A0A096LP32_HUMAN Loading...

Cyclin dependent kinase like 5

AlphaFold DB , UniProt , Accession A0A096LP32, Species HUMAN (Homo sapiens, Human), Gene CDKL5, Length 68 aa.

						>A0A096LP32_HUMAN|A0A096LP32|CDKL5
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.8	Very low	58.3	Low	242 Å²	242	127.7 Å²	127.7	100%	1.192	69%	0.689	S	S	*	*				0	108.6	0	-130.3	169.5	176.7	0	0	106.9	I3	M1-I3 PolarHBondContact O-N 2.89Å
2	K	35.3	Very low	61.2	Low	211 Å²	211	126.3 Å²	126.3	92%	0.917	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-77.2	122.7	-178.4	-73.3	-179.5	177.2	179.6	0	108.5
3	I	48.3	Very low	63.9	Low	146 Å²	146	119.8 Å²	119.8	75%	0.749	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-62.1	124.1	172.2	-56.3	168.7	0	0	0	106.4	M1 N5	M1-I3 PolarHBondContact O-N 2.89Å; I3-N5 PolarHBondContact O-N 3.13Å
4	P	48.3	Very low	66.2	Low	109 Å²	109	118.2 Å²	118.2	71%	0.708	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-59.5	139.1	-179.3	22.1	-30.4	0	0	0	109.9	I6	P4-I6 PolarHBondContact O-N 3.01Å
5	N	49.1	Very low	68.2	Low	143 Å²	143	117 Å²	117	77%	0.765	61%	0.614	S	S	*	*			trans	-55.8	107.1	-178.2	-170.2	-25.8	0	0	0	110.1	I3 G7	I3-N5 PolarHBondContact O-N 3.13Å; N5-G7 PolarHBondContact O-N 3.43Å; N5-G7 VanDerWaalsContact O-N 3.09Å; N5-G7 PolarHBondContact OD1-N 2.8Å; N5-G7 VanDerWaalsContact OD1-N 3.12Å
6	I	54.5	Low	69.9	Low	131 Å²	131	114.1 Å²	114.1	67%	0.672	60%	0.599	S	S	*	*	G	3₁₀ helix	trans	-60.5	-16.4	-178.7	-77.7	161.2	0	0	0	112.3	P4 N8 V9	P4-I6 PolarHBondContact O-N 3.01Å; I6-N8 PolarHBondContact O-N 3.34Å; I6-V9 PolarHBondContact O-N 2.81Å
7	G	52.7	Low	71.5	Confident	58 Å²	58	109.1 Å²	109.1	60%	0.598	58%	0.581	S	S	*	*	G	3₁₀ helix	trans	-58.1	-10.3	179.7	0	0	0	0	0	115.7	N5	N5-G7 PolarHBondContact O-N 3.43Å; N5-G7 VanDerWaalsContact O-N 3.09Å; N5-G7 PolarHBondContact OD1-N 2.8Å; N5-G7 VanDerWaalsContact OD1-N 3.12Å
8	N	62.5	Low	72.9	Confident	109 Å²	109	108.4 Å²	108.4	58%	0.583	58%	0.581	S	S	*	*	G	3₁₀ helix	trans	-112.6	-5.7	-177.5	-147.3	3.5	0	0	0	115.7	I6 N11	I6-N8 PolarHBondContact O-N 3.34Å; N8-N11 PolarHBondContact OD1-ND2 2.86Å
9	V	77.5	Confident	74.1	Confident	81 Å²	81	107.9 Å²	107.9	49%	0.491	58%	0.582	S	S	.	*	T	Hydrogen-bonded Turn	trans	-72.4	-43.2	-176.9	177.9	0	0	0	0	111.2	I6 N11 K12 F13	I6-V9 PolarHBondContact O-N 2.81Å; V9-N11 PolarHBondContact O-N 3.48Å; V9-K12 PolarHBondContact O-N 2.85Å; V9-F13 HydrophobicContact CG1-CE2 4.18Å; V9-F13 VanDerWaalsContact O-CD2 3.32Å; V9-F13 WeakPolarHBondContact O-CD2 3.37Å; V9-F13 WeakPolarHBondContact O-CE2 3.18Å
10	M	85.4	Confident	75.1	Confident	78 Å²	78	104.1 Å²	104.1	38%	0.384	57%	0.569	S	S	.	*	G	3₁₀ helix	trans	-66.8	-22.5	-177.9	-71	-55.5	-60.2	0	0	113.5	K12 F13 I41	M10-K12 PolarHBondContact O-N 2.81Å; M10-F13 PolarHBondContact O-N 2.82Å; M10-F13 VanDerWaalsContact O-N 3.07Å; M10-I41 HydrophobicContact CE-CD1 3.97Å; M10-I41 HydrophobicContact CE-CG2 4.37Å; M10-I41 HydrophobicContact SD-CD1 3.94Å; M10-I41 HydrophobicContact SD-CG2 4.02Å
11	N	89	Confident	76.1	Confident	97 Å²	97	105.6 Å²	105.6	52%	0.519	57%	0.573	S	S	.	*	G	3₁₀ helix	trans	-63.6	-23	177.8	-71.2	-24.1	0	0	0	113.2	N8 V9 F13 K33	N8-N11 PolarHBondContact OD1-ND2 2.86Å; V9-N11 PolarHBondContact O-N 3.48Å; N11-F13 PolarHBondContact O-N 3.41Å; N11-K33 WeakPolarHBondContact O-CD 3.39Å; N11-K33 WeakPolarHBondContact O-CE 3.35Å; N11-K33 PolarHBondContact O-NZ 2.88Å
12	K	93.4	Very high	78.4	Confident	111 Å²	111	96 Å²	96	48%	0.483	54%	0.536	S	S	.	.	G	3₁₀ helix	trans	-76	-9.8	177.3	-59.1	-171.9	176.4	-167.3	0	113.5	V9 M10 H32 K33	V9-K12 PolarHBondContact O-N 2.85Å; M10-K12 PolarHBondContact O-N 2.81Å; K12-H32 PolarHBondContact O-CD2 2.88Å; K12-K33 WeakPolarHBondContact O-CB 3.41Å; K12-K33 WeakPolarHBondContact O-CG 3.48Å; K12-K33 PolarHBondContact O-N 3.43Å
13	F	95.6	Very high	80.6	Confident	41 Å²	41	89.8 Å²	89.8	18%	0.18	52%	0.524	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	141.3	-173.5	-58.8	-86.3	0	0	0	111	V9 M10 N11 C30 R31 H32 K33 V39 I41	V9-F13 HydrophobicContact CG1-CE2 4.18Å; V9-F13 VanDerWaalsContact O-CD2 3.32Å; V9-F13 WeakPolarHBondContact O-CD2 3.37Å; V9-F13 WeakPolarHBondContact O-CE2 3.18Å; M10-F13 PolarHBondContact O-N 2.82Å; M10-F13 VanDerWaalsContact O-N 3.07Å; N11-F13 PolarHBondContact O-N 3.41Å; F13-C30 HydrophobicContact CB-CB 4.12Å; F13-C30 HydrophobicContact CD1-CB 4.45Å; F13-R31 CarbonylContact C-O 3.55Å; F13-R31 VanDerWaalsContact CA-O 3.31Å; F13-R31 WeakPolarHBondContact CA-O 3.44Å; F13-H32 HydrophobicContact CD1-CB 3.93Å; F13-H32 AromaticContact CD1-CD2 3.86Å; F13-H32 HydrophobicContact CE1-CB 3.79Å; F13-H32 AromaticContact CE1-CD2 3.39Å; F13-H32 WeakPolarHBondContact CE1-CD2 3.43Å; F13-H32 AromaticContact CE1-CG 3.94Å; F13-H32 AromaticContact CZ-CD2 3.64Å; F13-K33 WeakPolarHBondContact O-CE 3.47Å; F13-V39 HydrophobicContact CD1-CG2 3.79Å; F13-V39 HydrophobicContact CE1-CG2 3.75Å; F13-I41 HydrophobicContact CB-CD1 4.11Å; F13-I41 HydrophobicContact CD1-CD1 4Å; F13-I41 HydrophobicContact CD2-CD1 3.91Å; F13-I41 HydrophobicContact CE1-CD1 4.41Å; F13-I41 HydrophobicContact CE2-CD1 4.33Å; F13-I41 HydrophobicContact CG-CD1 3.73Å
14	E	96.2	Very high	82.3	Confident	98 Å²	98	89 Å²	89	46%	0.458	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	127.9	166.8	178.6	-173.4	-163.8	0	0	108.3	L16 C30 R31 K33	E14-L16 HydrophobicContact CG-CD2 4.19Å; E14-L16 PolarHBondContact O-N 2.81Å; E14-C30 CarbonylContact O-C 3.45Å; E14-C30 WeakPolarHBondContact O-CA 3.32Å; E14-C30 WeakPolarHBondContact O-CB 3.31Å; E14-R31 HydrophobicContact CB-CB 4.4Å; E14-R31 PolarHBondContact N-O 3.26Å; E14-R31 PolarHBondContact O-N 3.37Å; E14-K33 HydrophobicContact CB-CG 4.48Å
15	I	95.8	Very high	84.2	Confident	100 Å²	100	84 Å²	84	51%	0.513	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	117.6	177.6	-60.1	169.1	0	0	0	108	L28	I15-L28 HydrophobicContact CD1-CD1 4.11Å; I15-L28 HydrophobicContact CG1-CD1 4.41Å; I15-L28 HydrophobicContact CG2-CD2 4.4Å
16	L	96.8	Very high	86.2	Confident	70 Å²	70	78.7 Å²	78.7	37%	0.366	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.8	-23	178.4	-58	-177.9	0	0	0	112.4	E14 K29 R31 I38	E14-L16 HydrophobicContact CG-CD2 4.19Å; E14-L16 PolarHBondContact O-N 2.81Å; L16-K29 HydrophobicContact CB-CB 4.48Å; L16-K29 HydrophobicContact CB-CG 4.27Å; L16-K29 WeakPolarHBondContact CB-O 3.44Å; L16-K29 HydrophobicContact CD1-CD 4.5Å; L16-K29 HydrophobicContact CD1-CG 4.3Å; L16-K29 PolarHBondContact N-O 2.66Å; L16-R31 HydrophobicContact CD1-CB 4.1Å; L16-R31 HydrophobicContact CD2-CB 4.34Å; L16-R31 HydrophobicContact CG-CB 4.27Å; L16-I38 HydrophobicContact CD1-CD1 3.72Å
17	G	96.4	Very high	88.1	Confident	29 Å²	29	74.5 Å²	74.5	30%	0.299	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	160.7	-178.2	176.9	0	0	0	0	0	113.2	L28 K29	G17-L28 CarbonylContact O-C 3.59Å; G17-L28 WeakPolarHBondContact O-CA 3.45Å; G17-K29 PolarHBondContact N-O 2.95Å; G17-K29 PolarHBondContact O-N 2.86Å
18	V	96.9	Very high	90.2	Very high	97 Å²	97	72.8 Å²	72.8	59%	0.588	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91	131.1	174	177.2	0	0	0	0	109	V26 L28	V18-V26 HydrophobicContact CB-CG1 4.46Å; V18-V26 HydrophobicContact CG1-CG1 3.63Å; V18-V26 HydrophobicContact CG2-CG1 4.06Å; V18-L28 HydrophobicContact CG2-CD2 3.87Å
19	V	96.2	Very high	91.8	Very high	99 Å²	99	72.3 Å²	72.3	60%	0.6	40%	0.403	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.2	-39.3	172.2	-179	0	0	0	0	110.4	V27 K29	V19-V27 HydrophobicContact CB-CB 4.31Å; V19-V27 HydrophobicContact CB-CG1 4.08Å; V19-V27 HydrophobicContact CG2-CG1 4.4Å; V19-V27 PolarHBondContact N-O 3.4Å; V19-K29 HydrophobicContact CG2-CB 3.62Å
20	G	94.3	Very high	92.7	Very high	31 Å²	31	68.4 Å²	68.4	32%	0.32	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-176.1	159.2	178.2	0	0	0	0	0	112.8	V27	G20-V27 PolarHBondContact N-O 3.33Å; G20-V27 PolarHBondContact O-N 2.9Å
21	E	94.4	Very high	93.3	Very high	137 Å²	137	68.6 Å²	68.6	64%	0.64	38%	0.376	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.9	136.8	174	178.6	171.8	176.5	0	0	109.5	V26 K45	E21-V26 HydrophobicContact CB-CG2 4.31Å; E21-V26 HydrophobicContact CG-CG2 4.02Å; E21-K45 WeakPolarHBondContact OE1-CE 3.33Å; E21-K45 IonicContact OE1-NZ 2.74Å; E21-K45 PolarHBondContact OE1-NZ 3.39Å
22	G	87.1	Confident	93.7	Very high	41 Å²	41	65.3 Å²	65.3	42%	0.423	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	-176.5	173.8	0	0	0	0	0	112.1	Y24 G25 K45	G22-Y24 PolarHBondContact O-N 3.28Å; G22-G25 PolarHBondContact N-O 2.85Å; G22-G25 PolarHBondContact O-N 2.87Å; G22-K45 PolarHBondContact O-NZ 3.34Å
23	A	83	Confident	93.8	Very high	80 Å²	80	65.4 Å²	65.4	66%	0.661	36%	0.358	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.7	-37.1	179.4	0	0	0	0	0	112.6
24	Y	82.6	Confident	93.8	Very high	129 Å²	129	70.7 Å²	70.7	51%	0.506	38%	0.383	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.8	-9.4	-170.8	-55.6	-71.1	0	0	0	114.9	G22 F44 K45 V53	G22-Y24 PolarHBondContact O-N 3.28Å; Y24-F44 WeakPolarHBondContact O-CA 3.32Å; Y24-K45 PolarHBondContact O-N 3Å; Y24-V53 HydrophobicContact CD1-CG1 3.81Å; Y24-V53 HydrophobicContact CE1-CG1 3.91Å; Y24-V53 HydrophobicContact CE1-CG2 4.34Å
25	G	88.4	Confident	93.8	Very high	4 Å²	4	70 Å²	70	4%	0.041	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	167.9	179.4	-169.9	0	0	0	0	0	115.1	G22 K43	G22-G25 PolarHBondContact N-O 2.85Å; G22-G25 PolarHBondContact O-N 2.87Å; G25-K43 CarbonylContact C-O 3.47Å; G25-K43 WeakPolarHBondContact CA-O 3.49Å
26	V	92.1	Very high	93.8	Very high	32 Å²	32	71.2 Å²	71.2	19%	0.194	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	133.5	177.3	-177.7	0	0	0	0	108.9	V18 E21 L28 K43	V18-V26 HydrophobicContact CB-CG1 4.46Å; V18-V26 HydrophobicContact CG1-CG1 3.63Å; V18-V26 HydrophobicContact CG2-CG1 4.06Å; E21-V26 HydrophobicContact CB-CG2 4.31Å; E21-V26 HydrophobicContact CG-CG2 4.02Å; V26-L28 HydrophobicContact CG1-CD2 3.93Å; V26-K43 PolarHBondContact N-O 3.34Å; V26-K43 PolarHBondContact O-N 3.26Å
27	V	94.3	Very high	93.8	Very high	43 Å²	43	73.7 Å²	73.7	26%	0.261	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	120.3	172.2	-176.6	0	0	0	0	108.6	V19 G20 A40 K42	V19-V27 HydrophobicContact CB-CB 4.31Å; V19-V27 HydrophobicContact CB-CG1 4.08Å; V19-V27 HydrophobicContact CG2-CG1 4.4Å; V19-V27 PolarHBondContact N-O 3.4Å; G20-V27 PolarHBondContact N-O 3.33Å; G20-V27 PolarHBondContact O-N 2.9Å; V27-A40 HydrophobicContact CG1-CB 4.02Å; V27-K42 HydrophobicContact CG2-CB 4.34Å; V27-K42 HydrophobicContact CG2-CG 4.16Å
28	L	95.8	Very high	93.9	Very high	22 Å²	22	76.1 Å²	76.1	12%	0.115	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	137.8	178.3	-57.2	175.5	0	0	0	109.8	I15 G17 V18 V26 A40 I41	I15-L28 HydrophobicContact CD1-CD1 4.11Å; I15-L28 HydrophobicContact CG1-CD1 4.41Å; I15-L28 HydrophobicContact CG2-CD2 4.4Å; G17-L28 CarbonylContact O-C 3.59Å; G17-L28 WeakPolarHBondContact O-CA 3.45Å; V18-L28 HydrophobicContact CG2-CD2 3.87Å; V26-L28 HydrophobicContact CG1-CD2 3.93Å; L28-A40 CarbonylContact O-C 3.55Å; L28-A40 WeakPolarHBondContact O-CA 3.49Å; L28-I41 PolarHBondContact N-O 3.5Å; L28-I41 PolarHBondContact O-N 2.79Å
29	K	96.8	Very high	93.8	Very high	98 Å²	98	73.2 Å²	73.2	43%	0.426	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	122.7	163.8	-175.2	176.5	176.3	174.7	0	107.1	L16 G17 V19 I38	L16-K29 HydrophobicContact CB-CB 4.48Å; L16-K29 HydrophobicContact CB-CG 4.27Å; L16-K29 WeakPolarHBondContact CB-O 3.44Å; L16-K29 HydrophobicContact CD1-CD 4.5Å; L16-K29 HydrophobicContact CD1-CG 4.3Å; L16-K29 PolarHBondContact N-O 2.66Å; G17-K29 PolarHBondContact N-O 2.95Å; G17-K29 PolarHBondContact O-N 2.86Å; V19-K29 HydrophobicContact CG2-CB 3.62Å; K29-I38 HydrophobicContact CG-CG2 4.16Å
30	C	97.1	Very high	93.7	Very high	0 Å²	0	72.1 Å²	72.1	0%	0	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	156.4	-179	-60.3	0	0	0	0	111.1	F13 E14 I38 V39 I41	F13-C30 HydrophobicContact CB-CB 4.12Å; F13-C30 HydrophobicContact CD1-CB 4.45Å; E14-C30 CarbonylContact O-C 3.45Å; E14-C30 WeakPolarHBondContact O-CA 3.32Å; E14-C30 WeakPolarHBondContact O-CB 3.31Å; C30-I38 WeakPolarHBondContact O-CA 3.38Å; C30-V39 HydrophobicContact CB-CG2 3.98Å; C30-V39 PolarHBondContact N-O 3.19Å; C30-V39 PolarHBondContact O-N 3.41Å; C30-I41 HydrophobicContact CB-CD1 3.97Å; C30-I41 HydrophobicContact CB-CG1 4.24Å
31	R	97.5	Very high	93.7	Very high	82 Å²	82	72.3 Å²	72.3	31%	0.309	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	127.4	167	-175.4	-177.1	-58.9	-80	5	108.9	F13 E14 L16 K33 H36 E37 I38	F13-R31 CarbonylContact C-O 3.55Å; F13-R31 VanDerWaalsContact CA-O 3.31Å; F13-R31 WeakPolarHBondContact CA-O 3.44Å; E14-R31 HydrophobicContact CB-CB 4.4Å; E14-R31 PolarHBondContact N-O 3.26Å; E14-R31 PolarHBondContact O-N 3.37Å; L16-R31 HydrophobicContact CD1-CB 4.1Å; L16-R31 HydrophobicContact CD2-CB 4.34Å; L16-R31 HydrophobicContact CG-CB 4.27Å; R31-K33 PolarHBondContact O-N 3.34Å; R31-H36 PolarHBondContact NH1-O 2.81Å; R31-H36 VanDerWaalsContact NH1-O 3.13Å; R31-E37 CarbonylContact C-O 3.59Å; R31-E37 WeakPolarHBondContact CA-O 3.46Å; R31-I38 HydrophobicContact CB-CD1 4.22Å; R31-I38 HydrophobicContact CG-CD1 4.32Å
32	H	96.6	Very high	93.5	Very high	27 Å²	27	70.1 Å²	70.1	13%	0.125	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.1	125	169	-173	-112.2	0	0	0	109.2	K12 F13 E34 T35 H36 E37	K12-H32 PolarHBondContact O-CD2 2.88Å; F13-H32 HydrophobicContact CD1-CB 3.93Å; F13-H32 AromaticContact CD1-CD2 3.86Å; F13-H32 HydrophobicContact CE1-CB 3.79Å; F13-H32 AromaticContact CE1-CD2 3.39Å; F13-H32 WeakPolarHBondContact CE1-CD2 3.43Å; F13-H32 AromaticContact CE1-CG 3.94Å; F13-H32 AromaticContact CZ-CD2 3.64Å; H32-E34 VanDerWaalsContact C-N 3.31Å; H32-E34 IonicContact CE1-OE2 3.99Å; H32-E34 PolarHBondContact O-N 3.18Å; H32-T35 WeakPolarHBondContact CB-OG1 3.13Å; H32-T35 WeakPolarHBondContact ND1-CG2 3.48Å; H32-T35 PolarHBondContact ND1-N 2.82Å; H32-T35 PolarHBondContact ND1-OG1 2.87Å; H32-H36 WeakPolarHBondContact O-CA 3.49Å; H32-H36 PolarHBondContact O-N 3.47Å; H32-E37 PolarHBondContact N-O 3.07Å
33	K	95.4	Very high	93.5	Very high	113 Å²	113	75 Å²	75	49%	0.491	38%	0.379	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65	-33.6	-168.5	-70.8	176.5	-178.6	172.8	0	113.2	N11 K12 F13 E14 R31	N11-K33 WeakPolarHBondContact O-CD 3.39Å; N11-K33 WeakPolarHBondContact O-CE 3.35Å; N11-K33 PolarHBondContact O-NZ 2.88Å; K12-K33 WeakPolarHBondContact O-CB 3.41Å; K12-K33 WeakPolarHBondContact O-CG 3.48Å; K12-K33 PolarHBondContact O-N 3.43Å; F13-K33 WeakPolarHBondContact O-CE 3.47Å; E14-K33 HydrophobicContact CB-CG 4.48Å; R31-K33 PolarHBondContact O-N 3.34Å
34	E	95.8	Very high	93.6	Very high	153 Å²	153	73.7 Å²	73.7	72%	0.715	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.5	-43.1	-176.5	-64.3	174.6	177.7	0	0	112.8	H32	H32-E34 VanDerWaalsContact C-N 3.31Å; H32-E34 IonicContact CE1-OE2 3.99Å; H32-E34 PolarHBondContact O-N 3.18Å
35	T	96.9	Very high	93.4	Very high	83 Å²	83	71.2 Å²	71.2	51%	0.509	35%	0.351	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.7	-9.7	-176.3	62.1	0	0	0	0	112.8	H32 E37	H32-T35 WeakPolarHBondContact CB-OG1 3.13Å; H32-T35 WeakPolarHBondContact ND1-CG2 3.48Å; H32-T35 PolarHBondContact ND1-N 2.82Å; H32-T35 PolarHBondContact ND1-OG1 2.87Å; T35-E37 PolarHBondContact O-N 2.81Å; T35-E37 WeakPolarHBondContact OG1-CB 3.35Å
36	H	95.3	Very high	92.4	Very high	125 Å²	125	78.9 Å²	78.9	58%	0.579	39%	0.39	S	S	*	.			trans	57.6	8.6	-172.2	-61	-59.3	0	0	0	115.8	R31 H32	R31-H36 PolarHBondContact NH1-O 2.81Å; R31-H36 VanDerWaalsContact NH1-O 3.13Å; H32-H36 WeakPolarHBondContact O-CA 3.49Å; H32-H36 PolarHBondContact O-N 3.47Å
37	E	97.8	Very high	90.7	Very high	122 Å²	122	81.3 Å²	81.3	57%	0.57	41%	0.409	S	S	*	.			trans	-65.2	139.3	179.3	-169.9	179.1	176.1	0	0	111.2	R31 H32 T35 V39	R31-E37 CarbonylContact C-O 3.59Å; R31-E37 WeakPolarHBondContact CA-O 3.46Å; H32-E37 PolarHBondContact N-O 3.07Å; T35-E37 PolarHBondContact O-N 2.81Å; T35-E37 WeakPolarHBondContact OG1-CB 3.35Å; E37-V39 HydrophobicContact CG-CG1 4.15Å
38	I	96.8	Very high	88.9	Confident	80 Å²	80	82.3 Å²	82.3	41%	0.41	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	122.2	174.3	-59.3	-58.7	0	0	0	108.7	L16 K29 C30 R31	L16-I38 HydrophobicContact CD1-CD1 3.72Å; K29-I38 HydrophobicContact CG-CG2 4.16Å; C30-I38 WeakPolarHBondContact O-CA 3.38Å; R31-I38 HydrophobicContact CB-CD1 4.22Å; R31-I38 HydrophobicContact CG-CD1 4.32Å
39	V	95.8	Very high	87.2	Confident	37 Å²	37	90 Å²	90	22%	0.224	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	157.1	-178.3	-58.6	0	0	0	0	111.1	F13 C30 E37 I41	F13-V39 HydrophobicContact CD1-CG2 3.79Å; F13-V39 HydrophobicContact CE1-CG2 3.75Å; C30-V39 HydrophobicContact CB-CG2 3.98Å; C30-V39 PolarHBondContact N-O 3.19Å; C30-V39 PolarHBondContact O-N 3.41Å; E37-V39 HydrophobicContact CG-CG1 4.15Å; V39-I41 HydrophobicContact CG2-CD1 4.43Å; V39-I41 HydrophobicContact CG2-CG1 4.18Å
40	A	95.1	Very high	85.9	Confident	76 Å²	76	89.1 Å²	89.1	63%	0.628	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.2	129	169.1	0	0	0	0	0	109.8	V27 L28	V27-A40 HydrophobicContact CG1-CB 4.02Å; L28-A40 CarbonylContact O-C 3.55Å; L28-A40 WeakPolarHBondContact O-CA 3.49Å
41	I	93	Very high	84.8	Confident	34 Å²	34	96.5 Å²	96.5	17%	0.174	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	116.2	176.8	-59.5	-174.7	0	0	0	108.9	M10 F13 L28 C30 V39	M10-I41 HydrophobicContact CE-CD1 3.97Å; M10-I41 HydrophobicContact CE-CG2 4.37Å; M10-I41 HydrophobicContact SD-CD1 3.94Å; M10-I41 HydrophobicContact SD-CG2 4.02Å; F13-I41 HydrophobicContact CB-CD1 4.11Å; F13-I41 HydrophobicContact CD1-CD1 4Å; F13-I41 HydrophobicContact CD2-CD1 3.91Å; F13-I41 HydrophobicContact CE1-CD1 4.41Å; F13-I41 HydrophobicContact CE2-CD1 4.33Å; F13-I41 HydrophobicContact CG-CD1 3.73Å; L28-I41 PolarHBondContact N-O 3.5Å; L28-I41 PolarHBondContact O-N 2.79Å; C30-I41 HydrophobicContact CB-CD1 3.97Å; C30-I41 HydrophobicContact CB-CG1 4.24Å; V39-I41 HydrophobicContact CG2-CD1 4.43Å; V39-I41 HydrophobicContact CG2-CG1 4.18Å
42	K	90.2	Very high	83.7	Confident	91 Å²	91	99.6 Å²	99.6	40%	0.396	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.7	110.8	174.5	-171.3	171.7	-179.5	-178.1	0	109.7	V27 F44	V27-K42 HydrophobicContact CG2-CB 4.34Å; V27-K42 HydrophobicContact CG2-CG 4.16Å; K42-F44 HydrophobicContact CD-CE1 4.11Å; K42-F44 HydrophobicContact CD-CE2 4.42Å; K42-F44 HydrophobicContact CD-CZ 3.86Å; K42-F44 HydrophobicContact CG-CE1 4.48Å; K42-F44 HydrophobicContact CG-CE2 4.24Å; K42-F44 HydrophobicContact CG-CZ 4.15Å
43	K	87.9	Confident	82.7	Confident	144 Å²	144	100 Å²	100	63%	0.626	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.5	115.6	171.5	-176.3	179.7	178.3	-176.1	0	108.6	G25 V26	G25-K43 CarbonylContact C-O 3.47Å; G25-K43 WeakPolarHBondContact CA-O 3.49Å; V26-K43 PolarHBondContact N-O 3.34Å; V26-K43 PolarHBondContact O-N 3.26Å
44	F	84.1	Confident	81.9	Confident	53 Å²	53	99 Å²	99	23%	0.232	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.5	147.8	176.7	-64.3	-92.2	0	0	0	110.9	Y24 K42 E48 T57	Y24-F44 WeakPolarHBondContact O-CA 3.32Å; K42-F44 HydrophobicContact CD-CE1 4.11Å; K42-F44 HydrophobicContact CD-CE2 4.42Å; K42-F44 HydrophobicContact CD-CZ 3.86Å; K42-F44 HydrophobicContact CG-CE1 4.48Å; K42-F44 HydrophobicContact CG-CE2 4.24Å; K42-F44 HydrophobicContact CG-CZ 4.15Å; F44-E48 HydrophobicContact CB-CG 4.47Å; F44-E48 WeakPolarHBondContact CB-OE1 3.47Å; F44-E48 VanDerWaalsContact CG-OE1 3.29Å; F44-E48 WeakPolarHBondContact CG-OE1 3.31Å; F44-T57 HydrophobicContact CD1-CG2 4.34Å; F44-T57 HydrophobicContact CE1-CG2 3.51Å; F44-T57 HydrophobicContact CE2-CG2 4.44Å; F44-T57 HydrophobicContact CZ-CG2 3.57Å
45	K	79.8	Confident	81.3	Confident	77 Å²	77	96.1 Å²	96.1	34%	0.335	49%	0.485	S	S	.	.			trans	-75.7	144.7	174.1	-71.4	174.3	179.4	176.3	0	108.8	E21 G22 Y24 S47	E21-K45 WeakPolarHBondContact OE1-CE 3.33Å; E21-K45 IonicContact OE1-NZ 2.74Å; E21-K45 PolarHBondContact OE1-NZ 3.39Å; G22-K45 PolarHBondContact O-NZ 3.34Å; Y24-K45 PolarHBondContact O-N 3Å; K45-S47 PolarHBondContact O-N 3.13Å
46	D	65.8	Low	80.7	Confident	164 Å²	164	95.5 Å²	95.5	88%	0.877	48%	0.481	S	S	*	.	S	Bend	trans	-63	2.5	-178.2	-67	-41.2	0	0	0	114.6	E48	D46-E48 PolarHBondContact O-N 3.49Å
47	S	56.4	Low	80.1	Confident	83 Å²	83	90.4 Å²	90.4	58%	0.58	46%	0.459	S	S	*	.			trans	-71.3	17.4	171.6	58.1	0	0	0	0	114.1	K45 E49	K45-S47 PolarHBondContact O-N 3.13Å; S47-E49 PolarHBondContact O-N 2.94Å; S47-E49 VanDerWaalsContact O-N 3.13Å
48	E	56.8	Low	79.5	Confident	64 Å²	64	88.6 Å²	88.6	30%	0.299	45%	0.453	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.3	16	178.1	-70.1	-167.2	172.8	0	0	113.9	F44 D46 N50 K54	F44-E48 HydrophobicContact CB-CG 4.47Å; F44-E48 WeakPolarHBondContact CB-OE1 3.47Å; F44-E48 VanDerWaalsContact CG-OE1 3.29Å; F44-E48 WeakPolarHBondContact CG-OE1 3.31Å; D46-E48 PolarHBondContact O-N 3.49Å; E48-N50 PolarHBondContact O-N 3.48Å; E48-K54 WeakPolarHBondContact O-CD 3.48Å; E48-K54 WeakPolarHBondContact O-CE 3.08Å; E48-K54 PolarHBondContact O-NZ 3.21Å
49	E	60.1	Low	79	Confident	183 Å²	183	92.9 Å²	92.9	86%	0.855	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	-14.5	173.6	-67.4	-168.4	167.3	0	0	112.9	S47 E51	S47-E49 PolarHBondContact O-N 2.94Å; S47-E49 VanDerWaalsContact O-N 3.13Å; E49-E51 PolarHBondContact O-N 3.28Å
50	N	69.3	Low	78.4	Confident	80 Å²	80	95.5 Å²	95.5	43%	0.428	47%	0.474	S	S	.	.			trans	-81.3	113	174.4	-170.4	-28.1	0	0	0	111.4	E48 E52 V53 K54	E48-N50 PolarHBondContact O-N 3.48Å; N50-E52 VanDerWaalsContact C-N 3.25Å; N50-E52 PolarHBondContact O-N 3.42Å; N50-E52 WeakPolarHBondContact OD1-CB 3.35Å; N50-E52 PolarHBondContact OD1-N 2.98Å; N50-V53 HydrophobicContact CB-CB 4.33Å; N50-V53 HydrophobicContact CB-CG2 3.92Å; N50-V53 WeakPolarHBondContact O-CB 3.43Å; N50-V53 PolarHBondContact O-N 2.99Å; N50-V53 VanDerWaalsContact O-N 3.08Å; N50-K54 PolarHBondContact O-N 2.94Å
51	E	74.4	Confident	78	Confident	155 Å²	155	95 Å²	95	72%	0.724	46%	0.46	S	S	*	.	H	α-helix	trans	-58.9	-32.3	-179.1	-163.3	155.5	-157.8	0	0	113.2	E49 V53 K54 E55	E49-E51 PolarHBondContact O-N 3.28Å; E51-V53 VanDerWaalsContact C-N 3.35Å; E51-V53 PolarHBondContact O-N 2.74Å; E51-K54 PolarHBondContact O-N 3.49Å; E51-E55 PolarHBondContact O-N 3.27Å
52	E	75.6	Confident	77.7	Confident	148 Å²	148	100.3 Å²	100.3	69%	0.692	48%	0.482	S	S	*	.	H	α-helix	trans	-67.1	-35.5	176.3	-58.6	179.1	166.5	0	0	112.3	N50 T56	N50-E52 VanDerWaalsContact C-N 3.25Å; N50-E52 PolarHBondContact O-N 3.42Å; N50-E52 WeakPolarHBondContact OD1-CB 3.35Å; N50-E52 PolarHBondContact OD1-N 2.98Å; E52-T56 WeakPolarHBondContact O-CB 3.29Å; E52-T56 PolarHBondContact O-N 3.22Å; E52-T56 PolarHBondContact O-OG1 3.49Å
53	V	75.5	Confident	77.6	Confident	35 Å²	35	101.8 Å²	101.8	21%	0.212	49%	0.492	C	S	.	.	H	α-helix	trans	-70.8	-39.1	177.5	177.4	0	0	0	0	110.3	Y24 N50 E51 T56 T57	Y24-V53 HydrophobicContact CD1-CG1 3.81Å; Y24-V53 HydrophobicContact CE1-CG1 3.91Å; Y24-V53 HydrophobicContact CE1-CG2 4.34Å; N50-V53 HydrophobicContact CB-CB 4.33Å; N50-V53 HydrophobicContact CB-CG2 3.92Å; N50-V53 WeakPolarHBondContact O-CB 3.43Å; N50-V53 PolarHBondContact O-N 2.99Å; N50-V53 VanDerWaalsContact O-N 3.08Å; E51-V53 VanDerWaalsContact C-N 3.35Å; E51-V53 PolarHBondContact O-N 2.74Å; V53-T56 PolarHBondContact O-N 2.99Å; V53-T57 WeakPolarHBondContact O-CB 3.01Å; V53-T57 PolarHBondContact O-N 3.25Å; V53-T57 PolarHBondContact O-OG1 2.94Å
54	K	77.7	Confident	77.5	Confident	92 Å²	92	100.2 Å²	100.2	40%	0.4	49%	0.489	S	S	.	.	H	α-helix	trans	-62.4	-47	174	-79.1	173.8	163.5	141.4	0	111.7	E48 N50 E51 T56 T57 L58	E48-K54 WeakPolarHBondContact O-CD 3.48Å; E48-K54 WeakPolarHBondContact O-CE 3.08Å; E48-K54 PolarHBondContact O-NZ 3.21Å; N50-K54 PolarHBondContact O-N 2.94Å; E51-K54 PolarHBondContact O-N 3.49Å; K54-T56 PolarHBondContact O-N 3.04Å; K54-T57 PolarHBondContact O-N 3.25Å; K54-L58 WeakPolarHBondContact O-CG 3.36Å; K54-L58 PolarHBondContact O-N 2.76Å
55	E	83.8	Confident	77.6	Confident	92 Å²	92	107.8 Å²	107.8	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-60.4	-45.2	178.1	-80.9	-59.9	120.3	0	0	112.1	E51 T57 L58 R59	E51-E55 PolarHBondContact O-N 3.27Å; E55-T57 PolarHBondContact O-N 3.42Å; E55-L58 PolarHBondContact O-N 2.88Å; E55-R59 WeakPolarHBondContact O-CG 3.34Å; E55-R59 PolarHBondContact O-N 3.46Å
56	T	83.9	Confident	77.9	Confident	71 Å²	71	109.3 Å²	109.3	44%	0.436	53%	0.532	S	S	.	.	H	α-helix	trans	-61.7	-45.6	176.6	-55.8	0	0	0	0	110.9	E52 V53 K54 L58 R59 E60	E52-T56 WeakPolarHBondContact O-CB 3.29Å; E52-T56 PolarHBondContact O-N 3.22Å; E52-T56 PolarHBondContact O-OG1 3.49Å; V53-T56 PolarHBondContact O-N 2.99Å; K54-T56 PolarHBondContact O-N 3.04Å; T56-L58 PolarHBondContact O-N 3.49Å; T56-R59 PolarHBondContact O-N 3.05Å; T56-E60 WeakPolarHBondContact O-CG 3.5Å; T56-E60 PolarHBondContact O-N 3.01Å
57	T	82.9	Confident	78.6	Confident	17 Å²	17	106.7 Å²	106.7	10%	0.104	52%	0.518	C	S	.	.	H	α-helix	trans	-61	-42.5	177.8	-58.9	0	0	0	0	112.1	F44 V53 K54 E55 R59 E60 L61	F44-T57 HydrophobicContact CD1-CG2 4.34Å; F44-T57 HydrophobicContact CE1-CG2 3.51Å; F44-T57 HydrophobicContact CE2-CG2 4.44Å; F44-T57 HydrophobicContact CZ-CG2 3.57Å; V53-T57 WeakPolarHBondContact O-CB 3.01Å; V53-T57 PolarHBondContact O-N 3.25Å; V53-T57 PolarHBondContact O-OG1 2.94Å; K54-T57 PolarHBondContact O-N 3.25Å; E55-T57 PolarHBondContact O-N 3.42Å; T57-R59 PolarHBondContact O-N 3.36Å; T57-E60 PolarHBondContact O-N 2.83Å; T57-L61 HydrophobicContact CG2-CD1 4.19Å; T57-L61 HydrophobicContact CG2-CG 4.5Å; T57-L61 WeakPolarHBondContact O-CB 3.32Å; T57-L61 VanDerWaalsContact O-CG 3.31Å; T57-L61 WeakPolarHBondContact O-CG 3.35Å; T57-L61 PolarHBondContact O-N 3.35Å
58	L	83.9	Confident	78.6	Confident	85 Å²	85	116.2 Å²	116.2	45%	0.445	55%	0.549	S	S	.	.	H	α-helix	trans	-65.1	-38.2	177.4	-73.5	174.9	0	0	0	112.5	K54 E55 T56 L61 K62	K54-L58 WeakPolarHBondContact O-CG 3.36Å; K54-L58 PolarHBondContact O-N 2.76Å; E55-L58 PolarHBondContact O-N 2.88Å; T56-L58 PolarHBondContact O-N 3.49Å; L58-L61 PolarHBondContact O-N 3.08Å; L58-K62 WeakPolarHBondContact O-CG 3.46Å; L58-K62 PolarHBondContact O-N 2.74Å
59	R	86	Confident	79.7	Confident	169 Å²	169	118.8 Å²	118.8	64%	0.638	56%	0.561	S	S	*	*	H	α-helix	trans	-64.1	-46.5	175	-71	173	-170.1	-175.4	3.2	111.2	E55 T56 T57 L61 K62 M63	E55-R59 WeakPolarHBondContact O-CG 3.34Å; E55-R59 PolarHBondContact O-N 3.46Å; T56-R59 PolarHBondContact O-N 3.05Å; T57-R59 PolarHBondContact O-N 3.36Å; R59-L61 PolarHBondContact O-N 3.47Å; R59-K62 PolarHBondContact O-N 2.88Å; R59-M63 PolarHBondContact O-N 3.13Å
60	E	84.6	Confident	80.7	Confident	93 Å²	93	115.4 Å²	115.4	44%	0.435	55%	0.546	S	S	.	.	H	α-helix	trans	-59	-46.3	175.5	-71.4	-178.4	177.4	0	0	111.6	T56 T57 K62 M63 L64	T56-E60 WeakPolarHBondContact O-CG 3.5Å; T56-E60 PolarHBondContact O-N 3.01Å; T57-E60 PolarHBondContact O-N 2.83Å; E60-K62 VanDerWaalsContact C-N 3.34Å; E60-K62 PolarHBondContact O-N 2.97Å; E60-M63 PolarHBondContact O-N 3.23Å; E60-L64 WeakPolarHBondContact O-CG 2.95Å; E60-L64 PolarHBondContact O-N 2.91Å
61	L	85.3	Confident	81.3	Confident	65 Å²	65	117.4 Å²	117.4	34%	0.34	55%	0.552	S	S	.	*	H	α-helix	trans	-61.4	-40.7	177.6	-74.1	174	0	0	0	112.6	T57 L58 R59 R65	T57-L61 HydrophobicContact CG2-CD1 4.19Å; T57-L61 HydrophobicContact CG2-CG 4.5Å; T57-L61 WeakPolarHBondContact O-CB 3.32Å; T57-L61 VanDerWaalsContact O-CG 3.31Å; T57-L61 WeakPolarHBondContact O-CG 3.35Å; T57-L61 PolarHBondContact O-N 3.35Å; L58-L61 PolarHBondContact O-N 3.08Å; R59-L61 PolarHBondContact O-N 3.47Å; L61-R65 WeakPolarHBondContact O-CG 3.35Å; L61-R65 PolarHBondContact O-N 3.28Å; L61-R65 VanDerWaalsContact O-N 3.13Å
62	K	88.1	Confident	81.7	Confident	145 Å²	145	115.2 Å²	115.2	63%	0.63	54%	0.542	S	S	*	.	H	α-helix	trans	-61.5	-46.6	174.7	-77.5	174.9	-177.3	174.1	0	110.6	L58 R59 E60 R65 T66	L58-K62 WeakPolarHBondContact O-CG 3.46Å; L58-K62 PolarHBondContact O-N 2.74Å; R59-K62 PolarHBondContact O-N 2.88Å; E60-K62 VanDerWaalsContact C-N 3.34Å; E60-K62 PolarHBondContact O-N 2.97Å; K62-R65 PolarHBondContact O-N 2.98Å; K62-T66 WeakPolarHBondContact O-CG2 3.46Å; K62-T66 PolarHBondContact O-N 3Å
63	M	88.7	Confident	82.1	Confident	123 Å²	123	113.1 Å²	113.1	61%	0.606	53%	0.533	S	S	*	.	H	α-helix	trans	-60.4	-48.9	177.9	-177.5	-178.6	169.2	0	0	111.3	R59 E60 R65 T66 L67	R59-M63 PolarHBondContact O-N 3.13Å; E60-M63 PolarHBondContact O-N 3.23Å; M63-R65 VanDerWaalsContact C-N 3.27Å; M63-R65 PolarHBondContact O-N 3.37Å; M63-T66 PolarHBondContact O-N 3.45Å; M63-T66 PolarHBondContact O-OG1 3.41Å; M63-L67 PolarHBondContact O-N 3.49Å
64	L	85.2	Confident	82.5	Confident	110 Å²	110	118.3 Å²	118.3	58%	0.576	55%	0.554	S	S	*	*	H	α-helix	trans	-58.4	-37.1	179.5	-72.1	171.4	0	0	0	112.8	E60 T66 L67	E60-L64 WeakPolarHBondContact O-CG 2.95Å; E60-L64 PolarHBondContact O-N 2.91Å; L64-T66 PolarHBondContact O-N 3.09Å; L64-L67 HydrophobicContact CD2-CD1 4.2Å; L64-L67 PolarHBondContact O-N 3.12Å
65	R	85.1	Confident	82.9	Confident	212 Å²	212	120.2 Å²	120.2	80%	0.8	57%	0.565	S	S	*	*	H	α-helix	trans	-68.6	-19.9	176.1	-72.8	176.4	-176.3	178.4	3.1	113.9	L61 K62 M63	L61-R65 WeakPolarHBondContact O-CG 3.35Å; L61-R65 PolarHBondContact O-N 3.28Å; L61-R65 VanDerWaalsContact O-N 3.13Å; K62-R65 PolarHBondContact O-N 2.98Å; M63-R65 VanDerWaalsContact C-N 3.27Å; M63-R65 PolarHBondContact O-N 3.37Å
66	T	87.1	Confident	82.8	Confident	110 Å²	110	122.4 Å²	122.4	68%	0.675	58%	0.575	S	S	*	*	H	α-helix	trans	-91	-9.4	178.6	59.1	0	0	0	0	113.6	K62 M63 L64	K62-T66 WeakPolarHBondContact O-CG2 3.46Å; K62-T66 PolarHBondContact O-N 3Å; M63-T66 PolarHBondContact O-N 3.45Å; M63-T66 PolarHBondContact O-OG1 3.41Å; L64-T66 PolarHBondContact O-N 3.09Å
67	L	79.1	Confident	82.7	Confident	108 Å²	108	126.7 Å²	126.7	57%	0.565	59%	0.587	S	S	*	*			trans	-79.7	132	174	-58.3	176	0	0	0	109.2	M63 L64	M63-L67 PolarHBondContact O-N 3.49Å; L64-L67 HydrophobicContact CD2-CD1 4.2Å; L64-L67 PolarHBondContact O-N 3.12Å
68	K	56.8	Low	82.7	Confident	283 Å²	283	136.6 Å²	136.6	100%	1.23	63%	0.631	S	S	*	*			trans	-101.7	0	172.6	-81.8	-169.4	176.5	-176.8	0	110.5

Retrieved 68 of 68 residues in 12.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).