A096LNV7, Species HUMAN (Homo sapiens, Human), Gene AQP7, Length 50 aa.

						>A0A096LNV7_HUMAN|A0A096LNV7|AQP7
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMRE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.6	Very low	57.1	Low	242 Å²	242	153.3 Å²	153.3	100%	1.192	83%	0.832	S	S	*	*				0	101.2	0	-85.3	170.2	141.8	0	0	108.4
2	V	49.2	Very low	57.7	Low	146 Å²	146	159.7 Å²	159.7	89%	0.885	84%	0.835	S	S	*	*			trans	-88.2	111.7	174.7	169.5	0	0	0	0	107	A4	V2-A4 PolarHBondContact O-N 2.84Å
3	Q	49.2	Very low	58.1	Low	191 Å²	191	151.9 Å²	151.9	89%	0.893	82%	0.818	S	S	*	*			trans	-74.7	111.2	172.3	-75.5	-172.6	30.2	0	0	108.4	S5	Q3-S5 PolarHBondContact O-N 2.91Å; Q3-S5 VanDerWaalsContact O-N 3.14Å
4	A	55	Low	58.7	Low	95 Å²	95	149.3 Å²	149.3	79%	0.785	82%	0.817	S	S	*	*			trans	-60.4	112.7	169.3	0	0	0	0	0	108.6	V2 G6	V2-A4 PolarHBondContact O-N 2.84Å; A4-G6 VanDerWaalsContact C-N 3.31Å; A4-G6 PolarHBondContact O-N 2.88Å
5	S	58.8	Low	59.5	Low	119 Å²	119	152.5 Å²	152.5	83%	0.832	82%	0.82	S	S	*	*			trans	-62.7	92.4	174.5	53.1	0	0	0	0	109.2	Q3 H7	Q3-S5 PolarHBondContact O-N 2.91Å; Q3-S5 VanDerWaalsContact O-N 3.14Å; S5-H7 PolarHBondContact O-N 3.46Å
6	G	58.3	Low	60.5	Low	67 Å²	67	154.3 Å²	154.3	69%	0.691	82%	0.824	S	S	*	*			trans	-56.4	122.4	178.3	0	0	0	0	0	111	A4 R8	A4-G6 VanDerWaalsContact C-N 3.31Å; A4-G6 PolarHBondContact O-N 2.88Å; G6-R8 VanDerWaalsContact C-N 3.35Å; G6-R8 PolarHBondContact O-N 3.36Å
7	H	61.2	Low	61.5	Low	147 Å²	147	150 Å²	150	68%	0.681	81%	0.805	S	S	*	*			trans	-53.4	87.4	174	-173.1	80.9	0	0	0	111.4	S5 R9	S5-H7 PolarHBondContact O-N 3.46Å; H7-R9 VanDerWaalsContact C-N 3.29Å; H7-R9 PolarHBondContact NE2-NE 3.46Å; H7-R9 PolarHBondContact O-N 3.45Å
8	R	62.3	Low	62.8	Low	246 Å²	246	144.9 Å²	144.9	93%	0.928	78%	0.783	S	S	*	*			trans	-76.3	87.6	165.8	-96	-172.3	170.9	-166.9	-1.4	108	G6 S10	G6-R8 VanDerWaalsContact C-N 3.35Å; G6-R8 PolarHBondContact O-N 3.36Å; R8-S10 PolarHBondContact O-N 2.95Å
9	R	66.3	Low	64.1	Low	200 Å²	200	147.9 Å²	147.9	76%	0.755	78%	0.782	S	S	*	*			trans	-57	101.4	167.5	-163.2	174.1	-78.8	152.8	-12.7	107.1	H7 T11	H7-R9 VanDerWaalsContact C-N 3.29Å; H7-R9 PolarHBondContact NE2-NE 3.46Å; H7-R9 PolarHBondContact O-N 3.45Å; R9-T11 PolarHBondContact O-N 2.96Å
10	S	66.6	Low	65.4	Low	100 Å²	100	144.2 Å²	144.2	70%	0.699	77%	0.768	S	S	*	*			trans	-61.9	107.3	176.9	178.7	0	0	0	0	107.6	R8 R12	R8-S10 PolarHBondContact O-N 2.95Å; S10-R12 PolarHBondContact O-N 3.26Å
11	T	66.1	Low	66.5	Low	133 Å²	133	140.4 Å²	140.4	82%	0.816	75%	0.75	S	S	*	*			trans	-69.1	70.2	161.3	51	0	0	0	0	106.8	R9 G13	R9-T11 PolarHBondContact O-N 2.96Å; T11-G13 WeakPolarHBondContact O-CA 3.17Å; T11-G13 PolarHBondContact O-N 2.89Å
12	R	64.2	Low	69.1	Low	230 Å²	230	131.7 Å²	131.7	87%	0.868	71%	0.708	S	S	*	*			trans	-54.7	107.6	175.8	-176.9	177.9	174.5	-175.7	-1.8	106	S10 S14	S10-R12 PolarHBondContact O-N 3.26Å; R12-S14 PolarHBondContact O-N 3.43Å
13	G	62.8	Low	71.1	Confident	59 Å²	59	126.8 Å²	126.8	61%	0.608	68%	0.683	S	S	*	*			trans	-48.7	121.1	-154	0	0	0	0	0	113.4	T11 K15	T11-G13 WeakPolarHBondContact O-CA 3.17Å; T11-G13 PolarHBondContact O-N 2.89Å; G13-K15 PolarHBondContact O-N 3.44Å
14	S	66	Low	73.2	Confident	115 Å²	115	124.4 Å²	124.4	80%	0.804	67%	0.67	S	S	*	*			trans	-57.4	110.2	156.9	-176.8	0	0	0	0	106	R12 M16	R12-S14 PolarHBondContact O-N 3.43Å; S14-M16 VanDerWaalsContact C-N 3.26Å; S14-M16 PolarHBondContact O-N 2.91Å
15	K	70.6	Confident	74.9	Confident	198 Å²	198	124.1 Å²	124.1	86%	0.861	65%	0.654	S	S	*	*			trans	-65.8	94.5	175.7	-74.8	-176.6	176.8	-179.4	0	106.7	G13 V17	G13-K15 PolarHBondContact O-N 3.44Å; K15-V17 PolarHBondContact O-N 2.89Å
16	M	75.6	Confident	76.4	Confident	180 Å²	180	123.5 Å²	123.5	89%	0.887	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-60.8	121.2	174.4	-124.9	169	81.8	0	0	107.4	S14 S18	S14-M16 VanDerWaalsContact C-N 3.26Å; S14-M16 PolarHBondContact O-N 2.91Å; M16-S18 PolarHBondContact O-N 3.42Å
17	V	78.1	Confident	78	Confident	82 Å²	82	124.5 Å²	124.5	50%	0.497	63%	0.625	S	S	.	*	P	Polyproline II helix	trans	-57.2	133.2	175.3	174.3	0	0	0	0	107.8	K15 V21 I22	K15-V17 PolarHBondContact O-N 2.89Å; V17-V21 HydrophobicContact CG1-CB 3.54Å; V17-V21 HydrophobicContact CG1-CG1 3.42Å; V17-V21 VanDerWaalsContact CG1-CG1 3.42Å; V17-I22 HydrophobicContact CB-CG1 4.45Å; V17-I22 HydrophobicContact CG1-CG1 3.97Å
18	S	85.1	Confident	79.5	Confident	58 Å²	58	122.1 Å²	122.1	41%	0.406	62%	0.616	S	S	.	*	P	Polyproline II helix	trans	-62.5	146.9	-179.2	65.1	0	0	0	0	110.5	M16 S20 V21 I22	M16-S18 PolarHBondContact O-N 3.42Å; S18-S20 PolarHBondContact O-N 2.65Å; S18-S20 VanDerWaalsContact O-N 3.13Å; S18-S20 PolarHBondContact OG-OG 2.89Å; S18-V21 PolarHBondContact O-N 3.47Å; S18-V21 WeakPolarHBondContact OG-CG2 3.27Å; S18-I22 PolarHBondContact O-N 3.38Å; S18-I22 VanDerWaalsContact O-N 3.17Å
19	W	87.8	Confident	80.6	Confident	203 Å²	203	115 Å²	115	77%	0.769	60%	0.596	S	S	*	*	H	α-helix	trans	-52.1	-37.3	176.2	-175.1	-105.1	0	0	0	112.8	V21 I22 A23	W19-V21 VanDerWaalsContact C-N 3.32Å; W19-V21 PolarHBondContact O-N 3.16Å; W19-I22 PolarHBondContact O-N 2.87Å; W19-A23 PolarHBondContact O-N 3.41Å
20	S	89.4	Confident	81.7	Confident	73 Å²	73	111.4 Å²	111.4	51%	0.51	59%	0.587	S	S	.	*	H	α-helix	trans	-60.6	-36.3	175.8	54.2	0	0	0	0	113.8	S18 K24	S18-S20 PolarHBondContact O-N 2.65Å; S18-S20 VanDerWaalsContact O-N 3.13Å; S18-S20 PolarHBondContact OG-OG 2.89Å; S20-K24 WeakPolarHBondContact O-CG 3.33Å; S20-K24 PolarHBondContact O-N 2.67Å
21	V	89.1	Confident	82.7	Confident	64 Å²	64	114.1 Å²	114.1	39%	0.388	58%	0.582	S	S	.	*	H	α-helix	trans	-75.3	-38.1	177.5	171.2	0	0	0	0	110.2	V17 S18 W19 K24 I25	V17-V21 HydrophobicContact CG1-CB 3.54Å; V17-V21 HydrophobicContact CG1-CG1 3.42Å; V17-V21 VanDerWaalsContact CG1-CG1 3.42Å; S18-V21 PolarHBondContact O-N 3.47Å; S18-V21 WeakPolarHBondContact OG-CG2 3.27Å; W19-V21 VanDerWaalsContact C-N 3.32Å; W19-V21 PolarHBondContact O-N 3.16Å; V21-K24 PolarHBondContact O-N 3.33Å; V21-I25 HydrophobicContact CG1-CD1 3.87Å; V21-I25 HydrophobicContact CG1-CG1 4.48Å; V21-I25 VanDerWaalsContact O-CG1 3.29Å; V21-I25 WeakPolarHBondContact O-CG1 3.3Å; V21-I25 PolarHBondContact O-N 3.47Å
22	I	89.5	Confident	83.6	Confident	60 Å²	60	113.8 Å²	113.8	31%	0.308	57%	0.569	S	S	.	*	H	α-helix	trans	-60.5	-46.5	174.8	-63.3	171.3	0	0	0	110.6	V17 S18 W19 K24 I25 Q26	V17-I22 HydrophobicContact CB-CG1 4.45Å; V17-I22 HydrophobicContact CG1-CG1 3.97Å; S18-I22 PolarHBondContact O-N 3.38Å; S18-I22 VanDerWaalsContact O-N 3.17Å; W19-I22 PolarHBondContact O-N 2.87Å; I22-K24 VanDerWaalsContact C-N 3.35Å; I22-K24 PolarHBondContact O-N 3.43Å; I22-I25 PolarHBondContact O-N 3.46Å; I22-Q26 WeakPolarHBondContact O-CG 3.31Å; I22-Q26 PolarHBondContact O-N 3.09Å
23	A	91.3	Very high	84.7	Confident	43 Å²	43	108.4 Å²	108.4	36%	0.355	56%	0.556	S	S	.	*	H	α-helix	trans	-59.9	-42.8	177.7	0	0	0	0	0	112.3	W19 I25 Q26 E27	W19-A23 PolarHBondContact O-N 3.41Å; A23-I25 PolarHBondContact O-N 2.96Å; A23-Q26 PolarHBondContact O-N 3.03Å; A23-E27 PolarHBondContact O-N 3.19Å
24	K	93.5	Very high	85.7	Confident	141 Å²	141	110.1 Å²	110.1	61%	0.613	55%	0.554	S	S	*	*	H	α-helix	trans	-63	-41.6	175.6	-76.1	-179.1	178.6	-175.7	0	112.6	S20 V21 I22 E27 I28	S20-K24 WeakPolarHBondContact O-CG 3.33Å; S20-K24 PolarHBondContact O-N 2.67Å; V21-K24 PolarHBondContact O-N 3.33Å; I22-K24 VanDerWaalsContact C-N 3.35Å; I22-K24 PolarHBondContact O-N 3.43Å; K24-E27 PolarHBondContact O-N 3.37Å; K24-I28 VanDerWaalsContact O-CG1 3.29Å; K24-I28 WeakPolarHBondContact O-CG1 3.18Å; K24-I28 PolarHBondContact O-N 2.98Å; K24-I28 VanDerWaalsContact O-N 3.08Å
25	I	90.8	Very high	86.6	Confident	88 Å²	88	114 Å²	114	45%	0.451	55%	0.551	S	S	.	*	H	α-helix	trans	-62.7	-45.5	177	-69.2	165.7	0	0	0	109.9	V21 I22 A23 E27 I28 L29	V21-I25 HydrophobicContact CG1-CD1 3.87Å; V21-I25 HydrophobicContact CG1-CG1 4.48Å; V21-I25 VanDerWaalsContact O-CG1 3.29Å; V21-I25 WeakPolarHBondContact O-CG1 3.3Å; V21-I25 PolarHBondContact O-N 3.47Å; I22-I25 PolarHBondContact O-N 3.46Å; A23-I25 PolarHBondContact O-N 2.96Å; I25-E27 PolarHBondContact O-N 2.9Å; I25-I28 PolarHBondContact O-N 3.43Å; I25-L29 HydrophobicContact CG2-CD1 3.8Å; I25-L29 HydrophobicContact CG2-CG 4.35Å; I25-L29 WeakPolarHBondContact O-CB 3.28Å; I25-L29 VanDerWaalsContact O-CG 3.27Å; I25-L29 WeakPolarHBondContact O-CG 3.37Å; I25-L29 PolarHBondContact O-N 3.37Å
26	Q	89.4	Confident	87.4	Confident	106 Å²	106	110.7 Å²	110.7	50%	0.495	54%	0.539	S	S	.	.	H	α-helix	trans	-60.9	-44.2	177.3	-73.9	177.6	-36.4	0	0	112.2	I22 A23 I28 L29 Q30	I22-Q26 WeakPolarHBondContact O-CG 3.31Å; I22-Q26 PolarHBondContact O-N 3.09Å; A23-Q26 PolarHBondContact O-N 3.03Å; Q26-I28 PolarHBondContact O-N 2.94Å; Q26-L29 PolarHBondContact O-N 2.87Å; Q26-Q30 WeakPolarHBondContact O-CB 3.43Å; Q26-Q30 WeakPolarHBondContact O-CG 3.23Å; Q26-Q30 PolarHBondContact O-N 3.44Å
27	E	93.2	Very high	87.7	Confident	89 Å²	89	108.7 Å²	108.7	42%	0.416	53%	0.525	S	S	.	.	H	α-helix	trans	-61.1	-44.4	177.9	-172.3	-173.6	172	0	0	112	A23 K24 I25 Q30 R31	A23-E27 PolarHBondContact O-N 3.19Å; K24-E27 PolarHBondContact O-N 3.37Å; I25-E27 PolarHBondContact O-N 2.9Å; E27-Q30 PolarHBondContact O-N 3.43Å; E27-R31 WeakPolarHBondContact O-CG 3.49Å; E27-R31 PolarHBondContact O-N 3.08Å; E27-R31 IonicContact OE1-CZ 3.26Å; E27-R31 VanDerWaalsContact OE1-CZ 3.26Å; E27-R31 IonicContact OE1-NE 3.33Å; E27-R31 PolarHBondContact OE1-NE 2.84Å; E27-R31 IonicContact OE1-NH2 2.67Å; E27-R31 PolarHBondContact OE1-NH2 3.25Å
28	I	91.5	Very high	88	Confident	97 Å²	97	109.3 Å²	109.3	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-63.7	-44.4	178	-68.3	166.3	0	0	0	110.7	K24 I25 Q26 R31 K32	K24-I28 VanDerWaalsContact O-CG1 3.29Å; K24-I28 WeakPolarHBondContact O-CG1 3.18Å; K24-I28 PolarHBondContact O-N 2.98Å; K24-I28 VanDerWaalsContact O-N 3.08Å; I25-I28 PolarHBondContact O-N 3.43Å; Q26-I28 PolarHBondContact O-N 2.94Å; I28-R31 PolarHBondContact O-N 3.41Å; I28-K32 PolarHBondContact O-N 3.3Å; I28-K32 VanDerWaalsContact O-N 3.08Å
29	L	85.8	Confident	88	Confident	96 Å²	96	109.2 Å²	109.2	50%	0.503	53%	0.528	S	S	.	.	H	α-helix	trans	-63.8	-44.8	178.5	-71.7	173.2	0	0	0	111.3	I25 Q26 R31 K32 M33	I25-L29 HydrophobicContact CG2-CD1 3.8Å; I25-L29 HydrophobicContact CG2-CG 4.35Å; I25-L29 WeakPolarHBondContact O-CB 3.28Å; I25-L29 VanDerWaalsContact O-CG 3.27Å; I25-L29 WeakPolarHBondContact O-CG 3.37Å; I25-L29 PolarHBondContact O-N 3.37Å; Q26-L29 PolarHBondContact O-N 2.87Å; L29-R31 PolarHBondContact O-N 3.32Å; L29-K32 PolarHBondContact O-N 3.33Å; L29-M33 WeakPolarHBondContact O-CG 3.32Å; L29-M33 PolarHBondContact O-N 3.45Å
30	Q	88.8	Confident	87.9	Confident	125 Å²	125	106.1 Å²	106.1	58%	0.584	52%	0.522	S	S	*	.	H	α-helix	trans	-60.8	-44.7	176.3	-76.4	-172.6	-31.3	0	0	111.9	Q26 E27 K32 M33 V34	Q26-Q30 WeakPolarHBondContact O-CB 3.43Å; Q26-Q30 WeakPolarHBondContact O-CG 3.23Å; Q26-Q30 PolarHBondContact O-N 3.44Å; E27-Q30 PolarHBondContact O-N 3.43Å; Q30-K32 VanDerWaalsContact C-N 3.3Å; Q30-K32 PolarHBondContact O-N 2.95Å; Q30-M33 PolarHBondContact O-N 3.48Å; Q30-V34 VanDerWaalsContact O-CG2 3.27Å; Q30-V34 WeakPolarHBondContact O-CG2 3.35Å; Q30-V34 PolarHBondContact O-N 2.98Å
31	R	88.4	Confident	87.4	Confident	157 Å²	157	108 Å²	108	59%	0.592	52%	0.521	S	S	*	.	H	α-helix	trans	-61.6	-37.3	177	-74	178.2	-175.9	-153	3.2	112.7	E27 I28 L29 R35	E27-R31 WeakPolarHBondContact O-CG 3.49Å; E27-R31 PolarHBondContact O-N 3.08Å; E27-R31 IonicContact OE1-CZ 3.26Å; E27-R31 VanDerWaalsContact OE1-CZ 3.26Å; E27-R31 IonicContact OE1-NE 3.33Å; E27-R31 PolarHBondContact OE1-NE 2.84Å; E27-R31 IonicContact OE1-NH2 2.67Å; E27-R31 PolarHBondContact OE1-NH2 3.25Å; I28-R31 PolarHBondContact O-N 3.41Å; L29-R31 PolarHBondContact O-N 3.32Å; R31-R35 WeakPolarHBondContact O-CG 3.42Å; R31-R35 PolarHBondContact O-N 3.46Å
32	K	85.4	Confident	87.1	Confident	125 Å²	125	109.5 Å²	109.5	54%	0.543	53%	0.525	S	S	.	.	H	α-helix	trans	-66.7	-48.5	175	-77.6	-175.5	172.6	-172.2	0	111.5	I28 L29 Q30 V34 R35 E36	I28-K32 PolarHBondContact O-N 3.3Å; I28-K32 VanDerWaalsContact O-N 3.08Å; L29-K32 PolarHBondContact O-N 3.33Å; Q30-K32 VanDerWaalsContact C-N 3.3Å; Q30-K32 PolarHBondContact O-N 2.95Å; K32-V34 VanDerWaalsContact C-N 3.31Å; K32-V34 PolarHBondContact O-N 3.08Å; K32-R35 WeakPolarHBondContact O-CB 3.36Å; K32-R35 PolarHBondContact O-N 3.36Å; K32-R35 VanDerWaalsContact O-N 3.09Å; K32-E36 PolarHBondContact O-N 3.5Å
33	M	86.9	Confident	86.5	Confident	118 Å²	118	110 Å²	110	58%	0.581	53%	0.534	S	S	*	.	H	α-helix	trans	-61.2	-39.2	178.2	-68.5	-164.1	-54.4	0	0	112.3	L29 Q30 R35 E36 F37	L29-M33 WeakPolarHBondContact O-CG 3.32Å; L29-M33 PolarHBondContact O-N 3.45Å; Q30-M33 PolarHBondContact O-N 3.48Å; M33-R35 VanDerWaalsContact C-N 3.32Å; M33-R35 PolarHBondContact O-N 2.95Å; M33-E36 PolarHBondContact O-N 2.85Å; M33-F37 WeakPolarHBondContact O-CB 3.25Å; M33-F37 PolarHBondContact O-N 3.31Å
34	V	84.1	Confident	85.6	Confident	94 Å²	94	111.5 Å²	111.5	57%	0.57	54%	0.539	S	S	*	.	H	α-helix	trans	-64	-38.6	175.7	170.6	0	0	0	0	111.5	Q30 K32 L38	Q30-V34 VanDerWaalsContact O-CG2 3.27Å; Q30-V34 WeakPolarHBondContact O-CG2 3.35Å; Q30-V34 PolarHBondContact O-N 2.98Å; K32-V34 VanDerWaalsContact C-N 3.31Å; K32-V34 PolarHBondContact O-N 3.08Å; V34-L38 VanDerWaalsContact O-CB 3.23Å; V34-L38 WeakPolarHBondContact O-CB 3.4Å; V34-L38 PolarHBondContact O-N 3.13Å
35	R	84.4	Confident	84.1	Confident	196 Å²	196	110.5 Å²	110.5	74%	0.74	53%	0.532	S	S	*	.	H	α-helix	trans	-68.2	-44.4	177	-76.5	177.2	174.3	-166.1	-2.5	112.1	R31 K32 M33 L38 A39	R31-R35 WeakPolarHBondContact O-CG 3.42Å; R31-R35 PolarHBondContact O-N 3.46Å; K32-R35 WeakPolarHBondContact O-CB 3.36Å; K32-R35 PolarHBondContact O-N 3.36Å; K32-R35 VanDerWaalsContact O-N 3.09Å; M33-R35 VanDerWaalsContact C-N 3.32Å; M33-R35 PolarHBondContact O-N 2.95Å; R35-L38 PolarHBondContact O-N 2.93Å; R35-A39 VanDerWaalsContact O-CB 3.29Å; R35-A39 WeakPolarHBondContact O-CB 3.48Å; R35-A39 PolarHBondContact O-N 3.17Å
36	E	87.1	Confident	82.7	Confident	129 Å²	129	110.9 Å²	110.9	60%	0.603	54%	0.538	S	S	*	.	H	α-helix	trans	-64.1	-45.9	176.8	-72.6	169	-170.6	0	0	110.8	K32 M33 L38 A39 E40	K32-E36 PolarHBondContact O-N 3.5Å; M33-E36 PolarHBondContact O-N 2.85Å; E36-L38 PolarHBondContact O-N 3.24Å; E36-A39 PolarHBondContact O-N 3.38Å; E36-E40 WeakPolarHBondContact O-CB 3.27Å; E36-E40 PolarHBondContact O-N 3.24Å
37	F	81.7	Confident	81.4	Confident	138 Å²	138	113.8 Å²	113.8	61%	0.605	55%	0.554	S	S	*	*	H	α-helix	trans	-58.2	-46.4	174.3	176.3	-98.9	0	0	0	112.3	M33 E40 F41	M33-F37 WeakPolarHBondContact O-CB 3.25Å; M33-F37 PolarHBondContact O-N 3.31Å; F37-E40 PolarHBondContact O-N 3.2Å; F37-F41 VanDerWaalsContact O-CB 3.25Å; F37-F41 WeakPolarHBondContact O-CB 3.14Å; F37-F41 PolarHBondContact O-N 2.83Å
38	L	84.6	Confident	79.8	Confident	96 Å²	96	117.1 Å²	117.1	50%	0.503	57%	0.572	S	S	.	*	H	α-helix	trans	-66.9	-39.1	178.6	-175.9	63.4	0	0	0	111.7	V34 R35 E36 M42	V34-L38 VanDerWaalsContact O-CB 3.23Å; V34-L38 WeakPolarHBondContact O-CB 3.4Å; V34-L38 PolarHBondContact O-N 3.13Å; R35-L38 PolarHBondContact O-N 2.93Å; E36-L38 PolarHBondContact O-N 3.24Å; L38-M42 HydrophobicContact CD1-CG 4.23Å; L38-M42 HydrophobicContact CG-CG 4.38Å; L38-M42 VanDerWaalsContact O-CB 3.28Å; L38-M42 WeakPolarHBondContact O-CB 3.29Å; L38-M42 WeakPolarHBondContact O-CG 3.46Å; L38-M42 PolarHBondContact O-N 3.2Å
39	A	86.4	Confident	78.1	Confident	55 Å²	55	121 Å²	121	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-64.1	-44.2	176.2	0	0	0	0	0	111.5	R35 E36 S43	R35-A39 VanDerWaalsContact O-CB 3.29Å; R35-A39 WeakPolarHBondContact O-CB 3.48Å; R35-A39 PolarHBondContact O-N 3.17Å; E36-A39 PolarHBondContact O-N 3.38Å; A39-S43 WeakPolarHBondContact O-CB 3.29Å; A39-S43 PolarHBondContact O-N 2.92Å; A39-S43 PolarHBondContact O-OG 2.94Å
40	E	84.1	Confident	76.5	Confident	138 Å²	138	128.9 Å²	128.9	65%	0.645	61%	0.614	S	S	*	*	H	α-helix	trans	-64.4	-47.1	176.3	-174.2	165.4	-149.9	0	0	111	E36 F37 M42 S43 T44	E36-E40 WeakPolarHBondContact O-CB 3.27Å; E36-E40 PolarHBondContact O-N 3.24Å; F37-E40 PolarHBondContact O-N 3.2Å; E40-M42 PolarHBondContact O-N 3.02Å; E40-S43 WeakPolarHBondContact O-CB 3.35Å; E40-S43 PolarHBondContact O-N 2.89Å; E40-S43 VanDerWaalsContact O-N 3.16Å; E40-T44 PolarHBondContact O-N 2.99Å; E40-T44 PolarHBondContact O-OG1 3.36Å
41	F	80.2	Confident	75.9	Confident	113 Å²	113	129.1 Å²	129.1	50%	0.496	62%	0.615	S	S	.	*	H	α-helix	trans	-58	-47.9	176.3	-176.1	-96.9	0	0	0	112.3	F37 S43 T44 Y45	F37-F41 VanDerWaalsContact O-CB 3.25Å; F37-F41 WeakPolarHBondContact O-CB 3.14Å; F37-F41 PolarHBondContact O-N 2.83Å; F41-S43 VanDerWaalsContact C-N 3.32Å; F41-S43 PolarHBondContact O-N 2.8Å; F41-T44 PolarHBondContact O-N 2.83Å; F41-Y45 HydrophobicContact CZ-CD2 4.46Å; F41-Y45 VanDerWaalsContact O-CB 3.31Å; F41-Y45 WeakPolarHBondContact O-CB 3.29Å; F41-Y45 PolarHBondContact O-N 2.89Å
42	M	82.3	Confident	75.2	Confident	95 Å²	95	127.6 Å²	127.6	47%	0.468	62%	0.617	S	S	.	*	H	α-helix	trans	-64.5	-36.8	177.1	-73.3	-63.6	-59.5	0	0	111.9	L38 E40 Y45 V46	L38-M42 HydrophobicContact CD1-CG 4.23Å; L38-M42 HydrophobicContact CG-CG 4.38Å; L38-M42 VanDerWaalsContact O-CB 3.28Å; L38-M42 WeakPolarHBondContact O-CB 3.29Å; L38-M42 WeakPolarHBondContact O-CG 3.46Å; L38-M42 PolarHBondContact O-N 3.2Å; E40-M42 PolarHBondContact O-N 3.02Å; M42-Y45 PolarHBondContact O-N 3.23Å; M42-V46 HydrophobicContact CE-CG2 4.49Å; M42-V46 VanDerWaalsContact O-CB 3.27Å; M42-V46 WeakPolarHBondContact O-CB 3.44Å; M42-V46 WeakPolarHBondContact O-CG2 3.27Å; M42-V46 PolarHBondContact O-N 3.01Å
43	S	77.4	Confident	74.6	Confident	72 Å²	72	127.7 Å²	127.7	50%	0.503	62%	0.621	S	S	.	*	H	α-helix	trans	-64	-42.9	178.3	-59.2	0	0	0	0	111.4	A39 E40 F41 M47	A39-S43 WeakPolarHBondContact O-CB 3.29Å; A39-S43 PolarHBondContact O-N 2.92Å; A39-S43 PolarHBondContact O-OG 2.94Å; E40-S43 WeakPolarHBondContact O-CB 3.35Å; E40-S43 PolarHBondContact O-N 2.89Å; E40-S43 VanDerWaalsContact O-N 3.16Å; F41-S43 VanDerWaalsContact C-N 3.32Å; F41-S43 PolarHBondContact O-N 2.8Å; S43-M47 WeakPolarHBondContact O-CB 3.4Å; S43-M47 WeakPolarHBondContact O-CG 3.43Å; S43-M47 PolarHBondContact O-N 3.27Å
44	T	70.6	Confident	73.9	Confident	74 Å²	74	128.3 Å²	128.3	45%	0.454	62%	0.623	S	S	.	*	H	α-helix	trans	-69.3	-41.1	175.9	-38.2	0	0	0	0	111.6	E40 F41 V46 M47 M48	E40-T44 PolarHBondContact O-N 2.99Å; E40-T44 PolarHBondContact O-OG1 3.36Å; F41-T44 PolarHBondContact O-N 2.83Å; T44-V46 VanDerWaalsContact C-N 3.31Å; T44-V46 PolarHBondContact O-N 2.83Å; T44-M47 PolarHBondContact O-N 3.28Å; T44-M48 HydrophobicContact CG2-CG 4.4Å; T44-M48 VanDerWaalsContact O-CB 3.3Å; T44-M48 WeakPolarHBondContact O-CB 3.33Å; T44-M48 WeakPolarHBondContact O-CG 3.43Å; T44-M48 PolarHBondContact O-N 3Å
45	Y	63.8	Low	73.3	Confident	119 Å²	119	130.4 Å²	130.4	47%	0.467	63%	0.626	S	S	.	*	H	α-helix	trans	-67.8	-32	179.4	-158.8	-93.4	0	0	0	112.4	F41 M42 R49	F41-Y45 HydrophobicContact CZ-CD2 4.46Å; F41-Y45 VanDerWaalsContact O-CB 3.31Å; F41-Y45 WeakPolarHBondContact O-CB 3.29Å; F41-Y45 PolarHBondContact O-N 2.89Å; M42-Y45 PolarHBondContact O-N 3.23Å; Y45-R49 VanDerWaalsContact CE1-NH2 3.31Å; Y45-R49 PolarHBondContact OH-NH2 3.14Å
46	V	61	Low	72.5	Confident	97 Å²	97	126.1 Å²	126.1	59%	0.588	62%	0.619	S	S	*	*	H	α-helix	trans	-78.6	-42.8	174.1	171.5	0	0	0	0	111.4	M42 T44 M48 R49	M42-V46 HydrophobicContact CE-CG2 4.49Å; M42-V46 VanDerWaalsContact O-CB 3.27Å; M42-V46 WeakPolarHBondContact O-CB 3.44Å; M42-V46 WeakPolarHBondContact O-CG2 3.27Å; M42-V46 PolarHBondContact O-N 3.01Å; T44-V46 VanDerWaalsContact C-N 3.31Å; T44-V46 PolarHBondContact O-N 2.83Å; V46-M48 VanDerWaalsContact C-N 3.35Å; V46-M48 PolarHBondContact O-N 3.43Å; V46-R49 PolarHBondContact O-N 2.83Å
47	M	60.7	Low	71.5	Confident	167 Å²	167	125.9 Å²	125.9	82%	0.823	62%	0.62	S	S	*	*	H	α-helix	trans	-68.9	-27.8	178.1	-77.7	-150.7	96	0	0	114	S43 T44	S43-M47 WeakPolarHBondContact O-CB 3.4Å; S43-M47 WeakPolarHBondContact O-CG 3.43Å; S43-M47 PolarHBondContact O-N 3.27Å; T44-M47 PolarHBondContact O-N 3.28Å
48	M	60.7	Low	70.7	Confident	159 Å²	159	124.9 Å²	124.9	78%	0.783	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85	-5	177.6	-72.9	-117	-175.8	0	0	114	T44 V46	T44-M48 HydrophobicContact CG2-CG 4.4Å; T44-M48 VanDerWaalsContact O-CB 3.3Å; T44-M48 WeakPolarHBondContact O-CB 3.33Å; T44-M48 WeakPolarHBondContact O-CG 3.43Å; T44-M48 PolarHBondContact O-N 3Å; V46-M48 VanDerWaalsContact C-N 3.35Å; V46-M48 PolarHBondContact O-N 3.43Å
49	R	54.9	Low	69.5	Low	179 Å²	179	127.3 Å²	127.3	68%	0.675	63%	0.631	S	S	*	*			trans	-98.5	81.4	170.8	-73.1	-155.3	-165.1	-160.3	6.1	109.8	Y45 V46	Y45-R49 VanDerWaalsContact CE1-NH2 3.31Å; Y45-R49 PolarHBondContact OH-NH2 3.14Å; V46-R49 PolarHBondContact O-N 2.83Å
50	E	52.4	Low	68	Low	260 Å²	260	133.9 Å²	133.9	100%	1.215	65%	0.647	S	S	*	*			trans	-128	0	158.2	-133.6	170.6	-163	0	0	109

Retrieved 50 of 50 residues in 62.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).