QCR6L_HUMAN Loading...

Cytochrome b-c1 complex subunit 6-like, mitochondrial

May be a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.

AlphaFold DB , UniProt , Accession A0A096LP55, Species HUMAN (Homo sapiens, Human), Gene UQCRHL, Length 91 aa.

						>QCR6L_HUMAN|A0A096LP55|UQCRHL
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.4	Very low	60	Low	241 Å²	241	136.1 Å²	136.1	100%	1.187	69%	0.693	S	S	*	*				0	75.1	0	-68.3	-172.6	-71.7	0	0	106
2	G	51.9	Low	59.9	Low	32 Å²	32	137.5 Å²	137.5	33%	0.33	70%	0.695	S	S	.	*			trans	-95.5	137.4	-177.3	0	0	0	0	0	108.5	E4 D5	G2-E4 PolarHBondContact O-N 2.94Å; G2-D5 PolarHBondContact O-N 3.11Å
3	L	67.1	Low	59.7	Low	142 Å²	142	132.7 Å²	132.7	74%	0.743	68%	0.682	S	S	*	*	H	α-helix	trans	-50.2	-21.2	171	-74.7	154.5	0	0	0	112.8	Q7	L3-Q7 WeakPolarHBondContact O-CB 3.44Å; L3-Q7 PolarHBondContact O-N 2.96Å; L3-Q7 VanDerWaalsContact O-N 3.11Å
4	E	67.9	Low	59.6	Low	163 Å²	163	125.8 Å²	125.8	76%	0.762	66%	0.659	S	S	*	*	H	α-helix	trans	-65.4	-33.1	175.9	-58.2	173.7	173.3	0	0	112.8	G2 K8	G2-E4 PolarHBondContact O-N 2.94Å; E4-K8 WeakPolarHBondContact O-CB 3.42Å; E4-K8 PolarHBondContact O-N 3.25Å; E4-K8 VanDerWaalsContact O-N 3.15Å
5	D	65.9	Low	59.5	Low	114 Å²	114	123.1 Å²	123.1	61%	0.61	65%	0.646	S	S	*	*	H	α-helix	trans	-75.8	-36.8	179.2	-65.3	-40.8	0	0	0	111.7	G2 M9	G2-D5 PolarHBondContact O-N 3.11Å; D5-M9 WeakPolarHBondContact O-CG 3.39Å; D5-M9 PolarHBondContact O-N 3.32Å
6	E	62	Low	60.1	Low	137 Å²	137	120.5 Å²	120.5	64%	0.64	64%	0.639	S	S	*	*	H	α-helix	trans	-68.2	-39.4	172.9	-84.2	-173.4	100.6	0	0	111.6	K8 M9 L10	E6-K8 VanDerWaalsContact C-N 3.29Å; E6-K8 PolarHBondContact O-N 3.35Å; E6-M9 PolarHBondContact O-N 3.43Å; E6-L10 PolarHBondContact O-N 3.15Å
7	Q	61.1	Low	60.6	Low	137 Å²	137	121.3 Å²	121.3	64%	0.64	64%	0.638	S	S	*	*	H	α-helix	trans	-68.4	-30.6	179.6	-164.6	149	32.8	0	0	112.3	L3 T11	L3-Q7 WeakPolarHBondContact O-CB 3.44Å; L3-Q7 PolarHBondContact O-N 2.96Å; L3-Q7 VanDerWaalsContact O-N 3.11Å; Q7-T11 WeakPolarHBondContact O-CG2 3.48Å; Q7-T11 PolarHBondContact O-N 3.19Å; Q7-T11 PolarHBondContact O-OG1 3.38Å
8	K	61.1	Low	61	Low	139 Å²	139	121.3 Å²	121.3	60%	0.604	63%	0.634	S	S	*	*	H	α-helix	trans	-71.8	-36	175.6	-152.9	-177.8	-176.3	-152	0	112.9	E4 E6 T11 E12	E4-K8 WeakPolarHBondContact O-CB 3.42Å; E4-K8 PolarHBondContact O-N 3.25Å; E4-K8 VanDerWaalsContact O-N 3.15Å; E6-K8 VanDerWaalsContact C-N 3.29Å; E6-K8 PolarHBondContact O-N 3.35Å; K8-T11 PolarHBondContact O-N 3.07Å; K8-T11 PolarHBondContact O-OG1 3.38Å; K8-E12 PolarHBondContact O-N 3.49Å
9	M	58.2	Low	61.1	Low	150 Å²	150	121.3 Å²	121.3	74%	0.739	63%	0.631	S	S	*	*	H	α-helix	trans	-68.7	-35	175.7	-70.4	-101.5	-69.1	0	0	112.4	D5 E6 T11 E12 S13	D5-M9 WeakPolarHBondContact O-CG 3.39Å; D5-M9 PolarHBondContact O-N 3.32Å; E6-M9 PolarHBondContact O-N 3.43Å; M9-T11 VanDerWaalsContact C-N 3.31Å; M9-E12 PolarHBondContact O-N 2.94Å; M9-S13 PolarHBondContact O-N 3.45Å
10	L	58.9	Low	61.4	Low	133 Å²	133	121.7 Å²	121.7	70%	0.696	63%	0.629	S	S	*	*	H	α-helix	trans	-75.3	-17.7	177.9	-76	165.3	0	0	0	113.9	E6 S13	E6-L10 PolarHBondContact O-N 3.15Å; L10-S13 PolarHBondContact O-OG 3.45Å; L10-S13 VanDerWaalsContact O-OG 3.07Å
11	T	58.3	Low	61.6	Low	109 Å²	109	122.3 Å²	122.3	67%	0.669	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.8	-9.2	175.6	53.8	0	0	0	0	113.5	Q7 K8 M9	Q7-T11 WeakPolarHBondContact O-CG2 3.48Å; Q7-T11 PolarHBondContact O-N 3.19Å; Q7-T11 PolarHBondContact O-OG1 3.38Å; K8-T11 PolarHBondContact O-N 3.07Å; K8-T11 PolarHBondContact O-OG1 3.38Å; M9-T11 VanDerWaalsContact C-N 3.31Å
12	E	58.6	Low	62.6	Low	153 Å²	153	117.8 Å²	117.8	72%	0.715	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.6	-7.9	-179.2	-163.7	170.6	177.3	0	0	112.4	K8 M9 G14	K8-E12 PolarHBondContact O-N 3.49Å; M9-E12 PolarHBondContact O-N 2.94Å; E12-G14 PolarHBondContact O-N 3.46Å; E12-G14 VanDerWaalsContact O-N 3.14Å
13	S	57.3	Low	63.3	Low	75 Å²	75	123.6 Å²	123.6	52%	0.524	62%	0.624	S	S	.	*	S	Bend	trans	-66.8	105.2	156.1	41.2	0	0	0	0	107.4	M9 L10	M9-S13 PolarHBondContact O-N 3.45Å; L10-S13 PolarHBondContact O-OG 3.45Å; L10-S13 VanDerWaalsContact O-OG 3.07Å
14	G	58.2	Low	63.3	Low	36 Å²	36	124.9 Å²	124.9	37%	0.371	63%	0.626	S	S	.	*			trans	-44.8	144.3	176.7	0	0	0	0	0	111.1	E12 P16	E12-G14 PolarHBondContact O-N 3.46Å; E12-G14 VanDerWaalsContact O-N 3.14Å; G14-P16 WeakPolarHBondContact O-CD 3.31Å
15	D	59	Low	63.6	Low	85 Å²	85	125.1 Å²	125.1	46%	0.455	63%	0.627	S	S	.	*			trans	-58.4	123.2	175.8	-156	-30	0	0	0	107	E17 E18 E19	D15-E17 PolarHBondContact O-N 3.14Å; D15-E17 PolarHBondContact OD1-N 2.93Å; D15-E18 HydrophobicContact CB-CB 4.3Å; D15-E18 HydrophobicContact CB-CG 4.15Å; D15-E18 WeakPolarHBondContact O-CA 3.41Å; D15-E18 WeakPolarHBondContact O-CB 3.49Å; D15-E18 PolarHBondContact O-N 3.03Å; D15-E19 PolarHBondContact O-N 3.15Å; D15-E19 VanDerWaalsContact O-N 3.15Å
16	P	68.2	Low	64.3	Low	82 Å²	82	126.5 Å²	126.5	53%	0.532	63%	0.634	S	S	.	*	H	α-helix	trans	-53.6	-26	176.7	19	-32.1	0	0	0	112.1	G14 E20	G14-P16 WeakPolarHBondContact O-CD 3.31Å; P16-E20 WeakPolarHBondContact O-CB 3.47Å; P16-E20 WeakPolarHBondContact O-CG 3.44Å; P16-E20 PolarHBondContact O-N 2.81Å
17	E	69.2	Low	65.4	Low	134 Å²	134	124.6 Å²	124.6	63%	0.626	63%	0.631	S	S	*	*	H	α-helix	trans	-65.6	-39.3	171.1	-66.2	-171.7	162	0	0	112.7	D15 E21	D15-E17 PolarHBondContact O-N 3.14Å; D15-E17 PolarHBondContact OD1-N 2.93Å; E17-E21 WeakPolarHBondContact O-CB 3.41Å; E17-E21 VanDerWaalsContact O-CG 3.31Å; E17-E21 WeakPolarHBondContact O-CG 3.41Å; E17-E21 PolarHBondContact O-N 3.41Å
18	E	67.4	Low	66.8	Low	122 Å²	122	121.7 Å²	121.7	57%	0.57	62%	0.62	S	S	*	*	H	α-helix	trans	-69	-38.9	175.5	-75	-173.9	168.2	0	0	111.7	D15 E21 E22	D15-E18 HydrophobicContact CB-CB 4.3Å; D15-E18 HydrophobicContact CB-CG 4.15Å; D15-E18 WeakPolarHBondContact O-CA 3.41Å; D15-E18 WeakPolarHBondContact O-CB 3.49Å; D15-E18 PolarHBondContact O-N 3.03Å; E18-E21 PolarHBondContact O-N 2.93Å; E18-E22 WeakPolarHBondContact O-CG 3.33Å; E18-E22 PolarHBondContact O-N 2.97Å
19	E	63.9	Low	68.3	Low	121 Å²	121	117 Å²	117	57%	0.565	60%	0.604	S	S	*	*	H	α-helix	trans	-66.1	-41.6	175	-70.5	-171.7	171.2	0	0	111.8	D15 E22 E23	D15-E19 PolarHBondContact O-N 3.15Å; D15-E19 VanDerWaalsContact O-N 3.15Å; E19-E22 PolarHBondContact O-N 3.37Å; E19-E23 PolarHBondContact O-N 3.2Å
20	E	66.9	Low	70.1	Confident	129 Å²	129	111.7 Å²	111.7	60%	0.603	58%	0.578	S	S	*	*	H	α-helix	trans	-63.4	-41.5	173.8	-75.9	-178.1	-176.2	0	0	111.5	P16 E23 E24	P16-E20 WeakPolarHBondContact O-CB 3.47Å; P16-E20 WeakPolarHBondContact O-CG 3.44Å; P16-E20 PolarHBondContact O-N 2.81Å; E20-E23 PolarHBondContact O-N 3.43Å; E20-E24 WeakPolarHBondContact O-CG 3.44Å; E20-E24 PolarHBondContact O-N 3.48Å
21	E	65.6	Low	71.7	Confident	135 Å²	135	108.2 Å²	108.2	63%	0.631	56%	0.563	S	S	*	*	H	α-helix	trans	-62.9	-41	174.7	-78.1	-175.6	-177.6	0	0	112.5	E17 E18 E24 E25	E17-E21 WeakPolarHBondContact O-CB 3.41Å; E17-E21 VanDerWaalsContact O-CG 3.31Å; E17-E21 WeakPolarHBondContact O-CG 3.41Å; E17-E21 PolarHBondContact O-N 3.41Å; E18-E21 PolarHBondContact O-N 2.93Å; E21-E24 PolarHBondContact O-N 3.01Å; E21-E25 PolarHBondContact O-N 3.39Å
22	E	68.3	Low	73.4	Confident	146 Å²	146	105.6 Å²	105.6	68%	0.682	55%	0.546	S	S	*	.	H	α-helix	trans	-65.8	-37	175.1	-76.1	-170.5	177.6	0	0	112.3	E18 E19 E25 L26	E18-E22 WeakPolarHBondContact O-CG 3.33Å; E18-E22 PolarHBondContact O-N 2.97Å; E19-E22 PolarHBondContact O-N 3.37Å; E22-E25 PolarHBondContact O-N 2.94Å; E22-L26 PolarHBondContact O-N 3.22Å
23	E	65.9	Low	75.2	Confident	153 Å²	153	98.5 Å²	98.5	72%	0.715	51%	0.513	S	S	*	.	H	α-helix	trans	-68.9	-36.8	174.1	-74.5	-167	174.5	0	0	112.4	E19 E20 E25 L26	E19-E23 PolarHBondContact O-N 3.2Å; E20-E23 PolarHBondContact O-N 3.43Å; E23-E25 VanDerWaalsContact C-N 3.3Å; E23-E25 PolarHBondContact O-N 3.32Å; E23-L26 PolarHBondContact O-N 3.29Å
24	E	67.7	Low	77.1	Confident	170 Å²	170	99.3 Å²	99.3	79%	0.794	51%	0.505	S	S	*	.	H	α-helix	trans	-64.5	-31.8	175.3	-76.7	-168.6	175.4	0	0	112.7	E20 E21	E20-E24 WeakPolarHBondContact O-CG 3.44Å; E20-E24 PolarHBondContact O-N 3.48Å; E21-E24 PolarHBondContact O-N 3.01Å
25	E	73.4	Confident	78.9	Confident	168 Å²	168	103.6 Å²	103.6	79%	0.785	52%	0.515	S	S	*	.	H	α-helix	trans	-79.1	-21.2	176	-158.8	175.2	-168.1	0	0	112.8	E21 E22 E23 V27	E21-E25 PolarHBondContact O-N 3.39Å; E22-E25 PolarHBondContact O-N 2.94Å; E23-E25 VanDerWaalsContact C-N 3.3Å; E23-E25 PolarHBondContact O-N 3.32Å; E25-V27 PolarHBondContact O-N 3.26Å
26	L	81.2	Confident	80.6	Confident	143 Å²	143	104 Å²	104	75%	0.749	51%	0.514	S	S	*	.			trans	-74.6	87.8	-179.4	-171.4	70.9	0	0	0	112	E22 E23 D28	E22-L26 PolarHBondContact O-N 3.22Å; E23-L26 PolarHBondContact O-N 3.29Å; L26-D28 PolarHBondContact O-N 2.93Å
27	V	85.1	Confident	81.9	Confident	97 Å²	97	100.1 Å²	100.1	59%	0.588	49%	0.489	S	S	*	.			trans	-68.8	118.3	173.9	-176.8	0	0	0	0	111	E25 P29 T32	E25-V27 PolarHBondContact O-N 3.26Å; V27-P29 VanDerWaalsContact O-CD 3.31Å; V27-P29 WeakPolarHBondContact O-CD 3.31Å; V27-T32 WeakPolarHBondContact CG1-OG1 3.45Å
28	D	90.5	Very high	83.2	Confident	76 Å²	76	96.4 Å²	96.4	41%	0.406	47%	0.472	S	S	.	.			trans	-57.6	118.7	173.6	179.6	3	0	0	0	110.9	L26 L30 T31 T32	L26-D28 PolarHBondContact O-N 2.93Å; D28-L30 PolarHBondContact O-N 3.42Å; D28-L30 VanDerWaalsContact O-N 3.07Å; D28-L30 WeakPolarHBondContact OD1-CB 3.31Å; D28-L30 PolarHBondContact OD1-N 2.97Å; D28-L30 WeakPolarHBondContact OD2-CB 3.22Å; D28-T31 HydrophobicContact CB-CG2 4.15Å; D28-T31 PolarHBondContact O-N 2.81Å; D28-T31 VanDerWaalsContact O-N 3.14Å; D28-T31 PolarHBondContact O-OG1 3.49Å; D28-T32 PolarHBondContact O-N 3.5Å
29	P	93.1	Very high	84.6	Confident	40 Å²	40	98 Å²	98	26%	0.26	48%	0.479	S	S	.	.	H	α-helix	trans	-57.8	-25.9	177	-24.6	34.2	0	0	0	113.6	V27 V33 N89	V27-P29 VanDerWaalsContact O-CD 3.31Å; V27-P29 WeakPolarHBondContact O-CD 3.31Å; P29-V33 WeakPolarHBondContact O-CB 3.4Å; P29-V33 VanDerWaalsContact O-CG2 3.22Å; P29-V33 WeakPolarHBondContact O-CG2 3.48Å; P29-V33 PolarHBondContact O-N 3.07Å; P29-N89 HydrophobicContact CB-CB 3.51Å; P29-N89 HydrophobicContact CG-CB 4.13Å
30	L	94.7	Very high	86.1	Confident	39 Å²	39	96 Å²	96	20%	0.204	47%	0.472	C	S	.	.	H	α-helix	trans	-65.8	-43.3	177.5	178.6	62.1	0	0	0	112.5	D28 V33 R34 V82 L86	D28-L30 PolarHBondContact O-N 3.42Å; D28-L30 VanDerWaalsContact O-N 3.07Å; D28-L30 WeakPolarHBondContact OD1-CB 3.31Å; D28-L30 PolarHBondContact OD1-N 2.97Å; D28-L30 WeakPolarHBondContact OD2-CB 3.22Å; L30-V33 PolarHBondContact O-N 3.14Å; L30-R34 HydrophobicContact CD1-CG 4.25Å; L30-R34 WeakPolarHBondContact O-CB 3.45Å; L30-R34 VanDerWaalsContact O-CG 3.25Å; L30-R34 WeakPolarHBondContact O-CG 3.49Å; L30-R34 PolarHBondContact O-N 2.96Å; L30-V82 HydrophobicContact CD1-CG1 3.96Å; L30-L86 HydrophobicContact CB-CD1 3.88Å; L30-L86 HydrophobicContact CD1-CD1 3.75Å; L30-L86 HydrophobicContact CD1-CD2 3.71Å; L30-L86 HydrophobicContact CD1-CG 4.34Å; L30-L86 HydrophobicContact CG-CD1 4.44Å
31	T	94	Very high	87.5	Confident	60 Å²	60	96.2 Å²	96.2	37%	0.368	47%	0.473	S	S	.	.	H	α-helix	trans	-65	-45.8	179.3	57.6	0	0	0	0	109.8	D28 V33 R34 E35	D28-T31 HydrophobicContact CB-CG2 4.15Å; D28-T31 PolarHBondContact O-N 2.81Å; D28-T31 VanDerWaalsContact O-N 3.14Å; D28-T31 PolarHBondContact O-OG1 3.49Å; T31-V33 PolarHBondContact O-N 2.85Å; T31-R34 PolarHBondContact O-N 2.96Å; T31-E35 WeakPolarHBondContact O-CG 3.35Å; T31-E35 PolarHBondContact O-N 3.21Å
32	T	94.2	Very high	88.9	Confident	53 Å²	53	97.8 Å²	97.8	33%	0.325	48%	0.478	S	S	.	.	H	α-helix	trans	-57	-48.6	176.1	-58.3	0	0	0	0	112	V27 D28 R34 E35 Q36	V27-T32 WeakPolarHBondContact CG1-OG1 3.45Å; D28-T32 PolarHBondContact O-N 3.5Å; T32-R34 PolarHBondContact O-N 3.15Å; T32-E35 PolarHBondContact O-N 3.4Å; T32-Q36 VanDerWaalsContact O-CG 3.31Å; T32-Q36 WeakPolarHBondContact O-CG 3.48Å; T32-Q36 PolarHBondContact O-N 3.26Å; T32-Q36 VanDerWaalsContact O-N 3.15Å
33	V	95.9	Very high	90.3	Very high	4 Å²	4	90.9 Å²	90.9	2%	0.024	45%	0.446	C	S	.	.	H	α-helix	trans	-67.7	-36.8	-179.4	171.3	0	0	0	0	111.4	P29 L30 T31 Q36 C37 V82 K85	P29-V33 WeakPolarHBondContact O-CB 3.4Å; P29-V33 VanDerWaalsContact O-CG2 3.22Å; P29-V33 WeakPolarHBondContact O-CG2 3.48Å; P29-V33 PolarHBondContact O-N 3.07Å; L30-V33 PolarHBondContact O-N 3.14Å; T31-V33 PolarHBondContact O-N 2.85Å; V33-Q36 PolarHBondContact O-N 3.46Å; V33-C37 WeakPolarHBondContact O-CB 3.2Å; V33-C37 PolarHBondContact O-N 2.94Å; V33-C37 PolarHBondContact O-SG 3.05Å; V33-V82 HydrophobicContact CG1-CB 4.3Å; V33-V82 HydrophobicContact CG1-CG1 4.1Å; V33-V82 HydrophobicContact CG1-CG2 4.22Å; V33-K85 HydrophobicContact CG1-CB 3.63Å; V33-K85 HydrophobicContact CG1-CD 4.36Å; V33-K85 HydrophobicContact CG2-CB 4.4Å
34	R	96.5	Very high	91.7	Very high	93 Å²	93	85.5 Å²	85.5	35%	0.351	42%	0.423	S	S	.	.	H	α-helix	trans	-62.2	-50.1	175.6	-79.7	172.4	172.9	169.9	0.9	111.4	L30 T31 T32 Q36 C37 E38 K78 V82	L30-R34 HydrophobicContact CD1-CG 4.25Å; L30-R34 WeakPolarHBondContact O-CB 3.45Å; L30-R34 VanDerWaalsContact O-CG 3.25Å; L30-R34 WeakPolarHBondContact O-CG 3.49Å; L30-R34 PolarHBondContact O-N 2.96Å; T31-R34 PolarHBondContact O-N 2.96Å; T32-R34 PolarHBondContact O-N 3.15Å; R34-Q36 VanDerWaalsContact C-N 3.29Å; R34-Q36 PolarHBondContact O-N 2.82Å; R34-C37 CarbonylContact O-C 3.54Å; R34-C37 WeakPolarHBondContact O-CA 3.25Å; R34-C37 PolarHBondContact O-N 3Å; R34-E38 WeakPolarHBondContact O-CG 3.36Å; R34-E38 PolarHBondContact O-N 3.33Å; R34-K78 HydrophobicContact CB-CD 4.48Å; R34-K78 HydrophobicContact CG-CD 4.27Å; R34-V82 HydrophobicContact CG-CG2 3.81Å
35	E	95.3	Very high	93.1	Very high	125 Å²	125	82.9 Å²	82.9	58%	0.584	41%	0.409	S	S	*	.	H	α-helix	trans	-57.3	-43	177.9	-72.7	-179.6	-179.7	0	0	111.9	T31 T32 C37 E38 Q39	T31-E35 WeakPolarHBondContact O-CG 3.35Å; T31-E35 PolarHBondContact O-N 3.21Å; T32-E35 PolarHBondContact O-N 3.4Å; E35-C37 VanDerWaalsContact C-N 3.33Å; E35-C37 PolarHBondContact O-N 3.32Å; E35-E38 PolarHBondContact O-N 3.44Å; E35-Q39 WeakPolarHBondContact O-CG 3.36Å; E35-Q39 PolarHBondContact O-N 3.21Å
36	Q	95.2	Very high	94.3	Very high	94 Å²	94	75.6 Å²	75.6	44%	0.439	38%	0.378	S	S	.	.	H	α-helix	trans	-63.6	-37.3	174.9	-69.9	175.8	8.3	0	0	112.9	T32 V33 R34	T32-Q36 VanDerWaalsContact O-CG 3.31Å; T32-Q36 WeakPolarHBondContact O-CG 3.48Å; T32-Q36 PolarHBondContact O-N 3.26Å; T32-Q36 VanDerWaalsContact O-N 3.15Å; V33-Q36 PolarHBondContact O-N 3.46Å; R34-Q36 VanDerWaalsContact C-N 3.29Å; R34-Q36 PolarHBondContact O-N 2.82Å
37	C	96.8	Very high	95	Very high	0 Å²	0	73.7 Å²	73.7	0%	0	36%	0.361	C	S	.	.	H	α-helix	trans	-75.7	-29.1	178.8	-76	0	0	0	0	112.6	V33 R34 E35 Q39 L40 C43 C81 V82	V33-C37 WeakPolarHBondContact O-CB 3.2Å; V33-C37 PolarHBondContact O-N 2.94Å; V33-C37 PolarHBondContact O-SG 3.05Å; R34-C37 CarbonylContact O-C 3.54Å; R34-C37 WeakPolarHBondContact O-CA 3.25Å; R34-C37 PolarHBondContact O-N 3Å; E35-C37 VanDerWaalsContact C-N 3.33Å; E35-C37 PolarHBondContact O-N 3.32Å; C37-Q39 PolarHBondContact O-N 2.97Å; C37-L40 WeakPolarHBondContact O-CB 3.29Å; C37-L40 WeakPolarHBondContact O-CG 3.33Å; C37-L40 PolarHBondContact O-N 2.97Å; C37-C43 PolarHBondContact O-SG 3.47Å; C37-C81 VanDerWaalsContact CA-SG 3.54Å; C37-C81 HydrophobicContact CB-CB 3.6Å; C37-C81 WeakPolarHBondContact CB-SG 3.29Å; C37-C81 WeakPolarHBondContact SG-CB 3.48Å; C37-C81 CovalentContact SG-SG 2.04Å; C37-C81 PolarHBondContact SG-SG 2.83Å; C37-V82 HydrophobicContact CB-CG2 4.03Å; C37-V82 PolarHBondContact SG-N 3.12Å; C37-V82 VanDerWaalsContact SG-N 3.41Å
38	E	95.9	Very high	95.6	Very high	57 Å²	57	74.2 Å²	74.2	27%	0.266	36%	0.357	S	S	.	.	H	α-helix	trans	-68.8	-22.9	176.7	-75.3	175.8	-168.5	0	0	112.8	R34 E35 L40 C43 V44 F74 K78	R34-E38 WeakPolarHBondContact O-CG 3.36Å; R34-E38 PolarHBondContact O-N 3.33Å; E35-E38 PolarHBondContact O-N 3.44Å; E38-L40 PolarHBondContact O-N 2.83Å; E38-C43 WeakPolarHBondContact O-CB 3.37Å; E38-V44 WeakPolarHBondContact O-CG2 3.28Å; E38-F74 HydrophobicContact CG-CE2 4.18Å; E38-F74 HydrophobicContact CG-CZ 3.9Å; E38-K78 HydrophobicContact CG-CD 3.85Å; E38-K78 HydrophobicContact CG-CG 4.18Å; E38-K78 VanDerWaalsContact OE1-CD 3.29Å; E38-K78 WeakPolarHBondContact OE1-CD 3.46Å; E38-K78 IonicContact OE1-NZ 2.64Å
39	Q	95.8	Very high	95.9	Very high	155 Å²	155	74.8 Å²	74.8	72%	0.724	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.3	-10.5	173.8	-66	174.7	12.2	0	0	114	E35 C37	E35-Q39 WeakPolarHBondContact O-CG 3.36Å; E35-Q39 PolarHBondContact O-N 3.21Å; C37-Q39 PolarHBondContact O-N 2.97Å
40	L	95.9	Very high	96.1	Very high	79 Å²	79	74.5 Å²	74.5	41%	0.414	35%	0.349	S	S	.	.	S	Bend	trans	-66.4	140.3	176	-66.7	178.1	0	0	0	110.7	C37 E38 K42 C43 V44 C81	C37-L40 WeakPolarHBondContact O-CB 3.29Å; C37-L40 WeakPolarHBondContact O-CG 3.33Å; C37-L40 PolarHBondContact O-N 2.97Å; E38-L40 PolarHBondContact O-N 2.83Å; L40-K42 PolarHBondContact O-N 3.43Å; L40-C43 HydrophobicContact CB-CB 4.47Å; L40-C43 WeakPolarHBondContact O-CA 3.03Å; L40-C43 WeakPolarHBondContact O-CB 3.5Å; L40-C43 PolarHBondContact O-N 3.33Å; L40-V44 WeakPolarHBondContact O-CG2 3.39Å; L40-V44 PolarHBondContact O-N 3.36Å; L40-C81 HydrophobicContact CD1-CB 3.68Å; L40-C81 VanDerWaalsContact CD1-SG 3.57Å
41	E	96.1	Very high	96.2	Very high	133 Å²	133	77.2 Å²	77.2	62%	0.621	36%	0.361	S	S	*	.	H	α-helix	trans	-51.6	-38.2	-177.9	-170.4	-170.5	162.4	0	0	113.3	K45	E41-K45 HydrophobicContact CG-CD 4.24Å; E41-K45 WeakPolarHBondContact O-CB 3.36Å; E41-K45 WeakPolarHBondContact O-CG 3.04Å; E41-K45 PolarHBondContact O-N 3.23Å; E41-K45 WeakPolarHBondContact OE1-CE 3.35Å; E41-K45 IonicContact OE1-NZ 3.96Å; E41-K45 PolarHBondContact OE1-NZ 3.44Å
42	K	95.2	Very high	96.3	Very high	169 Å²	169	79.4 Å²	79.4	74%	0.735	37%	0.37	S	S	*	.	H	α-helix	trans	-65.4	-41.4	177.2	-67.5	-175.1	179.8	-179.1	0	112.4	L40 A46 A77	L40-K42 PolarHBondContact O-N 3.43Å; K42-A46 WeakPolarHBondContact O-CB 3.25Å; K42-A46 PolarHBondContact O-N 2.04Å; K42-A77 HydrophobicContact CB-CB 4.38Å
43	C	96.9	Very high	96.4	Very high	1 Å²	1	81.2 Å²	81.2	1%	0.007	37%	0.371	C	S	.	.	H	α-helix	trans	-70.7	-42.9	179	-58.5	0	0	0	0	110.6	C37 E38 L40 K45 A46 R47 F74	C37-C43 PolarHBondContact O-SG 3.47Å; E38-C43 WeakPolarHBondContact O-CB 3.37Å; L40-C43 HydrophobicContact CB-CB 4.47Å; L40-C43 WeakPolarHBondContact O-CA 3.03Å; L40-C43 WeakPolarHBondContact O-CB 3.5Å; L40-C43 PolarHBondContact O-N 3.33Å; C43-K45 PolarHBondContact O-N 3.39Å; C43-A46 PolarHBondContact O-N 3.45Å; C43-R47 WeakPolarHBondContact O-CB 3.41Å; C43-R47 PolarHBondContact O-N 2.9Å; C43-F74 HydrophobicContact CB-CE2 4.47Å
44	V	97.2	Very high	96.3	Very high	39 Å²	39	85.5 Å²	85.5	24%	0.236	39%	0.394	C	S	.	.	H	α-helix	trans	-58.5	-49.3	175.5	177.3	0	0	0	0	110.7	E38 L40 A46 R47 E48	E38-V44 WeakPolarHBondContact O-CG2 3.28Å; L40-V44 WeakPolarHBondContact O-CG2 3.39Å; L40-V44 PolarHBondContact O-N 3.36Å; V44-A46 PolarHBondContact O-N 3.14Å; V44-R47 PolarHBondContact O-N 3.41Å; V44-E48 WeakPolarHBondContact O-CG 3.41Å; V44-E48 PolarHBondContact O-N 3.15Å
45	K	97.4	Very high	96.3	Very high	116 Å²	116	87.8 Å²	87.8	50%	0.504	41%	0.409	S	S	.	.	H	α-helix	trans	-62.6	-41.4	177.6	-75.9	175.6	171.7	173.5	0	113.2	E41 C43 R47 E48 R49	E41-K45 HydrophobicContact CG-CD 4.24Å; E41-K45 WeakPolarHBondContact O-CB 3.36Å; E41-K45 WeakPolarHBondContact O-CG 3.04Å; E41-K45 PolarHBondContact O-N 3.23Å; E41-K45 WeakPolarHBondContact OE1-CE 3.35Å; E41-K45 IonicContact OE1-NZ 3.96Å; E41-K45 PolarHBondContact OE1-NZ 3.44Å; C43-K45 PolarHBondContact O-N 3.39Å; K45-R47 VanDerWaalsContact C-N 3.33Å; K45-E48 PolarHBondContact O-N 3.21Å; K45-R49 PolarHBondContact O-N 3.42Å
46	A	97.2	Very high	96.2	Very high	15 Å²	15	85.2 Å²	85.2	12%	0.124	40%	0.397	C	S	.	.	H	α-helix	trans	-65.9	-38.7	177.3	0	0	0	0	0	111.4	K42 C43 V44 R49 L50 F74	K42-A46 WeakPolarHBondContact O-CB 3.25Å; K42-A46 PolarHBondContact O-N 2.04Å; C43-A46 PolarHBondContact O-N 3.45Å; V44-A46 PolarHBondContact O-N 3.14Å; A46-R49 PolarHBondContact O-N 3.34Å; A46-L50 WeakPolarHBondContact O-CB 3.48Å; A46-L50 PolarHBondContact O-N 3.48Å; A46-F74 HydrophobicContact CB-CB 4.02Å; A46-F74 HydrophobicContact CB-CD2 4.38Å
47	R	97.1	Very high	96.1	Very high	103 Å²	103	82.1 Å²	82.1	39%	0.389	38%	0.384	S	S	.	.	H	α-helix	trans	-65	-45.8	174.3	-173.5	-173.2	65.3	172.2	2.3	112.1	C43 V44 K45 R49 L50 E51 F74	C43-R47 WeakPolarHBondContact O-CB 3.41Å; C43-R47 PolarHBondContact O-N 2.9Å; V44-R47 PolarHBondContact O-N 3.41Å; K45-R47 VanDerWaalsContact C-N 3.33Å; R47-R49 VanDerWaalsContact C-N 3.28Å; R47-R49 PolarHBondContact O-N 3.41Å; R47-L50 WeakPolarHBondContact O-CB 3.41Å; R47-L50 PolarHBondContact O-N 2.88Å; R47-L50 VanDerWaalsContact O-N 3.12Å; R47-E51 HydrophobicContact CG-CG 4.46Å; R47-E51 WeakPolarHBondContact CG-OE1 3.4Å; R47-E51 IonicContact NE-OE1 3.8Å; R47-E51 WeakPolarHBondContact O-CG 3.44Å; R47-E51 PolarHBondContact O-N 2.77Å; R47-F74 HydrophobicContact CB-CD2 4.04Å; R47-F74 HydrophobicContact CB-CE2 4.05Å
48	E	97.3	Very high	95.9	Very high	108 Å²	108	86.3 Å²	86.3	51%	0.505	41%	0.413	S	S	.	.	H	α-helix	trans	-58.5	-40.5	175.6	-74.1	172.9	173.2	0	0	111.7	V44 K45 L52	V44-E48 WeakPolarHBondContact O-CG 3.41Å; V44-E48 PolarHBondContact O-N 3.15Å; K45-E48 PolarHBondContact O-N 3.21Å; E48-L52 WeakPolarHBondContact O-CB 3.49Å; E48-L52 PolarHBondContact O-N 2.88Å
49	R	96.5	Very high	95.8	Very high	87 Å²	87	87.9 Å²	87.9	33%	0.328	43%	0.43	S	S	.	.	H	α-helix	trans	-63.9	-46.3	174	-173.7	-175.1	168.2	-175.3	-3.8	110.9	K45 A46 R47 E51 L52 Y53 E69 E70 D73	K45-R49 PolarHBondContact O-N 3.42Å; A46-R49 PolarHBondContact O-N 3.34Å; R47-R49 VanDerWaalsContact C-N 3.28Å; R47-R49 PolarHBondContact O-N 3.41Å; R49-E51 PolarHBondContact O-N 2.89Å; R49-L52 PolarHBondContact O-N 3.12Å; R49-Y53 HydrophobicContact CG-CD2 3.86Å; R49-Y53 HydrophobicContact CG-CE2 3.88Å; R49-Y53 VanDerWaalsContact O-CD2 3.32Å; R49-Y53 WeakPolarHBondContact O-CD2 3.33Å; R49-Y53 PolarHBondContact O-N 3.26Å; R49-E69 IonicContact CZ-OE1 3.72Å; R49-E69 IonicContact NH1-OE1 3.78Å; R49-E69 IonicContact NH2-OE1 2.85Å; R49-E69 PolarHBondContact NH2-OE1 3.06Å; R49-E70 HydrophobicContact CG-CG 3.81Å; R49-E70 IonicContact CZ-OE1 3.31Å; R49-E70 VanDerWaalsContact CZ-OE1 3.31Å; R49-E70 IonicContact NE-OE1 3.12Å; R49-E70 PolarHBondContact NE-OE1 3.48Å; R49-E70 VanDerWaalsContact NE-OE1 3.12Å; R49-E70 IonicContact NH2-OE1 2.83Å; R49-E70 PolarHBondContact NH2-OE1 2.94Å; R49-D73 IonicContact NH1-OD2 3.18Å; R49-D73 PolarHBondContact NH1-OD2 3.02Å
50	L	97.3	Very high	95.6	Very high	35 Å²	35	85.5 Å²	85.5	18%	0.183	42%	0.415	C	S	.	.	H	α-helix	trans	-57.4	-48.4	177.6	176.9	61.8	0	0	0	111.8	A46 R47 L52 Y53 D54 C67 E70 L71	A46-L50 WeakPolarHBondContact O-CB 3.48Å; A46-L50 PolarHBondContact O-N 3.48Å; R47-L50 WeakPolarHBondContact O-CB 3.41Å; R47-L50 PolarHBondContact O-N 2.88Å; R47-L50 VanDerWaalsContact O-N 3.12Å; L50-L52 PolarHBondContact O-N 3.36Å; L50-Y53 PolarHBondContact O-N 3.32Å; L50-D54 WeakPolarHBondContact O-CB 3.41Å; L50-D54 PolarHBondContact O-N 2.95Å; L50-C67 HydrophobicContact CD1-CB 3.82Å; L50-E70 HydrophobicContact CB-CB 4.03Å; L50-E70 HydrophobicContact CD1-CB 3.71Å; L50-E70 HydrophobicContact CG-CB 4.5Å; L50-L71 HydrophobicContact CD1-CB 4.41Å; L50-L71 HydrophobicContact CD2-CD1 4.36Å
51	E	96.9	Very high	95.2	Very high	95 Å²	95	87 Å²	87	44%	0.444	43%	0.432	S	S	.	.	H	α-helix	trans	-60.5	-43.5	178.1	-71.7	169.1	-174.7	0	0	111.6	R47 R49 Y53 D54 E55	R47-E51 HydrophobicContact CG-CG 4.46Å; R47-E51 WeakPolarHBondContact CG-OE1 3.4Å; R47-E51 IonicContact NE-OE1 3.8Å; R47-E51 WeakPolarHBondContact O-CG 3.44Å; R47-E51 PolarHBondContact O-N 2.77Å; R49-E51 PolarHBondContact O-N 2.89Å; E51-Y53 PolarHBondContact O-N 3.49Å; E51-D54 PolarHBondContact O-N 3.03Å; E51-E55 WeakPolarHBondContact O-CG 3.35Å; E51-E55 PolarHBondContact O-N 2.99Å
52	L	96.2	Very high	94.7	Very high	107 Å²	107	89.1 Å²	89.1	56%	0.56	44%	0.441	S	S	*	.	H	α-helix	trans	-62.9	-40.7	177.3	-179.3	147.8	0	0	0	112.7	E48 R49 L50 H56	E48-L52 WeakPolarHBondContact O-CB 3.49Å; E48-L52 PolarHBondContact O-N 2.88Å; R49-L52 PolarHBondContact O-N 3.12Å; L50-L52 PolarHBondContact O-N 3.36Å; L52-H56 WeakPolarHBondContact O-CB 3.38Å; L52-H56 PolarHBondContact O-N 2.86Å; L52-H56 VanDerWaalsContact O-N 3.1Å
53	Y	94.9	Very high	94.5	Very high	90 Å²	90	83.4 Å²	83.4	35%	0.353	42%	0.421	S	S	.	.	H	α-helix	trans	-71.7	-36.6	177.5	-88.9	-98.7	0	0	0	111.7	R49 L50 E51 H56 V57 E70	R49-Y53 HydrophobicContact CG-CD2 3.86Å; R49-Y53 HydrophobicContact CG-CE2 3.88Å; R49-Y53 VanDerWaalsContact O-CD2 3.32Å; R49-Y53 WeakPolarHBondContact O-CD2 3.33Å; R49-Y53 PolarHBondContact O-N 3.26Å; L50-Y53 PolarHBondContact O-N 3.32Å; E51-Y53 PolarHBondContact O-N 3.49Å; Y53-H56 PolarHBondContact O-N 2.94Å; Y53-V57 WeakPolarHBondContact O-CB 3.37Å; Y53-V57 WeakPolarHBondContact O-CG2 3.14Å; Y53-V57 PolarHBondContact O-N 2.89Å; Y53-E70 HydrophobicContact CD2-CG 3.88Å; Y53-E70 HydrophobicContact CE2-CG 4.44Å; Y53-E70 HydrophobicContact CG-CG 3.97Å
54	D	95.4	Very high	94.2	Very high	95 Å²	95	93.1 Å²	93.1	51%	0.508	47%	0.466	S	S	.	.	H	α-helix	trans	-64	-42.1	174.8	-171.5	57	0	0	0	111.7	L50 E51 H56 V57 S58	L50-D54 WeakPolarHBondContact O-CB 3.41Å; L50-D54 PolarHBondContact O-N 2.95Å; E51-D54 PolarHBondContact O-N 3.03Å; D54-H56 VanDerWaalsContact C-N 3.3Å; D54-H56 PolarHBondContact O-N 3.38Å; D54-V57 PolarHBondContact O-N 3.13Å; D54-S58 WeakPolarHBondContact O-CB 3.42Å; D54-S58 PolarHBondContact O-N 3.47Å; D54-S58 PolarHBondContact O-OG 3.05Å
55	E	95.1	Very high	93.9	Very high	141 Å²	141	95.5 Å²	95.5	66%	0.659	47%	0.474	S	S	*	.	H	α-helix	trans	-59	-41.4	170.5	-74.4	-178	-178.9	0	0	112	E51 S58 S59	E51-E55 WeakPolarHBondContact O-CG 3.35Å; E51-E55 PolarHBondContact O-N 2.99Å; E55-S58 WeakPolarHBondContact CA-OG 3.27Å; E55-S58 PolarHBondContact O-OG 2.64Å; E55-S59 WeakPolarHBondContact O-CB 3.32Å; E55-S59 PolarHBondContact O-N 2.77Å; E55-S59 VanDerWaalsContact O-N 3.11Å
56	H	93	Very high	93.6	Very high	71 Å²	71	94.5 Å²	94.5	33%	0.329	48%	0.475	S	S	.	.	H	α-helix	trans	-68.9	-45.4	178.6	174.8	-94.8	0	0	0	112.4	L52 Y53 D54 S59 R60 E65	L52-H56 WeakPolarHBondContact O-CB 3.38Å; L52-H56 PolarHBondContact O-N 2.86Å; L52-H56 VanDerWaalsContact O-N 3.1Å; Y53-H56 PolarHBondContact O-N 2.94Å; D54-H56 VanDerWaalsContact C-N 3.3Å; D54-H56 PolarHBondContact O-N 3.38Å; H56-S59 PolarHBondContact O-N 2.99Å; H56-S59 PolarHBondContact O-OG 3.41Å; H56-R60 PolarHBondContact CE1-NE 2.89Å; H56-R60 PolarHBondContact CE1-NH2 3.47Å; H56-R60 PolarHBondContact NE2-NE 2.87Å; H56-R60 PolarHBondContact NE2-NH2 3.4Å; H56-E65 IonicContact CE1-OE2 3.39Å; H56-E65 PolarHBondContact CE1-OE2 3.45Å; H56-E65 IonicContact ND1-OE2 3.67Å
57	V	93.7	Very high	93.6	Very high	28 Å²	28	94.8 Å²	94.8	17%	0.17	48%	0.476	C	S	.	.	H	α-helix	trans	-65.6	-45.2	178.2	170.8	0	0	0	0	110.7	Y53 D54 S59 R60 T63 E65	Y53-V57 WeakPolarHBondContact O-CB 3.37Å; Y53-V57 WeakPolarHBondContact O-CG2 3.14Å; Y53-V57 PolarHBondContact O-N 2.89Å; D54-V57 PolarHBondContact O-N 3.13Å; V57-S59 PolarHBondContact O-N 2.83Å; V57-R60 PolarHBondContact O-N 3.4Å; V57-R60 VanDerWaalsContact O-N 3.08Å; V57-T63 HydrophobicContact CG1-CG2 3.97Å; V57-E65 HydrophobicContact CG2-CB 4.28Å
58	S	92.8	Very high	93.5	Very high	88 Å²	88	93 Å²	93	62%	0.615	48%	0.476	S	S	*	.	H	α-helix	trans	-63.6	-27.6	178	64.5	0	0	0	0	113.4	D54 E55 R60	D54-S58 WeakPolarHBondContact O-CB 3.42Å; D54-S58 PolarHBondContact O-N 3.47Å; D54-S58 PolarHBondContact O-OG 3.05Å; E55-S58 WeakPolarHBondContact CA-OG 3.27Å; E55-S58 PolarHBondContact O-OG 2.64Å; S58-R60 VanDerWaalsContact C-N 3.29Å; S58-R60 PolarHBondContact O-N 3.36Å
59	S	93.8	Very high	93.4	Very high	90 Å²	90	93.1 Å²	93.1	63%	0.629	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.2	-17.6	174.8	78.9	0	0	0	0	114.2	E55 H56 V57	E55-S59 WeakPolarHBondContact O-CB 3.32Å; E55-S59 PolarHBondContact O-N 2.77Å; E55-S59 VanDerWaalsContact O-N 3.11Å; H56-S59 PolarHBondContact O-N 2.99Å; H56-S59 PolarHBondContact O-OG 3.41Å; V57-S59 PolarHBondContact O-N 2.83Å
60	R	91.8	Very high	93.5	Very high	106 Å²	106	89.2 Å²	89.2	40%	0.4	46%	0.462	S	S	.	.			trans	-94.7	124.3	-178.3	-66.8	-176.3	175.9	-164.9	3.7	110.3	H56 V57 S58 H62 T63 E65	H56-R60 PolarHBondContact CE1-NE 2.89Å; H56-R60 PolarHBondContact CE1-NH2 3.47Å; H56-R60 PolarHBondContact NE2-NE 2.87Å; H56-R60 PolarHBondContact NE2-NH2 3.4Å; V57-R60 PolarHBondContact O-N 3.4Å; V57-R60 VanDerWaalsContact O-N 3.08Å; S58-R60 VanDerWaalsContact C-N 3.29Å; S58-R60 PolarHBondContact O-N 3.36Å; R60-H62 VanDerWaalsContact C-N 3.28Å; R60-H62 PolarHBondContact O-N 3.29Å; R60-T63 HydrophobicContact CB-CG2 3.95Å; R60-E65 IonicContact CZ-OE1 3.72Å; R60-E65 IonicContact CZ-OE2 3.18Å; R60-E65 IonicContact NE-OE2 3.59Å; R60-E65 IonicContact NH1-OE1 2.95Å; R60-E65 PolarHBondContact NH1-OE1 2.9Å; R60-E65 IonicContact NH1-OE2 2.75Å; R60-E65 PolarHBondContact NH1-OE2 3.28Å; R60-E65 IonicContact NH2-OE1 3.91Å; R60-E65 IonicContact NH2-OE2 3.84Å
61	S	86.9	Confident	93.5	Very high	109 Å²	109	91 Å²	91	76%	0.762	47%	0.471	S	S	*	.	S	Bend	trans	-69.2	-27.1	178.6	60.7	0	0	0	0	113.6
62	H	87.1	Confident	93.5	Very high	178 Å²	178	93 Å²	93	82%	0.824	48%	0.479	S	S	*	.	S	Bend	trans	-145.9	105.1	178	-63.4	-65.7	0	0	0	108.7	R60	R60-H62 VanDerWaalsContact C-N 3.28Å; R60-H62 PolarHBondContact O-N 3.29Å
63	T	89.6	Confident	93.6	Very high	50 Å²	50	91.3 Å²	91.3	31%	0.307	47%	0.471	S	S	.	.			trans	-138.9	146.6	172.9	-169.1	0	0	0	0	109.3	V57 R60 E65	V57-T63 HydrophobicContact CG1-CG2 3.97Å; R60-T63 HydrophobicContact CB-CG2 3.95Å; T63-E65 VanDerWaalsContact C-N 3.33Å; T63-E65 HydrophobicContact CG2-CB 4.35Å; T63-E65 WeakPolarHBondContact OG1-CB 3.4Å; T63-E65 WeakPolarHBondContact OG1-CG 3.21Å; T63-E65 PolarHBondContact OG1-N 2.94Å; T63-E65 PolarHBondContact OG1-OE2 3.31Å
64	E	90.6	Very high	93.7	Very high	204 Å²	204	88 Å²	88	95%	0.953	46%	0.458	S	S	*	.			trans	-91.3	-3.9	168.1	-64.6	-176.7	163.1	0	0	111.1
65	E	90.9	Very high	93.8	Very high	89 Å²	89	86 Å²	86	42%	0.416	45%	0.447	S	S	.	.			trans	-70.1	137.6	175.4	-62.7	166.4	165.6	0	0	110.2	H56 V57 R60 T63	H56-E65 IonicContact CE1-OE2 3.39Å; H56-E65 PolarHBondContact CE1-OE2 3.45Å; H56-E65 IonicContact ND1-OE2 3.67Å; V57-E65 HydrophobicContact CG2-CB 4.28Å; R60-E65 IonicContact CZ-OE1 3.72Å; R60-E65 IonicContact CZ-OE2 3.18Å; R60-E65 IonicContact NE-OE2 3.59Å; R60-E65 IonicContact NH1-OE1 2.95Å; R60-E65 PolarHBondContact NH1-OE1 2.9Å; R60-E65 IonicContact NH1-OE2 2.75Å; R60-E65 PolarHBondContact NH1-OE2 3.28Å; R60-E65 IonicContact NH2-OE1 3.91Å; R60-E65 IonicContact NH2-OE2 3.84Å; T63-E65 VanDerWaalsContact C-N 3.33Å; T63-E65 HydrophobicContact CG2-CB 4.35Å; T63-E65 WeakPolarHBondContact OG1-CB 3.4Å; T63-E65 WeakPolarHBondContact OG1-CG 3.21Å; T63-E65 PolarHBondContact OG1-N 2.94Å; T63-E65 PolarHBondContact OG1-OE2 3.31Å
66	D	92.6	Very high	93.9	Very high	96 Å²	96	86 Å²	86	51%	0.513	45%	0.447	S	S	.	.			trans	-125.3	173.3	171.3	66.2	42.5	0	0	0	110.4	T68	D66-T68 HydrophobicContact CB-CG2 4.29Å; D66-T68 VanDerWaalsContact OD1-CB 3.29Å; D66-T68 WeakPolarHBondContact OD1-CB 3.37Å; D66-T68 WeakPolarHBondContact OD1-CG2 3.47Å; D66-T68 PolarHBondContact OD1-N 3.1Å; D66-T68 PolarHBondContact OD1-OG1 3.46Å
67	C	95.3	Very high	94.1	Very high	21 Å²	21	83.7 Å²	83.7	14%	0.142	44%	0.44	C	S	.	.	S	Bend	trans	-102.5	24.7	179.5	-53.4	0	0	0	0	112.2	L50 L71	L50-C67 HydrophobicContact CD1-CB 3.82Å; C67-L71 WeakPolarHBondContact O-CB 3.41Å; C67-L71 PolarHBondContact O-N 3Å
68	T	96.4	Very high	94.3	Very high	64 Å²	64	83.3 Å²	83.3	39%	0.393	44%	0.436	S	S	.	.	H	α-helix	trans	-69.8	-34.6	-172.9	58.5	0	0	0	0	112.8	D66 L71 F72	D66-T68 HydrophobicContact CB-CG2 4.29Å; D66-T68 VanDerWaalsContact OD1-CB 3.29Å; D66-T68 WeakPolarHBondContact OD1-CB 3.37Å; D66-T68 WeakPolarHBondContact OD1-CG2 3.47Å; D66-T68 PolarHBondContact OD1-N 3.1Å; D66-T68 PolarHBondContact OD1-OG1 3.46Å; T68-L71 PolarHBondContact O-N 3.41Å; T68-F72 WeakPolarHBondContact O-CD2 3.39Å; T68-F72 VanDerWaalsContact O-CG 3.31Å; T68-F72 WeakPolarHBondContact O-CG 3.49Å; T68-F72 PolarHBondContact O-N 3.12Å
69	E	95.7	Very high	94.5	Very high	111 Å²	111	82.3 Å²	82.3	52%	0.519	42%	0.424	S	S	.	.	H	α-helix	trans	-61.7	-52.6	174.5	-176.1	-173.3	136.4	0	0	110.7	R49 L71 F72 D73	R49-E69 IonicContact CZ-OE1 3.72Å; R49-E69 IonicContact NH1-OE1 3.78Å; R49-E69 IonicContact NH2-OE1 2.85Å; R49-E69 PolarHBondContact NH2-OE1 3.06Å; E69-L71 VanDerWaalsContact C-N 3.27Å; E69-L71 PolarHBondContact O-N 3.03Å; E69-F72 PolarHBondContact O-N 3.1Å; E69-F72 VanDerWaalsContact O-N 3.13Å; E69-D73 PolarHBondContact O-N 3.06Å
70	E	96.9	Very high	94.6	Very high	6 Å²	6	83.8 Å²	83.8	3%	0.028	42%	0.42	C	S	.	.	H	α-helix	trans	-60.7	-38	178.9	-73.3	68.7	-150.7	0	0	112	R49 L50 Y53 D73 F74	R49-E70 HydrophobicContact CG-CG 3.81Å; R49-E70 IonicContact CZ-OE1 3.31Å; R49-E70 VanDerWaalsContact CZ-OE1 3.31Å; R49-E70 IonicContact NE-OE1 3.12Å; R49-E70 PolarHBondContact NE-OE1 3.48Å; R49-E70 VanDerWaalsContact NE-OE1 3.12Å; R49-E70 IonicContact NH2-OE1 2.83Å; R49-E70 PolarHBondContact NH2-OE1 2.94Å; L50-E70 HydrophobicContact CB-CB 4.03Å; L50-E70 HydrophobicContact CD1-CB 3.71Å; L50-E70 HydrophobicContact CG-CB 4.5Å; Y53-E70 HydrophobicContact CD2-CG 3.88Å; Y53-E70 HydrophobicContact CE2-CG 4.44Å; Y53-E70 HydrophobicContact CG-CG 3.97Å; E70-D73 PolarHBondContact O-N 3.31Å; E70-F74 PolarHBondContact O-N 3.45Å
71	L	97.1	Very high	94.9	Very high	71 Å²	71	79.4 Å²	79.4	37%	0.372	41%	0.406	S	S	.	.	H	α-helix	trans	-64	-44.3	175.5	179.3	62.3	0	0	0	111.2	L50 C67 T68 E69 F74 L75	L50-L71 HydrophobicContact CD1-CB 4.41Å; L50-L71 HydrophobicContact CD2-CD1 4.36Å; C67-L71 WeakPolarHBondContact O-CB 3.41Å; C67-L71 PolarHBondContact O-N 3Å; T68-L71 PolarHBondContact O-N 3.41Å; E69-L71 VanDerWaalsContact C-N 3.27Å; E69-L71 PolarHBondContact O-N 3.03Å; L71-F74 PolarHBondContact O-N 3.43Å; L71-L75 HydrophobicContact CD1-CD1 4.11Å; L71-L75 HydrophobicContact CD1-CG 4.11Å; L71-L75 HydrophobicContact CG-CD1 3.96Å; L71-L75 HydrophobicContact CG-CG 4.36Å; L71-L75 WeakPolarHBondContact O-CB 3.32Å; L71-L75 VanDerWaalsContact O-CG 3.27Å; L71-L75 WeakPolarHBondContact O-CG 3.33Å; L71-L75 PolarHBondContact O-N 3.31Å
72	F	98.1	Very high	95.4	Very high	138 Å²	138	74.6 Å²	74.6	61%	0.605	37%	0.372	S	S	*	.	H	α-helix	trans	-66.4	-36.5	177.5	-68.5	-27.8	0	0	0	112.6	T68 E69 H76	T68-F72 WeakPolarHBondContact O-CD2 3.39Å; T68-F72 VanDerWaalsContact O-CG 3.31Å; T68-F72 WeakPolarHBondContact O-CG 3.49Å; T68-F72 PolarHBondContact O-N 3.12Å; E69-F72 PolarHBondContact O-N 3.1Å; E69-F72 VanDerWaalsContact O-N 3.13Å; F72-H76 WeakPolarHBondContact O-CB 3.22Å; F72-H76 PolarHBondContact O-N 3.11Å
73	D	97.3	Very high	95.8	Very high	72 Å²	72	69 Å²	69	39%	0.385	36%	0.357	S	S	.	.	H	α-helix	trans	-60.4	-47.1	172.9	-81.6	-13	0	0	0	111.5	R49 E69 E70 A77	R49-D73 IonicContact NH1-OD2 3.18Å; R49-D73 PolarHBondContact NH1-OD2 3.02Å; E69-D73 PolarHBondContact O-N 3.06Å; E70-D73 PolarHBondContact O-N 3.31Å; D73-A77 PolarHBondContact O-N 2.8Å; D73-A77 VanDerWaalsContact O-N 3.12Å
74	F	97.9	Very high	96.1	Very high	21 Å²	21	73.1 Å²	73.1	9%	0.092	37%	0.372	C	S	.	.	H	α-helix	trans	-63.6	-49.1	177.7	171.4	-108.7	0	0	0	112.1	E38 C43 A46 R47 E70 L71 H76 A77 K78	E38-F74 HydrophobicContact CG-CE2 4.18Å; E38-F74 HydrophobicContact CG-CZ 3.9Å; C43-F74 HydrophobicContact CB-CE2 4.47Å; A46-F74 HydrophobicContact CB-CB 4.02Å; A46-F74 HydrophobicContact CB-CD2 4.38Å; R47-F74 HydrophobicContact CB-CD2 4.04Å; R47-F74 HydrophobicContact CB-CE2 4.05Å; E70-F74 PolarHBondContact O-N 3.45Å; L71-F74 PolarHBondContact O-N 3.43Å; F74-H76 PolarHBondContact O-N 3.29Å; F74-A77 PolarHBondContact O-N 2.99Å; F74-K78 HydrophobicContact CE1-CD 4.33Å; F74-K78 HydrophobicContact CZ-CD 4.18Å; F74-K78 WeakPolarHBondContact O-CB 3.36Å; F74-K78 PolarHBondContact O-N 3.01Å
75	L	97.8	Very high	96.3	Very high	52 Å²	52	67.1 Å²	67.1	27%	0.272	34%	0.343	S	S	.	.	H	α-helix	trans	-61.4	-44.4	179	-72.1	176.7	0	0	0	111.4	L71 A77 K78 D79	L71-L75 HydrophobicContact CD1-CD1 4.11Å; L71-L75 HydrophobicContact CD1-CG 4.11Å; L71-L75 HydrophobicContact CG-CD1 3.96Å; L71-L75 HydrophobicContact CG-CG 4.36Å; L71-L75 WeakPolarHBondContact O-CB 3.32Å; L71-L75 VanDerWaalsContact O-CG 3.27Å; L71-L75 WeakPolarHBondContact O-CG 3.33Å; L71-L75 PolarHBondContact O-N 3.31Å; L75-A77 VanDerWaalsContact C-N 3.35Å; L75-A77 PolarHBondContact O-N 3.08Å; L75-K78 PolarHBondContact O-N 3.39Å; L75-D79 WeakPolarHBondContact O-CB 3.32Å; L75-D79 VanDerWaalsContact O-CG 3.24Å; L75-D79 PolarHBondContact O-N 3.13Å
76	H	97.4	Very high	96.5	Very high	141 Å²	141	64.1 Å²	64.1	65%	0.653	33%	0.33	S	S	*	.	H	α-helix	trans	-60.2	-44	178	178.3	-102.7	0	0	0	112	F72 F74 H80	F72-H76 WeakPolarHBondContact O-CB 3.22Å; F72-H76 PolarHBondContact O-N 3.11Å; F74-H76 PolarHBondContact O-N 3.29Å; H76-H80 VanDerWaalsContact O-CB 3.22Å; H76-H80 WeakPolarHBondContact O-CB 3.36Å; H76-H80 PolarHBondContact O-N 2.69Å; H76-H80 VanDerWaalsContact O-N 3.1Å
77	A	96.3	Very high	96.6	Very high	22 Å²	22	66.7 Å²	66.7	18%	0.182	34%	0.337	C	S	.	.	H	α-helix	trans	-64	-45.1	177.1	0	0	0	0	0	112.4	K42 D73 F74 L75	K42-A77 HydrophobicContact CB-CB 4.38Å; D73-A77 PolarHBondContact O-N 2.8Å; D73-A77 VanDerWaalsContact O-N 3.12Å; F74-A77 PolarHBondContact O-N 2.99Å; L75-A77 VanDerWaalsContact C-N 3.35Å; L75-A77 PolarHBondContact O-N 3.08Å
78	K	97.7	Very high	96.5	Very high	20 Å²	20	72.1 Å²	72.1	9%	0.087	36%	0.364	C	S	.	.	H	α-helix	trans	-65.9	-52.8	179.7	-177.2	-176.4	69.3	-177.2	0	111.3	R34 E38 F74 L75 H80 C81 V82	R34-K78 HydrophobicContact CB-CD 4.48Å; R34-K78 HydrophobicContact CG-CD 4.27Å; E38-K78 HydrophobicContact CG-CD 3.85Å; E38-K78 HydrophobicContact CG-CG 4.18Å; E38-K78 VanDerWaalsContact OE1-CD 3.29Å; E38-K78 WeakPolarHBondContact OE1-CD 3.46Å; E38-K78 IonicContact OE1-NZ 2.64Å; F74-K78 HydrophobicContact CE1-CD 4.33Å; F74-K78 HydrophobicContact CZ-CD 4.18Å; F74-K78 WeakPolarHBondContact O-CB 3.36Å; F74-K78 PolarHBondContact O-N 3.01Å; L75-K78 PolarHBondContact O-N 3.39Å; K78-H80 VanDerWaalsContact C-N 3.31Å; K78-H80 PolarHBondContact O-N 2.98Å; K78-C81 WeakPolarHBondContact O-CA 3.34Å; K78-C81 WeakPolarHBondContact O-CB 3.31Å; K78-C81 PolarHBondContact O-N 3.18Å; K78-V82 HydrophobicContact CG-CG2 4.06Å; K78-V82 WeakPolarHBondContact O-CG2 3.18Å; K78-V82 PolarHBondContact O-N 3.18Å
79	D	97.1	Very high	96.2	Very high	68 Å²	68	73.5 Å²	73.5	36%	0.364	37%	0.369	S	S	.	.	H	α-helix	trans	-70	-29.8	-172.2	-66.6	-23.9	0	0	0	111.9	L75 C81 V82 A83	L75-D79 WeakPolarHBondContact O-CB 3.32Å; L75-D79 VanDerWaalsContact O-CG 3.24Å; L75-D79 PolarHBondContact O-N 3.13Å; D79-C81 VanDerWaalsContact C-N 3.29Å; D79-C81 PolarHBondContact O-N 3.45Å; D79-V82 PolarHBondContact O-N 2.95Å; D79-A83 VanDerWaalsContact O-CB 3.25Å; D79-A83 WeakPolarHBondContact O-CB 3.48Å; D79-A83 PolarHBondContact O-N 3.34Å
80	H	97.2	Very high	95.9	Very high	120 Å²	120	72.2 Å²	72.2	56%	0.556	37%	0.365	S	S	*	.	H	α-helix	trans	-57.6	-43.3	169	-177.1	69.9	0	0	0	111.6	H76 K78 H84	H76-H80 VanDerWaalsContact O-CB 3.22Å; H76-H80 WeakPolarHBondContact O-CB 3.36Å; H76-H80 PolarHBondContact O-N 2.69Å; H76-H80 VanDerWaalsContact O-N 3.1Å; K78-H80 VanDerWaalsContact C-N 3.31Å; K78-H80 PolarHBondContact O-N 2.98Å; H80-H84 AromaticContact CE1-NE2 3.87Å; H80-H84 PolarHBondContact O-CD2 2.6Å
81	C	96.6	Very high	95.4	Very high	14 Å²	14	85.4 Å²	85.4	10%	0.095	42%	0.423	C	S	.	.	H	α-helix	trans	-70.9	-44.7	175.1	172	0	0	0	0	112.5	C37 L40 K78 D79 A83 H84	C37-C81 VanDerWaalsContact CA-SG 3.54Å; C37-C81 HydrophobicContact CB-CB 3.6Å; C37-C81 WeakPolarHBondContact CB-SG 3.29Å; C37-C81 WeakPolarHBondContact SG-CB 3.48Å; C37-C81 CovalentContact SG-SG 2.04Å; C37-C81 PolarHBondContact SG-SG 2.83Å; L40-C81 HydrophobicContact CD1-CB 3.68Å; L40-C81 VanDerWaalsContact CD1-SG 3.57Å; K78-C81 WeakPolarHBondContact O-CA 3.34Å; K78-C81 WeakPolarHBondContact O-CB 3.31Å; K78-C81 PolarHBondContact O-N 3.18Å; D79-C81 VanDerWaalsContact C-N 3.29Å; D79-C81 PolarHBondContact O-N 3.45Å; C81-A83 VanDerWaalsContact C-N 3.33Å; C81-A83 PolarHBondContact O-N 3.38Å; C81-H84 PolarHBondContact O-N 3.2Å
82	V	97.3	Very high	95.3	Very high	8 Å²	8	86.2 Å²	86.2	5%	0.048	43%	0.425	C	S	.	.	H	α-helix	trans	-61.1	-42.8	-177.9	173.5	0	0	0	0	110.6	L30 V33 R34 C37 K78 D79 H84 K85 L86	L30-V82 HydrophobicContact CD1-CG1 3.96Å; V33-V82 HydrophobicContact CG1-CB 4.3Å; V33-V82 HydrophobicContact CG1-CG1 4.1Å; V33-V82 HydrophobicContact CG1-CG2 4.22Å; R34-V82 HydrophobicContact CG-CG2 3.81Å; C37-V82 HydrophobicContact CB-CG2 4.03Å; C37-V82 PolarHBondContact SG-N 3.12Å; C37-V82 VanDerWaalsContact SG-N 3.41Å; K78-V82 HydrophobicContact CG-CG2 4.06Å; K78-V82 WeakPolarHBondContact O-CG2 3.18Å; K78-V82 PolarHBondContact O-N 3.18Å; D79-V82 PolarHBondContact O-N 2.95Å; V82-H84 PolarHBondContact O-N 3.18Å; V82-H84 VanDerWaalsContact O-N 3.15Å; V82-K85 PolarHBondContact O-N 2.75Å; V82-L86 HydrophobicContact CG1-CB 3.94Å; V82-L86 HydrophobicContact CG1-CD2 4.16Å; V82-L86 VanDerWaalsContact O-CB 3.28Å; V82-L86 WeakPolarHBondContact O-CB 3.39Å; V82-L86 PolarHBondContact O-N 2.95Å
83	A	96.5	Very high	95.1	Very high	62 Å²	62	83.4 Å²	83.4	51%	0.512	42%	0.416	S	S	.	.	H	α-helix	trans	-56.2	-33.2	179.3	0	0	0	0	0	113.1	D79 C81	D79-A83 VanDerWaalsContact O-CB 3.25Å; D79-A83 WeakPolarHBondContact O-CB 3.48Å; D79-A83 PolarHBondContact O-N 3.34Å; C81-A83 VanDerWaalsContact C-N 3.33Å; C81-A83 PolarHBondContact O-N 3.38Å
84	H	95.4	Very high	95	Very high	136 Å²	136	84.1 Å²	84.1	63%	0.63	42%	0.417	S	S	*	.	H	α-helix	trans	-77.3	-20	178.2	-77.1	-63.3	0	0	0	114.3	H80 C81 V82 N88	H80-H84 AromaticContact CE1-NE2 3.87Å; H80-H84 PolarHBondContact O-CD2 2.6Å; C81-H84 PolarHBondContact O-N 3.2Å; V82-H84 PolarHBondContact O-N 3.18Å; V82-H84 VanDerWaalsContact O-N 3.15Å; H84-N88 PolarHBondContact O-ND2 3.35Å
85	K	95	Very high	94.9	Very high	78 Å²	78	87.8 Å²	87.8	34%	0.339	44%	0.437	S	S	.	.	H	α-helix	trans	-115.5	-34.5	-170.4	-67.6	-177.2	-178.8	-179.7	0	113.9	V33 V82 F87 N88 N89	V33-K85 HydrophobicContact CG1-CB 3.63Å; V33-K85 HydrophobicContact CG1-CD 4.36Å; V33-K85 HydrophobicContact CG2-CB 4.4Å; V82-K85 PolarHBondContact O-N 2.75Å; K85-F87 PolarHBondContact O-N 3Å; K85-N88 WeakPolarHBondContact O-CB 3.33Å; K85-N88 PolarHBondContact O-N 3.39Å; K85-N89 PolarHBondContact O-ND2 2.85Å
86	L	95.5	Very high	94.7	Very high	26 Å²	26	90 Å²	90	14%	0.136	45%	0.447	C	S	.	.	G	3₁₀ helix	trans	-58	-51.9	-169.4	179.4	62.8	0	0	0	112.3	L30 V82 N88 N89 L90	L30-L86 HydrophobicContact CB-CD1 3.88Å; L30-L86 HydrophobicContact CD1-CD1 3.75Å; L30-L86 HydrophobicContact CD1-CD2 3.71Å; L30-L86 HydrophobicContact CD1-CG 4.34Å; L30-L86 HydrophobicContact CG-CD1 4.44Å; V82-L86 HydrophobicContact CG1-CB 3.94Å; V82-L86 HydrophobicContact CG1-CD2 4.16Å; V82-L86 VanDerWaalsContact O-CB 3.28Å; V82-L86 WeakPolarHBondContact O-CB 3.39Å; V82-L86 PolarHBondContact O-N 2.95Å; L86-N88 PolarHBondContact O-N 2.91Å; L86-N89 PolarHBondContact O-N 3.22Å; L86-L90 HydrophobicContact CG-CD1 4.08Å
87	F	94.9	Very high	94.5	Very high	150 Å²	150	86.6 Å²	86.6	66%	0.658	43%	0.433	S	S	*	.	G	3₁₀ helix	trans	-65	-11.9	-176	-71.9	-80.4	0	0	0	114.4	K85 N89 L90	K85-F87 PolarHBondContact O-N 3Å; F87-N89 VanDerWaalsContact C-N 3.26Å; F87-L90 HydrophobicContact CD1-CD1 4.3Å
88	N	93.1	Very high	94.4	Very high	135 Å²	135	91.2 Å²	91.2	72%	0.722	45%	0.451	S	S	*	.	G	3₁₀ helix	trans	-75.6	-17.1	172.5	-60.2	-40.5	0	0	0	112.7	H84 K85 L86	H84-N88 PolarHBondContact O-ND2 3.35Å; K85-N88 WeakPolarHBondContact O-CB 3.33Å; K85-N88 PolarHBondContact O-N 3.39Å; L86-N88 PolarHBondContact O-N 2.91Å
89	N	89.5	Confident	94.1	Very high	92 Å²	92	96.7 Å²	96.7	49%	0.492	48%	0.479	S	S	.	.	T	Hydrogen-bonded Turn	trans	-101.7	-10.5	179.8	-59.6	-80.8	0	0	0	112.9	P29 K85 L86 F87	P29-N89 HydrophobicContact CB-CB 3.51Å; P29-N89 HydrophobicContact CG-CB 4.13Å; K85-N89 PolarHBondContact O-ND2 2.85Å; L86-N89 PolarHBondContact O-N 3.22Å; F87-N89 VanDerWaalsContact C-N 3.26Å
90	L	90.4	Very high	93.8	Very high	85 Å²	85	99.1 Å²	99.1	45%	0.445	49%	0.489	S	S	.	.			trans	-95.5	136.4	179.1	-55.5	180	0	0	0	109	L86 F87	L86-L90 HydrophobicContact CG-CD1 4.08Å; F87-L90 HydrophobicContact CD1-CD1 4.3Å
91	K	85	Confident	93.5	Very high	283 Å²	283	97.2 Å²	97.2	100%	1.23	48%	0.483	S	S	*	.			trans	-100.8	0	175.7	-72.5	-177.7	-177.9	168.7	0	111.5

Retrieved 91 of 91 residues in 535.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).