A0A096LP34_HUMAN Loading...

Peptidyl-tRNA hydrolase 1 homolog

AlphaFold DB , UniProt , Accession A0A096LP34, Species HUMAN (Homo sapiens, Human), Gene PTRH1, Length 137 aa.

						>A0A096LP34_HUMAN|A0A096LP34|PTRH1
MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMFPWCRPQVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.1	Very low	34.8	Very low	249 Å²	249	139.9 Å²	139.9	100%	1.227	85%	0.847	S	S	*	*				0	109.2	0	-87.4	166.6	163.6	0	0	109.4
2	R	44.6	Very low	34.4	Very low	243 Å²	243	149.7 Å²	149.7	92%	0.917	86%	0.857	S	S	*	*			trans	-120.7	142.3	159.6	-80.8	-174.9	165	-176.4	-3.6	105.7
3	P	41.5	Very low	34.6	Very low	139 Å²	139	148.7 Å²	148.7	90%	0.903	85%	0.846	S	S	*	*				-143.5	178.3	91.8	29.1	-7.8	0	0	0	110.8
4	G	31.3	Very low	34.5	Very low	74 Å²	74	146.4 Å²	146.4	76%	0.763	84%	0.844	S	S	*	*			cis	174.1	140.4	7.6	0	0	0	0	0	105.8
5	G	30.2	Very low	34.6	Very low	71 Å²	71	152.2 Å²	152.2	73%	0.732	85%	0.846	S	S	*	*				117.5	103.5	104.3	0	0	0	0	0	109.8
6	F	31.2	Very low	34.7	Very low	195 Å²	195	148.4 Å²	148.4	86%	0.855	84%	0.841	S	S	*	*				68.8	109.1	102.2	-97.1	-102.8	0	0	0	117
7	L	31.6	Very low	35	Very low	152 Å²	152	149.2 Å²	149.2	80%	0.796	84%	0.838	S	S	*	*			trans	43.4	125	136.5	-76.4	110.6	0	0	0	122.1
8	G	31.4	Very low	34.8	Very low	77 Å²	77	146.4 Å²	146.4	79%	0.794	83%	0.83	S	S	*	*				81.7	87.9	119	0	0	0	0	0	118.1	G10	G8-G10 PolarHBondContact O-N 3.42Å
9	A	31.9	Very low	34.8	Very low	113 Å²	113	151.4 Å²	151.4	93%	0.934	83%	0.834	S	S	*	*			trans	-95.9	74.9	161.1	0	0	0	0	0	110.1
10	G	27.9	Very low	35	Very low	60 Å²	60	147.6 Å²	147.6	62%	0.619	82%	0.818	S	S	*	*			trans	-72.3	147.6	161.5	0	0	0	0	0	111.1	G8	G8-G10 PolarHBondContact O-N 3.42Å
11	Q	40.3	Very low	35.2	Very low	166 Å²	166	146.4 Å²	146.4	78%	0.776	82%	0.815	S	S	*	*			trans	57.9	95.3	151.6	-55	-176.8	43.6	0	0	117.6
12	R	30.2	Very low	35.6	Very low	257 Å²	257	139.1 Å²	139.1	97%	0.97	78%	0.78	S	S	*	*			trans	-92.7	90	149.3	-70.2	-173.2	-155.2	-116.6	1.9	108.6	S14	R12-S14 PolarHBondContact O-N 3.17Å
13	L	36.2	Very low	35.5	Very low	137 Å²	137	135.6 Å²	135.6	72%	0.717	77%	0.774	S	S	*	*			trans	-57	113.1	167.3	-74.3	153.4	0	0	0	109.5	R15	L13-R15 VanDerWaalsContact C-N 3.3Å; L13-R15 PolarHBondContact O-N 3.46Å
14	S	33.6	Very low	35.6	Very low	116 Å²	116	134.7 Å²	134.7	81%	0.811	77%	0.768	S	S	*	*			trans	-71.3	90.4	166.5	56.4	0	0	0	0	109.1	R12 A16	R12-S14 PolarHBondContact O-N 3.17Å; S14-A16 PolarHBondContact O-N 3.48Å
15	R	35.6	Very low	36.6	Very low	234 Å²	234	135.7 Å²	135.7	88%	0.883	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.9	48.7	-171.8	-151.1	178.6	-171.3	-173.6	2.8	113	L13	L13-R15 VanDerWaalsContact C-N 3.3Å; L13-R15 PolarHBondContact O-N 3.46Å
16	A	37.2	Very low	37.3	Very low	92 Å²	92	136 Å²	136	76%	0.76	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.4	-6.4	-178.3	0	0	0	0	0	114.9	S14	S14-A16 PolarHBondContact O-N 3.48Å
17	M	40.1	Very low	38	Very low	161 Å²	161	133.1 Å²	133.1	79%	0.793	74%	0.739	S	S	*	*	S	Bend	trans	-119.7	3.8	-171.2	-67.4	-74.9	-90.2	0	0	114.6
18	S	31	Very low	38.8	Very low	100 Å²	100	129.9 Å²	129.9	70%	0.699	74%	0.743	S	S	*	*	S	Bend	trans	-107.4	22.4	-163.7	-59.1	0	0	0	0	116.5
19	R	34.8	Very low	39.3	Very low	240 Å²	240	133.9 Å²	133.9	91%	0.906	74%	0.738	S	S	*	*			trans	-139	22.8	-179.6	-118.1	-176	178.2	-151.3	-1.2	117.3	V21	R19-V21 VanDerWaalsContact C-N 3.32Å
20	C	37.7	Very low	39.9	Very low	75 Å²	75	139.8 Å²	139.8	51%	0.507	74%	0.736	S	S	.	*			trans	-94.2	75.6	150.6	-88.2	0	0	0	0	107.7	L22 R37	C20-L22 VanDerWaalsContact C-N 3.26Å; C20-L22 PolarHBondContact O-N 2.96Å; C20-R37 PolarHBondContact SG-NH2 2.63Å
21	V	39.1	Very low	41	Very low	123 Å²	123	142.1 Å²	142.1	75%	0.745	73%	0.727	S	S	*	*			trans	-67.8	101.7	156.2	176.5	0	0	0	0	104.2	R19 E23	R19-V21 VanDerWaalsContact C-N 3.32Å; V21-E23 VanDerWaalsContact C-N 3.35Å; V21-E23 PolarHBondContact O-N 3.32Å
22	L	49.8	Very low	40.7	Very low	97 Å²	97	142.3 Å²	142.3	51%	0.508	73%	0.729	S	S	.	*			trans	-66.3	98.3	170.3	-68.6	145.4	0	0	0	106.1	C20 L115	C20-L22 VanDerWaalsContact C-N 3.26Å; C20-L22 PolarHBondContact O-N 2.96Å; L22-L115 WeakPolarHBondContact CD1-O 3.07Å
23	E	42.7	Very low	41.1	Very low	168 Å²	168	137.5 Å²	137.5	79%	0.785	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-64.9	132.4	167.3	-73.9	-172.4	154.4	0	0	108.5	V21	V21-E23 VanDerWaalsContact C-N 3.35Å; V21-E23 PolarHBondContact O-N 3.32Å
24	P	44.4	Very low	41.8	Very low	121 Å²	121	133.8 Å²	133.8	79%	0.786	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-65.1	137.4	-179.9	24.8	-31.7	0	0	0	110.7	P26	P24-P26 WeakPolarHBondContact O-CD 3.49Å
25	R	51.3	Low	42.8	Very low	94 Å²	94	136.2 Å²	136.2	36%	0.355	69%	0.691	S	S	.	*	P	Polyproline II helix	trans	-59.9	124.3	179.5	-173.5	178.3	-176.8	137.1	0.4	110.9	K29 W31 E122	R25-K29 PolarHBondContact NH2-O 3.16Å; R25-W31 HydrophobicContact CG-CZ2 4.32Å; R25-E122 IonicContact NH1-OE2 3.78Å
26	P	45	Very low	43.9	Very low	78 Å²	78	127.6 Å²	127.6	51%	0.506	67%	0.666	S	S	.	*	P	Polyproline II helix	trans	-69.7	139.6	170.3	26	-30.7	0	0	0	110.4	P24	P24-P26 WeakPolarHBondContact O-CD 3.49Å
27	P	46.3	Very low	45.8	Very low	134 Å²	134	124.4 Å²	124.4	87%	0.87	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	136.8	-177.6	23	-31	0	0	0	111.8
28	G	48	Very low	48.2	Very low	85 Å²	85	118 Å²	118	88%	0.876	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	92.1	8.2	165.9	0	0	0	0	0	118.1
29	K	42.6	Very low	51.2	Low	161 Å²	161	113.2 Å²	113.2	70%	0.7	57%	0.572	S	S	*	*			trans	-118.2	134.1	174.6	-55.3	-154.5	-179.2	-168.6	0	113	R25	R25-K29 PolarHBondContact NH2-O 3.16Å
30	R	43.4	Very low	54.2	Low	236 Å²	236	102.7 Å²	102.7	89%	0.891	53%	0.534	S	S	*	.			trans	-88.3	119.8	167.2	-170	167.4	177.6	171.7	-1.6	106.4	M32	R30-M32 PolarHBondContact O-N 2.9Å
31	W	51.4	Low	57	Low	109 Å²	109	99.1 Å²	99.1	41%	0.413	51%	0.51	S	S	.	.			trans	-52.4	132.5	-172.8	-64.4	96.8	0	0	0	112.1	R25	R25-W31 HydrophobicContact CG-CZ2 4.32Å
32	M	35	Very low	59.8	Low	170 Å²	170	93.3 Å²	93.3	84%	0.837	48%	0.475	S	S	*	.			trans	-105.4	100.5	158.3	-78.1	172.5	58.6	0	0	106.2	R30	R30-M32 PolarHBondContact O-N 2.9Å
33	F	38.3	Very low	62.1	Low	157 Å²	157	89.9 Å²	89.9	69%	0.689	46%	0.457	S	S	*	.	S	Bend	trans	67	157.3	175	-60.4	-88.3	0	0	0	118.5
34	P	50.7	Low	64.6	Low	59 Å²	59	81.9 Å²	81.9	38%	0.383	42%	0.419	S	S	.	.	S	Bend	cis	-99.9	15.7	-46.1	16.6	6.7	0	0	0	112.2	C36 D90	P34-C36 PolarHBondContact O-N 2.64Å; P34-D90 HydrophobicContact CB-CB 3.79Å; P34-D90 WeakPolarHBondContact CB-O 3.3Å
35	W	54.5	Low	67.1	Low	166 Å²	166	77.2 Å²	77.2	63%	0.629	39%	0.388	S	S	*	.			trans	-91.6	9.2	-164.9	-56.1	97.6	0	0	0	116.7	R37	W35-R37 PolarHBondContact O-N 2.96Å; W35-R37 VanDerWaalsContact O-N 3.16Å
36	C	58.9	Low	69.1	Low	53 Å²	53	75.3 Å²	75.3	36%	0.358	39%	0.388	S	S	.	.			trans	-65.5	119.7	175.6	-84.6	0	0	0	0	109.3	P34 P38 A91	P34-C36 PolarHBondContact O-N 2.64Å; C36-P38 VanDerWaalsContact O-CD 3.25Å; C36-P38 WeakPolarHBondContact O-CD 3.46Å; C36-A91 WeakPolarHBondContact O-CB 3.41Å
37	R	77.8	Confident	71.5	Confident	26 Å²	26	75.1 Å²	75.1	10%	0.098	40%	0.4	C	S	.	.			trans	-112.4	79	176.2	-63.8	-165.2	-172.6	-167	1	110.8	C20 W35 Q39 Q92 V94 L118	C20-R37 PolarHBondContact SG-NH2 2.63Å; W35-R37 PolarHBondContact O-N 2.96Å; W35-R37 VanDerWaalsContact O-N 3.16Å; R37-Q39 PolarHBondContact O-N 3.15Å; R37-Q92 WeakPolarHBondContact CA-O 3.49Å; R37-Q92 VanDerWaalsContact CB-O 3.27Å; R37-Q92 WeakPolarHBondContact CB-O 3.44Å; R37-Q92 HydrophobicContact CG-CB 4.11Å; R37-Q92 WeakPolarHBondContact CG-O 3.3Å; R37-Q92 VanDerWaalsContact NH1-OE1 3.08Å; R37-V94 HydrophobicContact CB-CG2 4.19Å; R37-L118 HydrophobicContact CB-CD2 4.13Å; R37-L118 WeakPolarHBondContact O-CD1 3.37Å; R37-L118 WeakPolarHBondContact O-CD2 3.49Å
38	P	89.3	Confident	73.8	Confident	25 Å²	25	72.9 Å²	72.9	16%	0.162	38%	0.381	C	S	.	.			trans	-56	142.3	175.8	24.7	-32.4	0	0	0	109.6	C36 L88 L93 V94 E122 Y124	C36-P38 VanDerWaalsContact O-CD 3.25Å; C36-P38 WeakPolarHBondContact O-CD 3.46Å; P38-L88 HydrophobicContact CG-CD2 4.12Å; P38-L93 HydrophobicContact CB-CD1 4.25Å; P38-L93 HydrophobicContact CG-CD1 3.91Å; P38-L93 WeakPolarHBondContact O-CD1 3.28Å; P38-V94 PolarHBondContact O-N 3.36Å; P38-E122 CarbonylContact C-O 3.53Å; P38-E122 VanDerWaalsContact CA-O 3.29Å; P38-E122 WeakPolarHBondContact CA-O 3.47Å; P38-Y124 HydrophobicContact CB-CD2 4.37Å; P38-Y124 HydrophobicContact CB-CE2 4.02Å
39	Q	93.9	Very high	75.9	Confident	0 Å²	0	74.3 Å²	74.3	0%	0	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	132	174.4	167.5	175.4	79.2	0	0	109.2	R37 V94 L96 L118 E122 V123 Y124	R37-Q39 PolarHBondContact O-N 3.15Å; Q39-V94 CarbonylContact C-O 3.59Å; Q39-V94 VanDerWaalsContact CA-O 3.32Å; Q39-V94 WeakPolarHBondContact CA-O 3.49Å; Q39-V94 HydrophobicContact CB-CB 4.32Å; Q39-L96 HydrophobicContact CG-CB 4.48Å; Q39-L96 VanDerWaalsContact NE2-CD1 3.31Å; Q39-L118 HydrophobicContact CB-CD1 3.41Å; Q39-L118 VanDerWaalsContact CB-CD1 3.41Å; Q39-E122 PolarHBondContact N-O 2.83Å; Q39-V123 HydrophobicContact CB-CG2 4.38Å; Q39-V123 HydrophobicContact CG-CG1 4.48Å; Q39-Y124 PolarHBondContact O-N 3.09Å
40	V	97.6	Very high	78.3	Confident	20 Å²	20	70.8 Å²	70.8	12%	0.121	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	114.4	169.6	-179.6	0	0	0	0	107.9	L60 L63 L93 V94 L95 L96 Y124 V126	V40-L60 HydrophobicContact CB-CD1 4.49Å; V40-L60 HydrophobicContact CG1-CD1 4.1Å; V40-L60 HydrophobicContact CG1-CD2 3.94Å; V40-L63 HydrophobicContact CG1-CD2 4.32Å; V40-L93 HydrophobicContact CB-CD1 4.48Å; V40-L93 HydrophobicContact CG2-CD1 3.66Å; V40-V94 PolarHBondContact N-O 3.04Å; V40-L95 HydrophobicContact CB-CD2 4.22Å; V40-L96 PolarHBondContact O-N 3.26Å; V40-Y124 CarbonylContact C-O 3.54Å; V40-Y124 WeakPolarHBondContact CA-O 3.45Å; V40-V126 HydrophobicContact CG1-CG2 3.89Å
41	A	97.6	Very high	80.7	Confident	0 Å²	0	62.3 Å²	62.3	0%	0	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	122.5	-179.7	0	0	0	0	0	111.1	L43 L96 V109 Y124 L125 V126	A41-L43 HydrophobicContact CB-CD2 4.49Å; A41-L96 WeakPolarHBondContact CA-O 3.35Å; A41-L96 HydrophobicContact CB-CB 4.25Å; A41-L96 HydrophobicContact CB-CD2 3.93Å; A41-V109 HydrophobicContact CB-CG2 3.79Å; A41-Y124 PolarHBondContact N-O 2.99Å; A41-L125 HydrophobicContact CB-CD2 3.85Å; A41-V126 PolarHBondContact O-N 2.81Å
42	G	97.4	Very high	82.7	Confident	0 Å²	0	66.4 Å²	66.4	0%	0	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	106.5	172.8	0	0	0	0	0	110.2	G56 M57 L96 P98	G42-G56 VanDerWaalsContact CA-C 3.47Å; G42-G56 WeakPolarHBondContact CA-O 3.36Å; G42-M57 WeakPolarHBondContact O-CG 3.15Å; G42-L96 PolarHBondContact N-O 3.32Å; G42-P98 VanDerWaalsContact O-CD 3.22Å; G42-P98 WeakPolarHBondContact O-CD 3.2Å
43	L	97.4	Very high	85.5	Confident	25 Å²	25	62.3 Å²	62.3	13%	0.131	35%	0.352	C	S	.	.			trans	-73.4	147.7	179	-53.3	-165.5	0	0	0	110.4	A41 G56 M57 M102 N105 V109 L125 V126 H127	A41-L43 HydrophobicContact CB-CD2 4.49Å; L43-G56 CarbonylContact O-C 3.58Å; L43-G56 VanDerWaalsContact O-CA 3.29Å; L43-G56 WeakPolarHBondContact O-CA 3.25Å; L43-G56 PolarHBondContact O-N 3.03Å; L43-M57 PolarHBondContact O-N 3.28Å; L43-M57 VanDerWaalsContact O-N 3.15Å; L43-M102 HydrophobicContact CB-CE 3.96Å; L43-M102 HydrophobicContact CB-SD 3.77Å; L43-N105 HydrophobicContact CD2-CB 4.06Å; L43-V109 HydrophobicContact CD2-CG2 4.24Å; L43-L125 HydrophobicContact CD2-CD2 4.43Å; L43-V126 PolarHBondContact N-O 3.43Å; L43-H127 HydrophobicContact CB-CB 4.06Å; L43-H127 HydrophobicContact CD1-CB 3.97Å; L43-H127 HydrophobicContact CG-CB 4.2Å
44	G	96.6	Very high	88.2	Confident	0 Å²	0	55 Å²	55	0%	0	32%	0.321	C	S	.	.			trans	170.1	-179.6	-177.7	0	0	0	0	0	113.8	H53 M57 N105	G44-H53 VanDerWaalsContact CA-O 3.27Å; G44-H53 WeakPolarHBondContact CA-O 3.48Å; G44-M57 VanDerWaalsContact C-CE 3.41Å; G44-M57 WeakPolarHBondContact O-CE 3.5Å; G44-N105 PolarHBondContact N-ND2 3.48Å; G44-N105 VanDerWaalsContact N-ND2 3.14Å; G44-N105 PolarHBondContact O-ND2 3.21Å
45	N	96.9	Very high	90.4	Very high	23 Å²	23	55.1 Å²	55.1	12%	0.123	32%	0.32	C	S	.	.			trans	-108.1	120.8	173.4	-76.6	-50.6	0	0	0	110.1	G47 L48 S54 L101 M102	N45-G47 PolarHBondContact O-N 2.84Å; N45-L48 HydrophobicContact CB-CB 3.92Å; N45-L48 HydrophobicContact CB-CD1 3.82Å; N45-L48 HydrophobicContact CB-CG 4.2Å; N45-L48 PolarHBondContact O-N 2.82Å; N45-L48 VanDerWaalsContact O-N 3.16Å; N45-S54 PolarHBondContact N-OG 2.95Å; N45-S54 VanDerWaalsContact N-OG 3.16Å; N45-S54 PolarHBondContact O-OG 3.18Å; N45-L101 WeakPolarHBondContact OD1-CA 3.14Å; N45-M102 WeakPolarHBondContact OD1-CB 3.38Å; N45-M102 PolarHBondContact OD1-N 2.76Å
46	P	93.1	Very high	92.4	Very high	54 Å²	54	47.2 Å²	47.2	35%	0.351	29%	0.29	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.6	135.8	169.9	-21.8	31.5	0	0	0	110.6	L48 M57 R99 R100	P46-L48 PolarHBondContact O-N 3.38Å; P46-M57 HydrophobicContact CG-CE 4.35Å; P46-R99 VanDerWaalsContact CG-C 3.47Å; P46-R100 WeakPolarHBondContact CD-O 3.22Å; P46-R100 WeakPolarHBondContact CG-O 3.44Å
47	G	93.8	Very high	94.2	Very high	75 Å²	75	46.1 Å²	46.1	77%	0.773	28%	0.28	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.7	-1.5	-179.2	0	0	0	0	0	115.1	N45 P49	N45-G47 PolarHBondContact O-N 2.84Å; G47-P49 WeakPolarHBondContact O-CD 3.46Å
48	L	95.1	Very high	95.1	Very high	87 Å²	87	47.7 Å²	47.7	46%	0.455	30%	0.299	S	S	.	.			trans	-120.2	59.5	175	-60.9	177.7	0	0	0	112	N45 P46 T51 S54	N45-L48 HydrophobicContact CB-CB 3.92Å; N45-L48 HydrophobicContact CB-CD1 3.82Å; N45-L48 HydrophobicContact CB-CG 4.2Å; N45-L48 PolarHBondContact O-N 2.82Å; N45-L48 VanDerWaalsContact O-N 3.16Å; P46-L48 PolarHBondContact O-N 3.38Å; L48-T51 HydrophobicContact CB-CG2 4.19Å; L48-T51 PolarHBondContact O-OG1 3.22Å; L48-T51 VanDerWaalsContact O-OG1 3.09Å; L48-S54 VanDerWaalsContact O-CB 3.22Å; L48-S54 WeakPolarHBondContact O-CB 3.29Å; L48-S54 PolarHBondContact O-OG 2.94Å
49	P	93.6	Very high	95.5	Very high	114 Å²	114	49.6 Å²	49.6	74%	0.74	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	152.6	175.6	31.4	-35.7	0	0	0	111.1	G47 T51	G47-P49 WeakPolarHBondContact O-CD 3.46Å; P49-T51 PolarHBondContact O-N 2.89Å
50	G	92.4	Very high	95.7	Very high	87 Å²	87	49.6 Å²	49.6	90%	0.897	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.5	-4.9	176.1	0	0	0	0	0	115.6
51	T	94.4	Very high	95.7	Very high	59 Å²	59	49.5 Å²	49.5	36%	0.362	31%	0.313	S	S	.	.	S	Bend	trans	-79.1	153.5	170.2	66.2	0	0	0	0	110.9	L48 P49 H53 S54	L48-T51 HydrophobicContact CB-CG2 4.19Å; L48-T51 PolarHBondContact O-OG1 3.22Å; L48-T51 VanDerWaalsContact O-OG1 3.09Å; P49-T51 PolarHBondContact O-N 2.89Å; T51-H53 VanDerWaalsContact C-N 3.28Å; T51-H53 PolarHBondContact O-N 2.88Å; T51-S54 PolarHBondContact O-N 3.04Å; T51-S54 PolarHBondContact OG1-N 3.06Å; T51-S54 PolarHBondContact OG1-OG 2.79Å
52	R	92.1	Very high	95.7	Very high	194 Å²	194	54 Å²	54	73%	0.732	33%	0.334	S	S	*	.	G	3₁₀ helix	trans	-53.6	-45.8	176.2	-72	-170.4	-71.8	-104.1	2.6	111.7	S54 V55 D128	R52-S54 PolarHBondContact O-N 3.33Å; R52-S54 VanDerWaalsContact O-N 3.15Å; R52-V55 VanDerWaalsContact O-CB 3.29Å; R52-V55 WeakPolarHBondContact O-CB 3.32Å; R52-V55 VanDerWaalsContact O-CG1 3.28Å; R52-V55 WeakPolarHBondContact O-CG1 3.46Å; R52-V55 PolarHBondContact O-N 2.94Å; R52-D128 WeakPolarHBondContact O-CB 2.92Å
53	H	93.4	Very high	95.7	Very high	84 Å²	84	56.5 Å²	56.5	39%	0.389	35%	0.347	S	S	.	.	G	3₁₀ helix	trans	-59.8	-27.4	177.1	-76.4	21	0	0	0	113.6	G44 T51 V55 M102 D128	G44-H53 VanDerWaalsContact CA-O 3.27Å; G44-H53 WeakPolarHBondContact CA-O 3.48Å; T51-H53 VanDerWaalsContact C-N 3.28Å; T51-H53 PolarHBondContact O-N 2.88Å; H53-V55 VanDerWaalsContact C-N 3.33Å; H53-M102 HydrophobicContact CB-CE 3.86Å; H53-M102 WeakPolarHBondContact O-CE 3.32Å; H53-D128 WeakPolarHBondContact CA-OD1 3.48Å; H53-D128 IonicContact CE1-OD2 3.86Å; H53-D128 IonicContact CG-OD2 3.8Å; H53-D128 PolarHBondContact N-OD2 2.81Å; H53-D128 IonicContact ND1-OD1 2.99Å; H53-D128 IonicContact ND1-OD2 3.94Å; H53-D128 PolarHBondContact ND1-OD2 3.49Å
54	S	96.3	Very high	95.7	Very high	5 Å²	5	55.3 Å²	55.3	4%	0.035	34%	0.341	C	S	.	.	G	3₁₀ helix	trans	-91.3	10.4	179.4	-65	0	0	0	0	113.8	N45 L48 T51 R52 G56 M57 A58	N45-S54 PolarHBondContact N-OG 2.95Å; N45-S54 VanDerWaalsContact N-OG 3.16Å; N45-S54 PolarHBondContact O-OG 3.18Å; L48-S54 VanDerWaalsContact O-CB 3.22Å; L48-S54 WeakPolarHBondContact O-CB 3.29Å; L48-S54 PolarHBondContact O-OG 2.94Å; T51-S54 PolarHBondContact O-N 3.04Å; T51-S54 PolarHBondContact OG1-N 3.06Å; T51-S54 PolarHBondContact OG1-OG 2.79Å; R52-S54 PolarHBondContact O-N 3.33Å; R52-S54 VanDerWaalsContact O-N 3.15Å; S54-G56 VanDerWaalsContact C-N 3.27Å; S54-G56 PolarHBondContact O-N 3.43Å; S54-M57 PolarHBondContact O-N 3.09Å; S54-A58 PolarHBondContact O-N 3.41Å
55	V	95.9	Very high	95.8	Very high	60 Å²	60	63 Å²	63	36%	0.364	37%	0.37	S	S	.	.	H	α-helix	trans	-60.5	-37.2	179.9	73.3	0	0	0	0	112	R52 H53 M57 A58 V59 D128	R52-V55 VanDerWaalsContact O-CB 3.29Å; R52-V55 WeakPolarHBondContact O-CB 3.32Å; R52-V55 VanDerWaalsContact O-CG1 3.28Å; R52-V55 WeakPolarHBondContact O-CG1 3.46Å; R52-V55 PolarHBondContact O-N 2.94Å; H53-V55 VanDerWaalsContact C-N 3.33Å; V55-M57 PolarHBondContact O-N 3.12Å; V55-A58 WeakPolarHBondContact O-CB 2.97Å; V55-A58 PolarHBondContact O-N 3.34Å; V55-A58 VanDerWaalsContact O-N 3.09Å; V55-V59 HydrophobicContact CG2-CG2 4.46Å; V55-V59 WeakPolarHBondContact O-CG2 3.43Å; V55-V59 PolarHBondContact O-N 3.17Å; V55-D128 HydrophobicContact CG1-CB 3.7Å
56	G	97.1	Very high	95.8	Very high	0 Å²	0	72 Å²	72	0%	0	40%	0.402	C	S	.	.	H	α-helix	trans	-58.8	-46.1	177.7	0	0	0	0	0	112	G42 L43 S54 A58 V59 L60 V126	G42-G56 VanDerWaalsContact CA-C 3.47Å; G42-G56 WeakPolarHBondContact CA-O 3.36Å; L43-G56 CarbonylContact O-C 3.58Å; L43-G56 VanDerWaalsContact O-CA 3.29Å; L43-G56 WeakPolarHBondContact O-CA 3.25Å; L43-G56 PolarHBondContact O-N 3.03Å; S54-G56 VanDerWaalsContact C-N 3.27Å; S54-G56 PolarHBondContact O-N 3.43Å; G56-A58 VanDerWaalsContact C-N 3.31Å; G56-A58 PolarHBondContact O-N 2.89Å; G56-V59 PolarHBondContact O-N 3.4Å; G56-L60 WeakPolarHBondContact O-CD2 3.27Å; G56-L60 PolarHBondContact O-N 2.83Å; G56-V126 VanDerWaalsContact CA-O 3.31Å; G56-V126 WeakPolarHBondContact CA-O 3.34Å
57	M	97.3	Very high	96	Very high	30 Å²	30	71.9 Å²	71.9	15%	0.148	40%	0.398	C	S	.	.	H	α-helix	trans	-62.2	-36.9	174.9	-69	-177.7	174.8	0	0	112.9	G42 L43 G44 P46 S54 V55 L60 G61 P98	G42-M57 WeakPolarHBondContact O-CG 3.15Å; L43-M57 PolarHBondContact O-N 3.28Å; L43-M57 VanDerWaalsContact O-N 3.15Å; G44-M57 VanDerWaalsContact C-CE 3.41Å; G44-M57 WeakPolarHBondContact O-CE 3.5Å; P46-M57 HydrophobicContact CG-CE 4.35Å; S54-M57 PolarHBondContact O-N 3.09Å; V55-M57 PolarHBondContact O-N 3.12Å; M57-L60 PolarHBondContact O-N 3.41Å; M57-G61 PolarHBondContact O-N 3.31Å; M57-P98 WeakPolarHBondContact CE-O 3.38Å
58	A	96.9	Very high	96.1	Very high	59 Å²	59	71.4 Å²	71.4	49%	0.488	39%	0.393	S	S	.	.	H	α-helix	trans	-66.5	-43.2	176.6	0	0	0	0	0	111.8	S54 V55 G56 G61 Q62	S54-A58 PolarHBondContact O-N 3.41Å; V55-A58 WeakPolarHBondContact O-CB 2.97Å; V55-A58 PolarHBondContact O-N 3.34Å; V55-A58 VanDerWaalsContact O-N 3.09Å; G56-A58 VanDerWaalsContact C-N 3.31Å; G56-A58 PolarHBondContact O-N 2.89Å; A58-G61 PolarHBondContact O-N 3.15Å; A58-Q62 PolarHBondContact O-N 2.87Å; A58-Q62 VanDerWaalsContact O-N 3.07Å
59	V	97.5	Very high	96.3	Very high	65 Å²	65	67.9 Å²	67.9	39%	0.394	38%	0.375	S	S	.	.	H	α-helix	trans	-60	-46.4	174.7	172.6	0	0	0	0	110.7	V55 G56 G61 Q62 L63 V126	V55-V59 HydrophobicContact CG2-CG2 4.46Å; V55-V59 WeakPolarHBondContact O-CG2 3.43Å; V55-V59 PolarHBondContact O-N 3.17Å; G56-V59 PolarHBondContact O-N 3.4Å; V59-G61 VanDerWaalsContact C-N 3.29Å; V59-G61 PolarHBondContact O-N 2.85Å; V59-Q62 PolarHBondContact O-N 2.95Å; V59-Q62 VanDerWaalsContact O-N 3.13Å; V59-L63 WeakPolarHBondContact O-CB 3.45Å; V59-L63 PolarHBondContact O-N 3.04Å; V59-V126 HydrophobicContact CB-CG1 3.94Å; V59-V126 HydrophobicContact CG1-CG1 3.91Å; V59-V126 HydrophobicContact CG2-CG1 4.16Å
60	L	97.5	Very high	96.4	Very high	0 Å²	0	63.8 Å²	63.8	0%	0	35%	0.351	C	S	.	.	H	α-helix	trans	-60.9	-37.4	176.5	-95.2	-69.8	0	0	0	112.6	V40 G56 M57 L63 A64 W73 L95 R97 V126	V40-L60 HydrophobicContact CB-CD1 4.49Å; V40-L60 HydrophobicContact CG1-CD1 4.1Å; V40-L60 HydrophobicContact CG1-CD2 3.94Å; G56-L60 WeakPolarHBondContact O-CD2 3.27Å; G56-L60 PolarHBondContact O-N 2.83Å; M57-L60 PolarHBondContact O-N 3.41Å; L60-L63 HydrophobicContact CD1-CD2 4.5Å; L60-L63 PolarHBondContact O-N 2.98Å; L60-A64 WeakPolarHBondContact O-CB 3.42Å; L60-A64 PolarHBondContact O-N 2.82Å; L60-W73 HydrophobicContact CB-CH2 4.48Å; L60-W73 HydrophobicContact CD1-CH2 4.42Å; L60-L95 HydrophobicContact CD1-CB 3.86Å; L60-L95 HydrophobicContact CD1-CD2 3.71Å; L60-L95 HydrophobicContact CD1-CG 4.23Å; L60-R97 HydrophobicContact CB-CG 4.24Å; L60-V126 HydrophobicContact CD2-CB 4.13Å; L60-V126 HydrophobicContact CD2-CG2 3.93Å
61	G	97.3	Very high	96.7	Very high	18 Å²	18	68.4 Å²	68.4	19%	0.186	35%	0.35	C	S	.	.	H	α-helix	trans	-61.1	-43.4	173	0	0	0	0	0	112.7	M57 A58 V59 R65	M57-G61 PolarHBondContact O-N 3.31Å; A58-G61 PolarHBondContact O-N 3.15Å; V59-G61 VanDerWaalsContact C-N 3.29Å; V59-G61 PolarHBondContact O-N 2.85Å; G61-R65 WeakPolarHBondContact O-CG 3.39Å; G61-R65 PolarHBondContact O-N 2.91Å
62	Q	98.1	Very high	96.8	Very high	96 Å²	96	68.4 Å²	68.4	45%	0.449	35%	0.352	S	S	.	.	H	α-helix	trans	-69.4	-39.9	175.7	-67.5	-62.2	-25.7	0	0	112.4	A58 V59 R65 R66	A58-Q62 PolarHBondContact O-N 2.87Å; A58-Q62 VanDerWaalsContact O-N 3.07Å; V59-Q62 PolarHBondContact O-N 2.95Å; V59-Q62 VanDerWaalsContact O-N 3.13Å; Q62-R65 PolarHBondContact O-N 3.14Å; Q62-R66 WeakPolarHBondContact O-CG 3.1Å; Q62-R66 PolarHBondContact O-N 3.31Å
63	L	97.6	Very high	97	Very high	52 Å²	52	61.4 Å²	61.4	27%	0.272	33%	0.326	S	S	.	.	H	α-helix	trans	-61.5	-46.3	176.8	-177.9	58.2	0	0	0	111.1	V40 V59 L60 R65 R66 L67 L95	V40-L63 HydrophobicContact CG1-CD2 4.32Å; V59-L63 WeakPolarHBondContact O-CB 3.45Å; V59-L63 PolarHBondContact O-N 3.04Å; L60-L63 HydrophobicContact CD1-CD2 4.5Å; L60-L63 PolarHBondContact O-N 2.98Å; L63-R65 VanDerWaalsContact C-N 3.29Å; L63-R65 PolarHBondContact O-N 3.49Å; L63-R66 PolarHBondContact O-N 2.9Å; L63-L67 HydrophobicContact CD1-CD1 3.8Å; L63-L67 HydrophobicContact CD1-CG 4.1Å; L63-L67 HydrophobicContact CG-CD1 3.79Å; L63-L67 HydrophobicContact CG-CG 4.46Å; L63-L67 WeakPolarHBondContact O-CB 3.31Å; L63-L67 VanDerWaalsContact O-CG 3.31Å; L63-L67 WeakPolarHBondContact O-CG 3.41Å; L63-L67 PolarHBondContact O-N 2.81Å; L63-L95 HydrophobicContact CD2-CD2 3.8Å; L63-L95 HydrophobicContact CG-CD2 4.32Å
64	A	97.7	Very high	97.2	Very high	0 Å²	0	61.1 Å²	61.1	0%	0	33%	0.33	C	S	.	.	H	α-helix	trans	-58.9	-38.8	176.3	0	0	0	0	0	112.6	L60 L67 G68 V69 A70 W73 L95	L60-A64 WeakPolarHBondContact O-CB 3.42Å; L60-A64 PolarHBondContact O-N 2.82Å; A64-L67 PolarHBondContact O-N 2.83Å; A64-G68 PolarHBondContact O-N 3.02Å; A64-G68 VanDerWaalsContact O-N 3.15Å; A64-V69 HydrophobicContact CB-CG2 4.12Å; A64-V69 PolarHBondContact O-N 3.13Å; A64-A70 PolarHBondContact O-N 3.27Å; A64-W73 HydrophobicContact CB-CZ2 3.82Å; A64-L95 HydrophobicContact CB-CD1 3.77Å
65	R	98	Very high	97.3	Very high	160 Å²	160	69 Å²	69	60%	0.604	36%	0.358	S	S	*	.	H	α-helix	trans	-63.8	-47	174.3	-71	173.5	-173.6	178.1	1.2	112.1	G61 Q62 L63 L67 G68 A70	G61-R65 WeakPolarHBondContact O-CG 3.39Å; G61-R65 PolarHBondContact O-N 2.91Å; Q62-R65 PolarHBondContact O-N 3.14Å; L63-R65 VanDerWaalsContact C-N 3.29Å; L63-R65 PolarHBondContact O-N 3.49Å; R65-L67 PolarHBondContact O-N 3.27Å; R65-G68 PolarHBondContact O-N 3.41Å; R65-G68 VanDerWaalsContact O-N 3.09Å; R65-A70 HydrophobicContact CB-CB 4.38Å; R65-A70 HydrophobicContact CG-CB 3.64Å
66	R	97.4	Very high	97.4	Very high	212 Å²	212	68 Å²	68	80%	0.8	35%	0.352	S	S	*	.	H	α-helix	trans	-63.1	-31.9	178.4	-70.3	-179.7	-178	-171.3	0.1	112.6	Q62 L63 G68	Q62-R66 WeakPolarHBondContact O-CG 3.1Å; Q62-R66 PolarHBondContact O-N 3.31Å; L63-R66 PolarHBondContact O-N 2.9Å; R66-G68 VanDerWaalsContact C-N 3.32Å
67	L	96.3	Very high	97.3	Very high	53 Å²	53	77.8 Å²	77.8	28%	0.277	39%	0.388	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.2	0.8	177.2	-64.9	173.1	0	0	0	113.6	L63 A64 R65 V69 A86 L93 L95	L63-L67 HydrophobicContact CD1-CD1 3.8Å; L63-L67 HydrophobicContact CD1-CG 4.1Å; L63-L67 HydrophobicContact CG-CD1 3.79Å; L63-L67 HydrophobicContact CG-CG 4.46Å; L63-L67 WeakPolarHBondContact O-CB 3.31Å; L63-L67 VanDerWaalsContact O-CG 3.31Å; L63-L67 WeakPolarHBondContact O-CG 3.41Å; L63-L67 PolarHBondContact O-N 2.81Å; A64-L67 PolarHBondContact O-N 2.83Å; R65-L67 PolarHBondContact O-N 3.27Å; L67-V69 VanDerWaalsContact C-N 3.31Å; L67-V69 HydrophobicContact CB-CG2 4.15Å; L67-V69 PolarHBondContact O-N 3.07Å; L67-A86 HydrophobicContact CB-CB 3.97Å; L67-A86 HydrophobicContact CD1-CB 3.72Å; L67-A86 HydrophobicContact CG-CB 4.36Å; L67-L93 HydrophobicContact CD1-CD2 3.66Å; L67-L95 HydrophobicContact CD1-CD1 4.35Å
68	G	97.2	Very high	97.3	Very high	65 Å²	65	81.2 Å²	81.2	67%	0.67	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.3	18.2	178.1	0	0	0	0	0	115.2	A64 R65 R66	A64-G68 PolarHBondContact O-N 3.02Å; A64-G68 VanDerWaalsContact O-N 3.15Å; R65-G68 PolarHBondContact O-N 3.41Å; R65-G68 VanDerWaalsContact O-N 3.09Å; R66-G68 VanDerWaalsContact C-N 3.32Å
69	V	97.8	Very high	97.3	Very high	12 Å²	12	78.5 Å²	78.5	7%	0.073	38%	0.381	C	S	.	.			trans	-119.2	20.4	-175.7	-59.6	0	0	0	0	113.2	A64 L67 E71 S72 A84 L85 A86 L95	A64-V69 HydrophobicContact CB-CG2 4.12Å; A64-V69 PolarHBondContact O-N 3.13Å; L67-V69 VanDerWaalsContact C-N 3.31Å; L67-V69 HydrophobicContact CB-CG2 4.15Å; L67-V69 PolarHBondContact O-N 3.07Å; V69-E71 PolarHBondContact O-N 3.37Å; V69-S72 WeakPolarHBondContact O-CB 3.37Å; V69-S72 PolarHBondContact O-N 3Å; V69-A84 HydrophobicContact CG2-CB 4.39Å; V69-L85 WeakPolarHBondContact CG1-O 3.37Å; V69-A86 HydrophobicContact CG1-CB 4.14Å; V69-A86 HydrophobicContact CG2-CB 3.96Å; V69-L95 HydrophobicContact CG2-CD1 4.06Å
70	A	97	Very high	97.3	Very high	29 Å²	29	76.5 Å²	76.5	24%	0.24	37%	0.371	C	S	.	.	T	Hydrogen-bonded Turn	trans	-60.8	-27.8	-177.7	0	0	0	0	0	114	A64 R65	A64-A70 PolarHBondContact O-N 3.27Å; R65-A70 HydrophobicContact CB-CB 4.38Å; R65-A70 HydrophobicContact CG-CB 3.64Å
71	E	97.6	Very high	97.3	Very high	184 Å²	184	76.5 Å²	76.5	86%	0.86	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.4	0.2	178.1	-56.3	-51.2	131.6	0	0	112.7	V69	V69-E71 PolarHBondContact O-N 3.37Å
72	S	96.2	Very high	97.4	Very high	59 Å²	59	77.2 Å²	77.2	41%	0.413	37%	0.371	S	S	.	.			trans	-95.5	7.9	-172.9	-49.3	0	0	0	0	113.7	V69 T74	V69-S72 WeakPolarHBondContact O-CB 3.37Å; V69-S72 PolarHBondContact O-N 3Å; S72-T74 PolarHBondContact O-N 3.3Å
73	W	97.7	Very high	97.4	Very high	47 Å²	47	73.5 Å²	73.5	18%	0.178	35%	0.354	C	S	.	.			trans	-65.7	121.7	178.5	-69	100.4	0	0	0	111.2	L60 A64 D82 L83 A84 L95 R97	L60-W73 HydrophobicContact CB-CH2 4.48Å; L60-W73 HydrophobicContact CD1-CH2 4.42Å; A64-W73 HydrophobicContact CB-CZ2 3.82Å; W73-D82 HydrophobicContact CE3-CB 3.98Å; W73-D82 VanDerWaalsContact CZ3-O 3.31Å; W73-D82 WeakPolarHBondContact CZ3-O 3.37Å; W73-L83 CarbonylContact C-O 3.58Å; W73-L83 WeakPolarHBondContact CA-O 3.46Å; W73-A84 HydrophobicContact CD2-CB 3.78Å; W73-A84 HydrophobicContact CE3-CB 3.85Å; W73-A84 HydrophobicContact CG-CB 4.26Å; W73-A84 HydrophobicContact CH2-CB 4.44Å; W73-A84 HydrophobicContact CZ2-CB 4.41Å; W73-A84 HydrophobicContact CZ3-CB 4.18Å; W73-L95 HydrophobicContact CH2-CB 3.67Å; W73-L95 HydrophobicContact CZ2-CB 4.36Å; W73-L95 HydrophobicContact CZ2-CD1 4.47Å; W73-L95 HydrophobicContact CZ3-CB 4.14Å; W73-R97 HydrophobicContact CH2-CG 3.61Å; W73-R97 HydrophobicContact CZ2-CG 4.34Å; W73-R97 HydrophobicContact CZ3-CB 4.19Å; W73-R97 HydrophobicContact CZ3-CG 3.77Å
74	T	97.7	Very high	97.4	Very high	77 Å²	77	71.1 Å²	71.1	47%	0.472	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	133.6	176.6	-58	0	0	0	0	109.7	S72 D76 D82 L83	S72-T74 PolarHBondContact O-N 3.3Å; T74-D76 PolarHBondContact O-N 3.23Å; T74-D82 WeakPolarHBondContact O-CA 2.98Å; T74-L83 PolarHBondContact N-O 2.9Å; T74-L83 PolarHBondContact O-N 3.44Å
75	R	97.8	Very high	97.2	Very high	170 Å²	170	74.5 Å²	74.5	64%	0.642	36%	0.36	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.8	123	174.4	-176.7	-174.1	-177.2	-179.5	-1.9	109.9	D82 R99	R75-D82 WeakPolarHBondContact CA-OD1 3.44Å; R75-R99 VanDerWaalsContact CD-NH1 3.32Å
76	D	97.3	Very high	97	Very high	41 Å²	41	67 Å²	67	22%	0.219	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	121.7	170.4	-174.3	-79.3	0	0	0	110.7	T74 H78 C79 A80 A81 L83	T74-D76 PolarHBondContact O-N 3.23Å; D76-H78 WeakPolarHBondContact OD1-CA 3.39Å; D76-H78 VanDerWaalsContact OD1-CB 3.32Å; D76-H78 WeakPolarHBondContact OD1-CB 3.16Å; D76-H78 PolarHBondContact OD1-N 3.04Å; D76-H78 IonicContact OD2-CD2 3.74Å; D76-C79 PolarHBondContact OD1-N 3.26Å; D76-C79 PolarHBondContact OD1-SG 2.96Å; D76-A80 VanDerWaalsContact O-CA 3.32Å; D76-A80 WeakPolarHBondContact O-CA 3.4Å; D76-A80 PolarHBondContact O-N 2.96Å; D76-A80 VanDerWaalsContact O-N 3.09Å; D76-A81 PolarHBondContact N-O 3.5Å; D76-A81 PolarHBondContact O-N 3.47Å; D76-A81 VanDerWaalsContact O-N 3.13Å; D76-L83 HydrophobicContact CB-CD1 3.68Å; D76-L83 HydrophobicContact CB-CG 4.11Å
77	R	96.7	Very high	96.7	Very high	204 Å²	204	61.3 Å²	61.3	77%	0.77	32%	0.322	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.3	-23.4	-178.8	64.9	179.9	178.2	-179.8	-1.7	113.4
78	H	95.7	Very high	96.3	Very high	103 Å²	103	62.8 Å²	62.8	48%	0.477	33%	0.33	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.4	-39.6	-175	-63.3	-77.7	0	0	0	110.8	D76 R111 L115	D76-H78 WeakPolarHBondContact OD1-CA 3.39Å; D76-H78 VanDerWaalsContact OD1-CB 3.32Å; D76-H78 WeakPolarHBondContact OD1-CB 3.16Å; D76-H78 PolarHBondContact OD1-N 3.04Å; D76-H78 IonicContact OD2-CD2 3.74Å; H78-R111 WeakPolarHBondContact O-CG 3.42Å; H78-L115 HydrophobicContact CB-CD1 3.83Å; H78-L115 HydrophobicContact CB-CD2 4.45Å
79	C	96.7	Very high	95.7	Very high	2 Å²	2	63.4 Å²	63.4	1%	0.014	34%	0.336	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99.2	-1.4	172.1	62.7	0	0	0	0	113.9	D76 A81 S108 R111 A112 L115	D76-C79 PolarHBondContact OD1-N 3.26Å; D76-C79 PolarHBondContact OD1-SG 2.96Å; C79-A81 VanDerWaalsContact C-N 3.33Å; C79-A81 PolarHBondContact O-N 2.97Å; C79-S108 WeakPolarHBondContact O-CA 3.47Å; C79-S108 WeakPolarHBondContact O-CB 3.45Å; C79-S108 PolarHBondContact O-OG 3.43Å; C79-R111 HydrophobicContact CB-CB 4.12Å; C79-R111 HydrophobicContact CB-CG 4.1Å; C79-A112 HydrophobicContact CB-CB 3.87Å; C79-L115 HydrophobicContact CB-CD1 4.01Å
80	A	98	Very high	94.9	Very high	22 Å²	22	69 Å²	69	18%	0.182	37%	0.366	C	S	.	.	T	Hydrogen-bonded Turn	trans	51.5	51.4	-177.2	0	0	0	0	0	112	D76 R99 R100 S108	D76-A80 VanDerWaalsContact O-CA 3.32Å; D76-A80 WeakPolarHBondContact O-CA 3.4Å; D76-A80 PolarHBondContact O-N 2.96Å; D76-A80 VanDerWaalsContact O-N 3.09Å; A80-R99 WeakPolarHBondContact O-CA 3.19Å; A80-R99 WeakPolarHBondContact O-CB 3.18Å; A80-R99 PolarHBondContact O-N 3.31Å; A80-R100 HydrophobicContact CB-CG 4.44Å; A80-S108 PolarHBondContact O-OG 3.13Å
81	A	98.2	Very high	94.3	Very high	0 Å²	0	68.7 Å²	68.7	0%	0	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.1	161.3	-178	0	0	0	0	0	110.6	D76 C79 L83 L96 R97	D76-A81 PolarHBondContact N-O 3.5Å; D76-A81 PolarHBondContact O-N 3.47Å; D76-A81 VanDerWaalsContact O-N 3.13Å; C79-A81 VanDerWaalsContact C-N 3.33Å; C79-A81 PolarHBondContact O-N 2.97Å; A81-L83 HydrophobicContact CB-CD2 4.29Å; A81-L96 HydrophobicContact CB-CD1 4.16Å; A81-L96 HydrophobicContact CB-CD2 4.13Å; A81-L96 HydrophobicContact CB-CG 3.86Å; A81-R97 CarbonylContact C-O 3.57Å; A81-R97 VanDerWaalsContact CA-O 3.25Å; A81-R97 WeakPolarHBondContact CA-O 3.29Å; A81-R97 VanDerWaalsContact CB-O 3.32Å; A81-R97 WeakPolarHBondContact CB-O 3.41Å
82	D	98.3	Very high	94	Very high	34 Å²	34	63.4 Å²	63.4	18%	0.182	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	133.1	160.3	-58.4	-47.2	0	0	0	108	W73 T74 R75 R97 R99	W73-D82 HydrophobicContact CE3-CB 3.98Å; W73-D82 VanDerWaalsContact CZ3-O 3.31Å; W73-D82 WeakPolarHBondContact CZ3-O 3.37Å; T74-D82 WeakPolarHBondContact O-CA 2.98Å; R75-D82 WeakPolarHBondContact CA-OD1 3.44Å; D82-R97 PolarHBondContact N-O 2.9Å; D82-R97 PolarHBondContact O-N 3.11Å; D82-R99 WeakPolarHBondContact OD1-CD 3.42Å; D82-R99 IonicContact OD1-CZ 3.92Å; D82-R99 IonicContact OD1-NH1 3.97Å; D82-R99 PolarHBondContact OD1-NH1 3.09Å; D82-R99 IonicContact OD2-NH1 2.73Å
83	L	98.1	Very high	93.9	Very high	18 Å²	18	61.2 Å²	61.2	9%	0.094	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	142.9	-176.9	-59.3	179.1	0	0	0	110.8	W73 T74 D76 A81 V94 L95 L96 F116	W73-L83 CarbonylContact C-O 3.58Å; W73-L83 WeakPolarHBondContact CA-O 3.46Å; T74-L83 PolarHBondContact N-O 2.9Å; T74-L83 PolarHBondContact O-N 3.44Å; D76-L83 HydrophobicContact CB-CD1 3.68Å; D76-L83 HydrophobicContact CB-CG 4.11Å; A81-L83 HydrophobicContact CB-CD2 4.29Å; L83-V94 HydrophobicContact CD2-CG1 4.37Å; L83-L95 VanDerWaalsContact CA-O 3.3Å; L83-L95 WeakPolarHBondContact CA-O 3.31Å; L83-L96 HydrophobicContact CD2-CB 3.88Å; L83-L96 HydrophobicContact CD2-CD1 3.71Å; L83-L96 HydrophobicContact CD2-CG 3.71Å; L83-F116 HydrophobicContact CD1-CE2 3.93Å; L83-F116 HydrophobicContact CD1-CZ 4.02Å
84	A	97.3	Very high	93.9	Very high	2 Å²	2	59 Å²	59	2%	0.017	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.5	142.4	165.9	0	0	0	0	0	109.2	V69 W73 L95	V69-A84 HydrophobicContact CG2-CB 4.39Å; W73-A84 HydrophobicContact CD2-CB 3.78Å; W73-A84 HydrophobicContact CE3-CB 3.85Å; W73-A84 HydrophobicContact CG-CB 4.26Å; W73-A84 HydrophobicContact CH2-CB 4.44Å; W73-A84 HydrophobicContact CZ2-CB 4.41Å; W73-A84 HydrophobicContact CZ3-CB 4.18Å; A84-L95 HydrophobicContact CB-CB 4.26Å; A84-L95 HydrophobicContact CB-CD1 4.46Å; A84-L95 PolarHBondContact N-O 3.06Å; A84-L95 WeakPolarHBondContact O-CB 3.29Å; A84-L95 PolarHBondContact O-N 3.09Å
85	L	95.1	Very high	93.9	Very high	71 Å²	71	55.3 Å²	55.3	37%	0.372	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	129.1	176.4	-62.2	-179.8	0	0	0	109	V69 L93 V94	V69-L85 WeakPolarHBondContact CG1-O 3.37Å; L85-L93 WeakPolarHBondContact CA-O 3.43Å; L85-V94 HydrophobicContact CD2-CB 4.32Å; L85-V94 HydrophobicContact CD2-CG1 4.4Å; L85-V94 HydrophobicContact CD2-CG2 3.77Å
86	A	94.2	Very high	94	Very high	1 Å²	1	47.2 Å²	47.2	1%	0.008	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	141.2	175.3	0	0	0	0	0	111.1	L67 V69 Q92 L93	L67-A86 HydrophobicContact CB-CB 3.97Å; L67-A86 HydrophobicContact CD1-CB 3.72Å; L67-A86 HydrophobicContact CG-CB 4.36Å; V69-A86 HydrophobicContact CG1-CB 4.14Å; V69-A86 HydrophobicContact CG2-CB 3.96Å; A86-Q92 CarbonylContact O-C 3.52Å; A86-Q92 WeakPolarHBondContact O-CA 3.29Å; A86-L93 HydrophobicContact CB-CB 4.3Å; A86-L93 PolarHBondContact N-O 3.15Å; A86-L93 PolarHBondContact O-N 2.88Å
87	P	90.5	Very high	94	Very high	93 Å²	93	48.4 Å²	48.4	60%	0.604	26%	0.262	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-66.6	139.3	170.6	28.6	-32.6	0	0	0	110.4
88	L	86.9	Confident	94.1	Very high	85 Å²	85	38.8 Å²	38.8	45%	0.445	23%	0.226	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	84.5	177.3	-175.6	65.6	0	0	0	109.5	P38 D90 A91 L93	P38-L88 HydrophobicContact CG-CD2 4.12Å; L88-D90 PolarHBondContact O-N 3.38Å; L88-A91 PolarHBondContact N-O 2.73Å; L88-A91 WeakPolarHBondContact O-CA 3.5Å; L88-A91 WeakPolarHBondContact O-CB 3.44Å; L88-A91 PolarHBondContact O-N 2.96Å; L88-L93 HydrophobicContact CB-CB 4.3Å; L88-L93 HydrophobicContact CD2-CB 4.44Å
89	G	85.7	Confident	94.1	Very high	77 Å²	77	39 Å²	39	79%	0.794	22%	0.222	S	C	*	.	T	Hydrogen-bonded Turn	trans	59.4	-126.8	-168.3	0	0	0	0	0	110.1	A91	G89-A91 VanDerWaalsContact C-N 3.26Å; G89-A91 PolarHBondContact O-N 3.21Å
90	D	80.6	Confident	94.1	Very high	130 Å²	130	44 Å²	44	70%	0.695	24%	0.241	S	C	*	.	T	Hydrogen-bonded Turn	trans	-82.2	-2.8	175.5	-57.3	-39.2	0	0	0	113.5	P34 L88	P34-D90 HydrophobicContact CB-CB 3.79Å; P34-D90 WeakPolarHBondContact CB-O 3.3Å; L88-D90 PolarHBondContact O-N 3.38Å
91	A	85.4	Confident	94	Very high	23 Å²	23	48 Å²	48	19%	0.19	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	170.7	-178.6	0	0	0	0	0	112.9	C36 L88 G89	C36-A91 WeakPolarHBondContact O-CB 3.41Å; L88-A91 PolarHBondContact N-O 2.73Å; L88-A91 WeakPolarHBondContact O-CA 3.5Å; L88-A91 WeakPolarHBondContact O-CB 3.44Å; L88-A91 PolarHBondContact O-N 2.96Å; G89-A91 VanDerWaalsContact C-N 3.26Å; G89-A91 PolarHBondContact O-N 3.21Å
92	Q	90	Very high	93.8	Very high	72 Å²	72	49.9 Å²	49.9	34%	0.336	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	121.1	169.7	-78	-162.4	-30	0	0	111.4	R37 A86	R37-Q92 WeakPolarHBondContact CA-O 3.49Å; R37-Q92 VanDerWaalsContact CB-O 3.27Å; R37-Q92 WeakPolarHBondContact CB-O 3.44Å; R37-Q92 HydrophobicContact CG-CB 4.11Å; R37-Q92 WeakPolarHBondContact CG-O 3.3Å; R37-Q92 VanDerWaalsContact NH1-OE1 3.08Å; A86-Q92 CarbonylContact O-C 3.52Å; A86-Q92 WeakPolarHBondContact O-CA 3.29Å
93	L	95.2	Very high	93.7	Very high	14 Å²	14	55.3 Å²	55.3	7%	0.073	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.5	129.1	173.3	-178.7	67.5	0	0	0	110.5	P38 V40 L67 L85 A86 L88 L95	P38-L93 HydrophobicContact CB-CD1 4.25Å; P38-L93 HydrophobicContact CG-CD1 3.91Å; P38-L93 WeakPolarHBondContact O-CD1 3.28Å; V40-L93 HydrophobicContact CB-CD1 4.48Å; V40-L93 HydrophobicContact CG2-CD1 3.66Å; L67-L93 HydrophobicContact CD1-CD2 3.66Å; L85-L93 WeakPolarHBondContact CA-O 3.43Å; A86-L93 HydrophobicContact CB-CB 4.3Å; A86-L93 PolarHBondContact N-O 3.15Å; A86-L93 PolarHBondContact O-N 2.88Å; L88-L93 HydrophobicContact CB-CB 4.3Å; L88-L93 HydrophobicContact CD2-CB 4.44Å; L93-L95 HydrophobicContact CD2-CD2 3.63Å; L93-L95 HydrophobicContact CG-CD2 3.86Å
94	V	96.9	Very high	93.6	Very high	0 Å²	0	55.6 Å²	55.6	0%	0	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	110.9	172.4	-176.6	0	0	0	0	109.1	R37 P38 Q39 V40 L83 L85 F116	R37-V94 HydrophobicContact CB-CG2 4.19Å; P38-V94 PolarHBondContact O-N 3.36Å; Q39-V94 CarbonylContact C-O 3.59Å; Q39-V94 VanDerWaalsContact CA-O 3.32Å; Q39-V94 WeakPolarHBondContact CA-O 3.49Å; Q39-V94 HydrophobicContact CB-CB 4.32Å; V40-V94 PolarHBondContact N-O 3.04Å; L83-V94 HydrophobicContact CD2-CG1 4.37Å; L85-V94 HydrophobicContact CD2-CB 4.32Å; L85-V94 HydrophobicContact CD2-CG1 4.4Å; L85-V94 HydrophobicContact CD2-CG2 3.77Å; V94-F116 HydrophobicContact CG1-CD2 3.99Å; V94-F116 HydrophobicContact CG1-CE2 3.62Å; V94-F116 HydrophobicContact CG1-CZ 4.06Å; V94-F116 HydrophobicContact CG2-CD1 4.11Å; V94-F116 HydrophobicContact CG2-CD2 4.14Å; V94-F116 HydrophobicContact CG2-CE1 4.19Å; V94-F116 HydrophobicContact CG2-CE2 4.25Å; V94-F116 HydrophobicContact CG2-CG 4.09Å; V94-F116 HydrophobicContact CG2-CZ 4.28Å
95	L	98.2	Very high	93.7	Very high	0 Å²	0	55.6 Å²	55.6	0%	0	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	130.2	169.8	-55.8	-176.3	0	0	0	109.2	V40 L60 L63 A64 L67 V69 W73 L83 A84 L93	V40-L95 HydrophobicContact CB-CD2 4.22Å; L60-L95 HydrophobicContact CD1-CB 3.86Å; L60-L95 HydrophobicContact CD1-CD2 3.71Å; L60-L95 HydrophobicContact CD1-CG 4.23Å; L63-L95 HydrophobicContact CD2-CD2 3.8Å; L63-L95 HydrophobicContact CG-CD2 4.32Å; A64-L95 HydrophobicContact CB-CD1 3.77Å; L67-L95 HydrophobicContact CD1-CD1 4.35Å; V69-L95 HydrophobicContact CG2-CD1 4.06Å; W73-L95 HydrophobicContact CH2-CB 3.67Å; W73-L95 HydrophobicContact CZ2-CB 4.36Å; W73-L95 HydrophobicContact CZ2-CD1 4.47Å; W73-L95 HydrophobicContact CZ3-CB 4.14Å; L83-L95 VanDerWaalsContact CA-O 3.3Å; L83-L95 WeakPolarHBondContact CA-O 3.31Å; A84-L95 HydrophobicContact CB-CB 4.26Å; A84-L95 HydrophobicContact CB-CD1 4.46Å; A84-L95 PolarHBondContact N-O 3.06Å; A84-L95 WeakPolarHBondContact O-CB 3.29Å; A84-L95 PolarHBondContact O-N 3.09Å; L93-L95 HydrophobicContact CD2-CD2 3.63Å; L93-L95 HydrophobicContact CG-CD2 3.86Å
96	L	98.3	Very high	93.8	Very high	0 Å²	0	54.7 Å²	54.7	0%	0	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	130.9	-177.2	-175.5	150.7	0	0	0	111.7	Q39 V40 A41 G42 A81 L83 P98 V109 A112	Q39-L96 HydrophobicContact CG-CB 4.48Å; Q39-L96 VanDerWaalsContact NE2-CD1 3.31Å; V40-L96 PolarHBondContact O-N 3.26Å; A41-L96 WeakPolarHBondContact CA-O 3.35Å; A41-L96 HydrophobicContact CB-CB 4.25Å; A41-L96 HydrophobicContact CB-CD2 3.93Å; G42-L96 PolarHBondContact N-O 3.32Å; A81-L96 HydrophobicContact CB-CD1 4.16Å; A81-L96 HydrophobicContact CB-CD2 4.13Å; A81-L96 HydrophobicContact CB-CG 3.86Å; L83-L96 HydrophobicContact CD2-CB 3.88Å; L83-L96 HydrophobicContact CD2-CD1 3.71Å; L83-L96 HydrophobicContact CD2-CG 3.71Å; L96-P98 HydrophobicContact CD2-CG 3.69Å; L96-V109 HydrophobicContact CD2-CG2 4.25Å; L96-A112 HydrophobicContact CD1-CB 3.14Å
97	R	98.3	Very high	93.9	Very high	65 Å²	65	63.6 Å²	63.6	25%	0.245	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	109.6	168.6	-70.4	-176	-63.3	166.1	4.3	109.7	L60 W73 A81 D82	L60-R97 HydrophobicContact CB-CG 4.24Å; W73-R97 HydrophobicContact CH2-CG 3.61Å; W73-R97 HydrophobicContact CZ2-CG 4.34Å; W73-R97 HydrophobicContact CZ3-CB 4.19Å; W73-R97 HydrophobicContact CZ3-CG 3.77Å; A81-R97 CarbonylContact C-O 3.57Å; A81-R97 VanDerWaalsContact CA-O 3.25Å; A81-R97 WeakPolarHBondContact CA-O 3.29Å; A81-R97 VanDerWaalsContact CB-O 3.32Å; A81-R97 WeakPolarHBondContact CB-O 3.41Å; D82-R97 PolarHBondContact N-O 2.9Å; D82-R97 PolarHBondContact O-N 3.11Å
98	P	98	Very high	94.3	Very high	2 Å²	2	59.2 Å²	59.2	1%	0.013	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.2	143.6	179.2	-23.2	35.7	0	0	0	111.6	G42 M57 L96 R100 N105	G42-P98 VanDerWaalsContact O-CD 3.22Å; G42-P98 WeakPolarHBondContact O-CD 3.2Å; M57-P98 WeakPolarHBondContact CE-O 3.38Å; L96-P98 HydrophobicContact CD2-CG 3.69Å; P98-R100 VanDerWaalsContact C-N 3.34Å; P98-N105 HydrophobicContact CB-CB 4.11Å; P98-N105 WeakPolarHBondContact CB-OD1 3.33Å; P98-N105 HydrophobicContact CG-CB 3.9Å
99	R	97.3	Very high	94.8	Very high	108 Å²	108	55.9 Å²	55.9	41%	0.408	30%	0.298	S	S	.	.	S	Bend	trans	-102.4	28.6	171.8	-64.1	-178.4	69.1	135	2	112	P46 R75 A80 D82	P46-R99 VanDerWaalsContact CG-C 3.47Å; R75-R99 VanDerWaalsContact CD-NH1 3.32Å; A80-R99 WeakPolarHBondContact O-CA 3.19Å; A80-R99 WeakPolarHBondContact O-CB 3.18Å; A80-R99 PolarHBondContact O-N 3.31Å; D82-R99 WeakPolarHBondContact OD1-CD 3.42Å; D82-R99 IonicContact OD1-CZ 3.92Å; D82-R99 IonicContact OD1-NH1 3.97Å; D82-R99 PolarHBondContact OD1-NH1 3.09Å; D82-R99 IonicContact OD2-NH1 2.73Å
100	R	95.6	Very high	95.4	Very high	108 Å²	108	54.6 Å²	54.6	41%	0.408	28%	0.28	S	S	.	.	S	Bend	trans	-118.4	162.3	177.2	-63.8	-174.4	177.5	-82.8	-1	109.5	P46 A80 P98 A104 N105	P46-R100 WeakPolarHBondContact CD-O 3.22Å; P46-R100 WeakPolarHBondContact CG-O 3.44Å; A80-R100 HydrophobicContact CB-CG 4.44Å; P98-R100 VanDerWaalsContact C-N 3.34Å; R100-A104 HydrophobicContact CB-CB 4.07Å; R100-N105 PolarHBondContact O-OD1 2.89Å
101	L	96.5	Very high	96.2	Very high	105 Å²	105	53.4 Å²	53.4	55%	0.55	27%	0.266	S	S	.	.			trans	-63.6	154.1	169.6	-63.4	178.6	0	0	0	110.1	N45 N103 A104 N105	N45-L101 WeakPolarHBondContact OD1-CA 3.14Å; L101-N103 WeakPolarHBondContact CB-OD1 3.35Å; L101-N103 PolarHBondContact O-N 3.21Å; L101-N103 VanDerWaalsContact O-N 3.13Å; L101-N103 PolarHBondContact O-OD1 3.26Å; L101-A104 WeakPolarHBondContact O-CA 3.31Å; L101-A104 PolarHBondContact O-N 3.34Å; L101-N105 PolarHBondContact O-N 2.89Å; L101-N105 PolarHBondContact O-OD1 2.8Å
102	M	93.9	Very high	96.7	Very high	40 Å²	40	52.3 Å²	52.3	20%	0.197	26%	0.257	C	S	.	.	G	3₁₀ helix	trans	-49.2	-45.1	-170.6	-179.5	61.1	93.3	0	0	112.8	L43 N45 H53 A104 N105	L43-M102 HydrophobicContact CB-CE 3.96Å; L43-M102 HydrophobicContact CB-SD 3.77Å; N45-M102 WeakPolarHBondContact OD1-CB 3.38Å; N45-M102 PolarHBondContact OD1-N 2.76Å; H53-M102 HydrophobicContact CB-CE 3.86Å; H53-M102 WeakPolarHBondContact O-CE 3.32Å; M102-A104 PolarHBondContact O-N 3.41Å; M102-N105 WeakPolarHBondContact O-CB 3.32Å; M102-N105 PolarHBondContact O-N 2.93Å; M102-N105 VanDerWaalsContact O-N 3.13Å; M102-N105 PolarHBondContact SD-ND2 3.4Å; M102-N105 VanDerWaalsContact SD-ND2 3.41Å
103	N	96.2	Very high	97	Very high	148 Å²	148	49.5 Å²	49.5	79%	0.791	25%	0.246	S	C	*	.	G	3₁₀ helix	trans	-60.5	-17.2	179	67.4	-32.5	0	0	0	114.3	L101	L101-N103 WeakPolarHBondContact CB-OD1 3.35Å; L101-N103 PolarHBondContact O-N 3.21Å; L101-N103 VanDerWaalsContact O-N 3.13Å; L101-N103 PolarHBondContact O-OD1 3.26Å
104	A	96.6	Very high	96.9	Very high	23 Å²	23	54.8 Å²	54.8	19%	0.19	27%	0.27	C	S	.	.	G	3₁₀ helix	trans	-115.2	4.5	-179.1	0	0	0	0	0	113.6	R100 L101 M102 G106 R107	R100-A104 HydrophobicContact CB-CB 4.07Å; L101-A104 WeakPolarHBondContact O-CA 3.31Å; L101-A104 PolarHBondContact O-N 3.34Å; M102-A104 PolarHBondContact O-N 3.41Å; A104-G106 PolarHBondContact O-N 3.22Å; A104-R107 PolarHBondContact O-N 3.38Å
105	N	97.8	Very high	96.7	Very high	2 Å²	2	57 Å²	57	1%	0.011	28%	0.281	C	S	.	.	H	α-helix	trans	-60.3	-33.8	-179.2	-76.8	-5.2	0	0	0	113	L43 G44 P98 R100 L101 M102 R107 S108 V109	L43-N105 HydrophobicContact CD2-CB 4.06Å; G44-N105 PolarHBondContact N-ND2 3.48Å; G44-N105 VanDerWaalsContact N-ND2 3.14Å; G44-N105 PolarHBondContact O-ND2 3.21Å; P98-N105 HydrophobicContact CB-CB 4.11Å; P98-N105 WeakPolarHBondContact CB-OD1 3.33Å; P98-N105 HydrophobicContact CG-CB 3.9Å; R100-N105 PolarHBondContact O-OD1 2.89Å; L101-N105 PolarHBondContact O-N 2.89Å; L101-N105 PolarHBondContact O-OD1 2.8Å; M102-N105 WeakPolarHBondContact O-CB 3.32Å; M102-N105 PolarHBondContact O-N 2.93Å; M102-N105 VanDerWaalsContact O-N 3.13Å; M102-N105 PolarHBondContact SD-ND2 3.4Å; M102-N105 VanDerWaalsContact SD-ND2 3.41Å; N105-R107 PolarHBondContact O-N 3.27Å; N105-R107 VanDerWaalsContact O-N 3.15Å; N105-S108 WeakPolarHBondContact O-CB 2.87Å; N105-S108 PolarHBondContact O-N 2.84Å; N105-V109 PolarHBondContact O-N 3.34Å
106	G	97.4	Very high	96.2	Very high	53 Å²	53	58.9 Å²	58.9	55%	0.546	29%	0.29	S	S	.	.	H	α-helix	trans	-55.2	-33.5	177.7	0	0	0	0	0	113.5	A104 S108 V109 A110	A104-G106 PolarHBondContact O-N 3.22Å; G106-S108 PolarHBondContact O-N 3Å; G106-V109 PolarHBondContact O-N 2.8Å; G106-A110 VanDerWaalsContact O-CB 3.29Å; G106-A110 WeakPolarHBondContact O-CB 3.46Å; G106-A110 PolarHBondContact O-N 2.83Å
107	R	97.7	Very high	95.8	Very high	188 Å²	188	61 Å²	61	71%	0.709	31%	0.312	S	S	*	.	H	α-helix	trans	-66.3	-38.6	175.9	-64.9	-177.5	179.3	-179	0.6	112.1	A104 N105 R111	A104-R107 PolarHBondContact O-N 3.38Å; N105-R107 PolarHBondContact O-N 3.27Å; N105-R107 VanDerWaalsContact O-N 3.15Å; R107-R111 WeakPolarHBondContact O-CB 3.17Å; R107-R111 PolarHBondContact O-N 3.28Å; R107-R111 VanDerWaalsContact O-N 3.11Å
108	S	98	Very high	95.4	Very high	0 Å²	0	59.1 Å²	59.1	0%	0	31%	0.306	C	S	.	.	H	α-helix	trans	-69.9	-42.1	177.4	-72.7	0	0	0	0	111.7	C79 A80 N105 G106 A112	C79-S108 WeakPolarHBondContact O-CA 3.47Å; C79-S108 WeakPolarHBondContact O-CB 3.45Å; C79-S108 PolarHBondContact O-OG 3.43Å; A80-S108 PolarHBondContact O-OG 3.13Å; N105-S108 WeakPolarHBondContact O-CB 2.87Å; N105-S108 PolarHBondContact O-N 2.84Å; G106-S108 PolarHBondContact O-N 3Å; S108-A112 WeakPolarHBondContact O-CB 3.12Å; S108-A112 PolarHBondContact O-N 3.41Å
109	V	98.2	Very high	95.1	Very high	15 Å²	15	61.3 Å²	61.3	9%	0.091	32%	0.32	C	S	.	.	H	α-helix	trans	-62.8	-55.2	176.6	176.2	0	0	0	0	110.6	A41 L43 L96 N105 G106 R111 A112 A113 V123 L125	A41-V109 HydrophobicContact CB-CG2 3.79Å; L43-V109 HydrophobicContact CD2-CG2 4.24Å; L96-V109 HydrophobicContact CD2-CG2 4.25Å; N105-V109 PolarHBondContact O-N 3.34Å; G106-V109 PolarHBondContact O-N 2.8Å; V109-R111 VanDerWaalsContact C-N 3.31Å; V109-R111 PolarHBondContact O-N 3.15Å; V109-A112 PolarHBondContact O-N 2.97Å; V109-A112 VanDerWaalsContact O-N 3.09Å; V109-A113 PolarHBondContact O-N 3.41Å; V109-V123 HydrophobicContact CG1-CG1 3.7Å; V109-L125 HydrophobicContact CG1-CD2 4Å; V109-L125 HydrophobicContact CG2-CD2 4.21Å
110	A	97.6	Very high	95	Very high	51 Å²	51	60 Å²	60	42%	0.421	33%	0.332	S	S	.	.	H	α-helix	trans	-57.6	-44.8	-178.5	0	0	0	0	0	111.6	G106 A112 A113 E114	G106-A110 VanDerWaalsContact O-CB 3.29Å; G106-A110 WeakPolarHBondContact O-CB 3.46Å; G106-A110 PolarHBondContact O-N 2.83Å; A110-A112 VanDerWaalsContact C-N 3.31Å; A110-A112 PolarHBondContact O-N 3.06Å; A110-A113 WeakPolarHBondContact O-CB 3.49Å; A110-A113 PolarHBondContact O-N 3.19Å; A110-E114 WeakPolarHBondContact O-CG 3.27Å; A110-E114 PolarHBondContact O-N 3.15Å
111	R	97.8	Very high	94.9	Very high	105 Å²	105	61.8 Å²	61.8	40%	0.396	35%	0.345	S	S	.	.	H	α-helix	trans	-65	-36	179.1	-172.9	52.2	177.7	164.3	4.4	112.6	H78 C79 R107 V109 E114 L115	H78-R111 WeakPolarHBondContact O-CG 3.42Å; C79-R111 HydrophobicContact CB-CB 4.12Å; C79-R111 HydrophobicContact CB-CG 4.1Å; R107-R111 WeakPolarHBondContact O-CB 3.17Å; R107-R111 PolarHBondContact O-N 3.28Å; R107-R111 VanDerWaalsContact O-N 3.11Å; V109-R111 VanDerWaalsContact C-N 3.31Å; V109-R111 PolarHBondContact O-N 3.15Å; R111-E114 VanDerWaalsContact CD-OE2 3.3Å; R111-E114 WeakPolarHBondContact CD-OE2 3.22Å; R111-E114 IonicContact CZ-OE2 3.57Å; R111-E114 IonicContact NE-OE2 3.82Å; R111-E114 IonicContact NH1-OE2 2.84Å; R111-E114 PolarHBondContact NH1-OE2 3.03Å; R111-L115 HydrophobicContact CG-CD1 4.49Å; R111-L115 WeakPolarHBondContact O-CG 3.34Å; R111-L115 PolarHBondContact O-N 2.9Å
112	A	95.8	Very high	94.8	Very high	0 Å²	0	58.2 Å²	58.2	0%	0	33%	0.326	C	S	.	.	H	α-helix	trans	-71	-39.3	174.4	0	0	0	0	0	112.1	C79 L96 S108 V109 A110 E114 L115 F116	C79-A112 HydrophobicContact CB-CB 3.87Å; L96-A112 HydrophobicContact CD1-CB 3.14Å; S108-A112 WeakPolarHBondContact O-CB 3.12Å; S108-A112 PolarHBondContact O-N 3.41Å; V109-A112 PolarHBondContact O-N 2.97Å; V109-A112 VanDerWaalsContact O-N 3.09Å; A110-A112 VanDerWaalsContact C-N 3.31Å; A110-A112 PolarHBondContact O-N 3.06Å; A112-E114 VanDerWaalsContact C-N 3.3Å; A112-E114 PolarHBondContact O-N 3.21Å; A112-L115 PolarHBondContact O-N 3.33Å; A112-L115 VanDerWaalsContact O-N 3.14Å; A112-F116 WeakPolarHBondContact O-CD2 3.22Å; A112-F116 PolarHBondContact O-N 3.04Å
113	A	95.5	Very high	94.9	Very high	13 Å²	13	57.8 Å²	57.8	11%	0.107	33%	0.325	C	S	.	.	H	α-helix	trans	-57.7	-43.9	173.3	0	0	0	0	0	111.4	V109 A110 F116 G117 L118 V123	V109-A113 PolarHBondContact O-N 3.41Å; A110-A113 WeakPolarHBondContact O-CB 3.49Å; A110-A113 PolarHBondContact O-N 3.19Å; A113-F116 CarbonylContact O-C 3.54Å; A113-F116 PolarHBondContact O-N 3.14Å; A113-G117 PolarHBondContact O-N 2.75Å; A113-L118 HydrophobicContact CB-CB 4.15Å; A113-L118 PolarHBondContact O-N 3.28Å; A113-V123 HydrophobicContact CB-CG2 3.99Å
114	E	94	Very high	95	Very high	124 Å²	124	57 Å²	57	58%	0.579	31%	0.312	S	S	*	.	H	α-helix	trans	-59.5	-47.1	172.2	-70.7	169.9	-170.8	0	0	112.4	A110 R111 A112 F116 G117	A110-E114 WeakPolarHBondContact O-CG 3.27Å; A110-E114 PolarHBondContact O-N 3.15Å; R111-E114 VanDerWaalsContact CD-OE2 3.3Å; R111-E114 WeakPolarHBondContact CD-OE2 3.22Å; R111-E114 IonicContact CZ-OE2 3.57Å; R111-E114 IonicContact NE-OE2 3.82Å; R111-E114 IonicContact NH1-OE2 2.84Å; R111-E114 PolarHBondContact NH1-OE2 3.03Å; A112-E114 VanDerWaalsContact C-N 3.3Å; A112-E114 PolarHBondContact O-N 3.21Å; E114-F116 PolarHBondContact O-N 3.24Å; E114-G117 PolarHBondContact O-N 2.96Å
115	L	91.1	Very high	95	Very high	47 Å²	47	60.4 Å²	60.4	25%	0.246	33%	0.326	C	S	.	.	H	α-helix	trans	-60.9	-32.7	179.5	-73.9	169.4	0	0	0	112.4	L22 H78 C79 R111 A112	L22-L115 WeakPolarHBondContact CD1-O 3.07Å; H78-L115 HydrophobicContact CB-CD1 3.83Å; H78-L115 HydrophobicContact CB-CD2 4.45Å; C79-L115 HydrophobicContact CB-CD1 4.01Å; R111-L115 HydrophobicContact CG-CD1 4.49Å; R111-L115 WeakPolarHBondContact O-CG 3.34Å; R111-L115 PolarHBondContact O-N 2.9Å; A112-L115 PolarHBondContact O-N 3.33Å; A112-L115 VanDerWaalsContact O-N 3.14Å
116	F	89.6	Confident	95	Very high	39 Å²	39	62.1 Å²	62.1	17%	0.171	34%	0.337	C	S	.	.	H	α-helix	trans	-99.3	2.3	179.9	-68.3	-70.6	0	0	0	113.7	L83 V94 A112 A113 E114 L118	L83-F116 HydrophobicContact CD1-CE2 3.93Å; L83-F116 HydrophobicContact CD1-CZ 4.02Å; V94-F116 HydrophobicContact CG1-CD2 3.99Å; V94-F116 HydrophobicContact CG1-CE2 3.62Å; V94-F116 HydrophobicContact CG1-CZ 4.06Å; V94-F116 HydrophobicContact CG2-CD1 4.11Å; V94-F116 HydrophobicContact CG2-CD2 4.14Å; V94-F116 HydrophobicContact CG2-CE1 4.19Å; V94-F116 HydrophobicContact CG2-CE2 4.25Å; V94-F116 HydrophobicContact CG2-CG 4.09Å; V94-F116 HydrophobicContact CG2-CZ 4.28Å; A112-F116 WeakPolarHBondContact O-CD2 3.22Å; A112-F116 PolarHBondContact O-N 3.04Å; A113-F116 CarbonylContact O-C 3.54Å; A113-F116 PolarHBondContact O-N 3.14Å; E114-F116 PolarHBondContact O-N 3.24Å; F116-L118 HydrophobicContact CB-CD1 3.93Å; F116-L118 HydrophobicContact CB-CD2 3.96Å; F116-L118 HydrophobicContact CB-CG 3.67Å; F116-L118 WeakPolarHBondContact O-CD2 3.25Å
117	G	89.3	Confident	94.9	Very high	46 Å²	46	64.1 Å²	64.1	47%	0.474	33%	0.332	S	S	.	.	T	Hydrogen-bonded Turn	trans	66.7	32.4	179.6	0	0	0	0	0	114.3	A113 E114	A113-G117 PolarHBondContact O-N 2.75Å; E114-G117 PolarHBondContact O-N 2.96Å
118	L	90.3	Very high	94.7	Very high	24 Å²	24	56.6 Å²	56.6	13%	0.126	31%	0.306	C	S	.	.			trans	-89.7	144	-173	-50.2	-176.9	0	0	0	112.1	R37 Q39 A113 F116 E122 V123	R37-L118 HydrophobicContact CB-CD2 4.13Å; R37-L118 WeakPolarHBondContact O-CD1 3.37Å; R37-L118 WeakPolarHBondContact O-CD2 3.49Å; Q39-L118 HydrophobicContact CB-CD1 3.41Å; Q39-L118 VanDerWaalsContact CB-CD1 3.41Å; A113-L118 HydrophobicContact CB-CB 4.15Å; A113-L118 PolarHBondContact O-N 3.28Å; F116-L118 HydrophobicContact CB-CD1 3.93Å; F116-L118 HydrophobicContact CB-CD2 3.96Å; F116-L118 HydrophobicContact CB-CG 3.67Å; F116-L118 WeakPolarHBondContact O-CD2 3.25Å; L118-E122 WeakPolarHBondContact CA-OE2 3.36Å; L118-E122 HydrophobicContact CB-CB 4.23Å; L118-V123 HydrophobicContact CB-CG2 4.35Å; L118-V123 HydrophobicContact CD1-CG2 4.49Å
119	T	92.1	Very high	94.5	Very high	48 Å²	48	60.9 Å²	60.9	29%	0.294	33%	0.326	S	S	.	.			trans	-86.2	167.6	166.1	76.2	0	0	0	0	111	E121 E122	T119-E121 WeakPolarHBondContact CB-OE2 3.38Å; T119-E121 PolarHBondContact O-N 3.16Å; T119-E121 PolarHBondContact OG1-OE2 3.4Å; T119-E122 PolarHBondContact N-OE2 2.85Å; T119-E122 WeakPolarHBondContact O-CB 3.32Å; T119-E122 PolarHBondContact O-N 3.23Å; T119-E122 PolarHBondContact OG1-OE2 3.42Å
120	A	93.3	Very high	94.1	Very high	80 Å²	80	66.1 Å²	66.1	66%	0.661	35%	0.353	S	S	*	.	G	3₁₀ helix	trans	-60.9	-33.2	-179.9	0	0	0	0	0	112.3	E122 V123	A120-E122 PolarHBondContact O-N 2.76Å; A120-V123 PolarHBondContact O-N 3.13Å; A120-V123 VanDerWaalsContact O-N 3.15Å
121	E	94.1	Very high	93.8	Very high	147 Å²	147	71 Å²	71	69%	0.687	37%	0.371	S	S	*	.	G	3₁₀ helix	trans	-69.2	-14.8	177.5	-55.6	77	-168.7	0	0	113	T119	T119-E121 WeakPolarHBondContact CB-OE2 3.38Å; T119-E121 PolarHBondContact O-N 3.16Å; T119-E121 PolarHBondContact OG1-OE2 3.4Å
122	E	94	Very high	93.4	Very high	29 Å²	29	70.3 Å²	70.3	14%	0.136	37%	0.371	C	S	.	.	G	3₁₀ helix	trans	-96.7	-0.1	177.5	-62.1	174.4	128.9	0	0	111.7	R25 P38 Q39 L118 T119 A120	R25-E122 IonicContact NH1-OE2 3.78Å; P38-E122 CarbonylContact C-O 3.53Å; P38-E122 VanDerWaalsContact CA-O 3.29Å; P38-E122 WeakPolarHBondContact CA-O 3.47Å; Q39-E122 PolarHBondContact N-O 2.83Å; L118-E122 WeakPolarHBondContact CA-OE2 3.36Å; L118-E122 HydrophobicContact CB-CB 4.23Å; T119-E122 PolarHBondContact N-OE2 2.85Å; T119-E122 WeakPolarHBondContact O-CB 3.32Å; T119-E122 PolarHBondContact O-N 3.23Å; T119-E122 PolarHBondContact OG1-OE2 3.42Å; A120-E122 PolarHBondContact O-N 2.76Å
123	V	96.5	Very high	93.2	Very high	31 Å²	31	74.7 Å²	74.7	19%	0.188	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	122.2	-178.9	-179.4	0	0	0	0	110.8	Q39 V109 A113 L118 A120 L125	Q39-V123 HydrophobicContact CB-CG2 4.38Å; Q39-V123 HydrophobicContact CG-CG1 4.48Å; V109-V123 HydrophobicContact CG1-CG1 3.7Å; A113-V123 HydrophobicContact CB-CG2 3.99Å; L118-V123 HydrophobicContact CB-CG2 4.35Å; L118-V123 HydrophobicContact CD1-CG2 4.49Å; A120-V123 PolarHBondContact O-N 3.13Å; A120-V123 VanDerWaalsContact O-N 3.15Å; V123-L125 HydrophobicContact CG1-CD2 4.07Å
124	Y	97.6	Very high	92.9	Very high	133 Å²	133	82.6 Å²	82.6	52%	0.522	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	129.3	178.6	-61	-94.8	0	0	0	109.6	P38 Q39 V40 A41	P38-Y124 HydrophobicContact CB-CD2 4.37Å; P38-Y124 HydrophobicContact CB-CE2 4.02Å; Q39-Y124 PolarHBondContact O-N 3.09Å; V40-Y124 CarbonylContact C-O 3.54Å; V40-Y124 WeakPolarHBondContact CA-O 3.45Å; A41-Y124 PolarHBondContact N-O 2.99Å
125	L	97.7	Very high	92.6	Very high	93 Å²	93	80 Å²	80	49%	0.487	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	135.4	178.7	-56.1	-176.8	0	0	0	110.1	A41 L43 V109 V123	A41-L125 HydrophobicContact CB-CD2 3.85Å; L43-L125 HydrophobicContact CD2-CD2 4.43Å; V109-L125 HydrophobicContact CG1-CD2 4Å; V109-L125 HydrophobicContact CG2-CD2 4.21Å; V123-L125 HydrophobicContact CG1-CD2 4.07Å
126	V	97.6	Very high	92.6	Very high	38 Å²	38	86.1 Å²	86.1	23%	0.23	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	119	171.4	-170.6	0	0	0	0	108.1	V40 A41 L43 G56 V59 L60	V40-V126 HydrophobicContact CG1-CG2 3.89Å; A41-V126 PolarHBondContact O-N 2.81Å; L43-V126 PolarHBondContact N-O 3.43Å; G56-V126 VanDerWaalsContact CA-O 3.31Å; G56-V126 WeakPolarHBondContact CA-O 3.34Å; V59-V126 HydrophobicContact CB-CG1 3.94Å; V59-V126 HydrophobicContact CG1-CG1 3.91Å; V59-V126 HydrophobicContact CG2-CG1 4.16Å; L60-V126 HydrophobicContact CD2-CB 4.13Å; L60-V126 HydrophobicContact CD2-CG2 3.93Å
127	H	95.8	Very high	92.3	Very high	95 Å²	95	94.3 Å²	94.3	44%	0.44	51%	0.511	S	S	.	.			trans	-147.9	172.3	-178.5	67.3	87.4	0	0	0	111.3	L43	L43-H127 HydrophobicContact CB-CB 4.06Å; L43-H127 HydrophobicContact CD1-CB 3.97Å; L43-H127 HydrophobicContact CG-CB 4.2Å
128	D	94	Very high	92.5	Very high	31 Å²	31	96.8 Å²	96.8	17%	0.166	51%	0.512	C	S	.	.			trans	-77	145.7	171.1	53.9	-39.4	0	0	0	111.9	R52 H53 V55	R52-D128 WeakPolarHBondContact O-CB 2.92Å; H53-D128 WeakPolarHBondContact CA-OD1 3.48Å; H53-D128 IonicContact CE1-OD2 3.86Å; H53-D128 IonicContact CG-OD2 3.8Å; H53-D128 PolarHBondContact N-OD2 2.81Å; H53-D128 IonicContact ND1-OD1 2.99Å; H53-D128 IonicContact ND1-OD2 3.94Å; H53-D128 PolarHBondContact ND1-OD2 3.49Å; V55-D128 HydrophobicContact CG1-CB 3.7Å
129	E	92.6	Very high	92.6	Very high	90 Å²	90	100.6 Å²	100.6	42%	0.421	53%	0.533	S	S	.	.			trans	-117.5	128	174.2	179.8	53.8	-91	0	0	108.7	D131 K132	E129-D131 PolarHBondContact OE1-N 3.13Å; E129-K132 HydrophobicContact CB-CD 4.42Å; E129-K132 HydrophobicContact CG-CB 3.86Å; E129-K132 HydrophobicContact CG-CD 3.78Å; E129-K132 HydrophobicContact CG-CG 3.56Å
130	L	90	Very high	92.6	Very high	125 Å²	125	103.5 Å²	103.5	65%	0.654	55%	0.546	S	S	*	.	S	Bend	trans	-91.7	-25.4	-179.6	-67.1	176.9	0	0	0	111.8	K132	L130-K132 VanDerWaalsContact C-N 3.31Å; L130-K132 PolarHBondContact O-N 2.76Å
131	D	91.6	Very high	92.6	Very high	152 Å²	152	104.9 Å²	104.9	81%	0.813	54%	0.539	S	S	*	.	S	Bend	trans	-84.9	-6.8	-173.4	-64.8	-26.5	0	0	0	113	E129	E129-D131 PolarHBondContact OE1-N 3.13Å
132	K	89.3	Confident	92.5	Very high	91 Å²	91	102.3 Å²	102.3	40%	0.396	53%	0.53	S	S	.	.	S	Bend	trans	-101.2	141.7	179.9	-71.4	-176.8	-172.8	-166.3	0	111.9	E129 L130 R136 L137	E129-K132 HydrophobicContact CB-CD 4.42Å; E129-K132 HydrophobicContact CG-CB 3.86Å; E129-K132 HydrophobicContact CG-CD 3.78Å; E129-K132 HydrophobicContact CG-CG 3.56Å; L130-K132 VanDerWaalsContact C-N 3.31Å; L130-K132 PolarHBondContact O-N 2.76Å; K132-R136 HydrophobicContact CB-CB 4.32Å; K132-L137 PolarHBondContact NZ-O 3.16Å; K132-L137 PolarHBondContact NZ-OXT 3.44Å
133	P	91.8	Very high	92.4	Very high	93 Å²	93	107.1 Å²	107.1	60%	0.604	56%	0.556	S	S	*	*	P	Polyproline II helix	trans	-58.6	151.4	168.6	-22.9	33.2	0	0	0	112.3	G135 R136	P133-G135 PolarHBondContact O-N 3.09Å; P133-R136 HydrophobicContact CB-CG 4.25Å; P133-R136 WeakPolarHBondContact O-CB 3.34Å; P133-R136 PolarHBondContact O-N 3.37Å
134	L	88.7	Confident	92.1	Very high	178 Å²	178	112.6 Å²	112.6	93%	0.932	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	135.4	177.5	-176.1	66.5	0	0	0	111.4	R136	L134-R136 VanDerWaalsContact C-N 3.34Å
135	G	88.5	Confident	91.7	Very high	70 Å²	70	111 Å²	111	72%	0.722	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	79.9	13.8	180	0	0	0	0	0	114.3	P133	P133-G135 PolarHBondContact O-N 3.09Å
136	R	89.8	Confident	91.2	Very high	175 Å²	175	112.5 Å²	112.5	66%	0.66	60%	0.596	S	S	*	*			trans	-104.9	144.5	168	-61.7	-61.8	-166.4	-98.4	1.6	110.2	K132 P133 L134	K132-R136 HydrophobicContact CB-CB 4.32Å; P133-R136 HydrophobicContact CB-CG 4.25Å; P133-R136 WeakPolarHBondContact O-CB 3.34Å; P133-R136 PolarHBondContact O-N 3.37Å; L134-R136 VanDerWaalsContact C-N 3.34Å
137	L	84.4	Confident	90.6	Very high	212 Å²	212	119.3 Å²	119.3	100%	1.11	63%	0.629	S	S	*	*			trans	-114.9	0	176.4	-70.3	175.1	0	0	0	111.1	K132	K132-L137 PolarHBondContact NZ-O 3.16Å; K132-L137 PolarHBondContact NZ-OXT 3.44Å

Retrieved 137 of 137 residues in 689 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).