A0A096LP97_HUMAN Loading...

Short transmembrane mitochondrial protein 1

AlphaFold DB , UniProt , Accession A0A096LP97, Species HUMAN (Homo sapiens, Human), Gene STMP1, Length 45 aa.

						>A0A096LP97_HUMAN|A0A096LP97|STMP1
MLQFLLGFTLGNVVGMYLAQNYDGIGSPSVSQAGVQWWDLGSLQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.8	Low	76.3	Confident	190 Å²	190	108.2 Å²	108.2	94%	0.936	58%	0.583	S	S	*	*				0	-50.6	0	-60.9	-52.1	-88.8	111.8	Q3 F4 L5	M1-Q3 PolarHBondContact O-N 3.37Å; M1-F4 PolarHBondContact O-N 2.83Å; M1-L5 PolarHBondContact O-N 3.35Å; M1-L5 VanDerWaalsContact O-N 3.07Å
2	L	72.1	Confident	76.4	Confident	135 Å²	135	103.3 Å²	103.3	71%	0.707	56%	0.556	S	S	*	*	H	α-helix	trans	-62.8	-42.4	-177	-92.5	152.4	0	114.7	F4 L5 L6	L2-F4 PolarHBondContact O-N 3.49Å; L2-L5 PolarHBondContact O-N 3.08Å; L2-L6 WeakPolarHBondContact O-CB 3.34Å; L2-L6 PolarHBondContact O-N 3.24Å
3	Q	70.7	Confident	76.8	Confident	157 Å²	157	101.7 Å²	101.7	73%	0.734	55%	0.552	S	S	*	*	H	α-helix	trans	-64.2	-28.3	177.5	63.6	-88.6	24.8	113.5	M1 G7	M1-Q3 PolarHBondContact O-N 3.37Å; Q3-G7 PolarHBondContact O-N 3.29Å; Q3-G7 VanDerWaalsContact O-N 3.08Å
4	F	73.8	Confident	77.1	Confident	170 Å²	170	100.3 Å²	100.3	75%	0.746	55%	0.548	S	S	*	.	H	α-helix	trans	-79.2	-42.8	178.5	-159.3	-90.3	0	111.1	M1 L2 F8	M1-F4 PolarHBondContact O-N 2.83Å; L2-F4 PolarHBondContact O-N 3.49Å; F4-F8 VanDerWaalsContact O-CB 3.22Å; F4-F8 WeakPolarHBondContact O-CB 3.23Å; F4-F8 PolarHBondContact O-N 2.82Å
5	L	76.4	Confident	77	Confident	107 Å²	107	95.5 Å²	95.5	56%	0.56	53%	0.531	S	S	*	.	H	α-helix	trans	-63.7	-44.2	174.3	-176.4	59.5	0	111.1	M1 L2 F8 T9	M1-L5 PolarHBondContact O-N 3.35Å; M1-L5 VanDerWaalsContact O-N 3.07Å; L2-L5 PolarHBondContact O-N 3.08Å; L5-F8 PolarHBondContact O-N 3.07Å; L5-T9 WeakPolarHBondContact O-CB 3.21Å; L5-T9 PolarHBondContact O-N 2.9Å; L5-T9 PolarHBondContact O-OG1 2.97Å
6	L	79.9	Confident	76.8	Confident	107 Å²	107	96.2 Å²	96.2	56%	0.56	53%	0.53	S	S	*	.	H	α-helix	trans	-66.8	-44	-179.9	-161	78.4	0	111.3	L2 T9 L10	L2-L6 WeakPolarHBondContact O-CB 3.34Å; L2-L6 PolarHBondContact O-N 3.24Å; L6-T9 PolarHBondContact O-N 2.91Å; L6-L10 HydrophobicContact CG-CD1 4.18Å; L6-L10 WeakPolarHBondContact O-CB 3.42Å; L6-L10 VanDerWaalsContact O-CG 3.23Å; L6-L10 WeakPolarHBondContact O-CG 3.3Å; L6-L10 PolarHBondContact O-N 2.91Å
7	G	81	Confident	76.8	Confident	45 Å²	45	99.5 Å²	99.5	46%	0.464	53%	0.534	S	S	.	.	H	α-helix	trans	-63.1	-39	174.4	0	0	0	113	Q3 G11	Q3-G7 PolarHBondContact O-N 3.29Å; Q3-G7 VanDerWaalsContact O-N 3.08Å; G7-G11 PolarHBondContact O-N 3.46Å
8	F	79.1	Confident	76.7	Confident	59 Å²	59	98.7 Å²	98.7	26%	0.259	53%	0.529	S	S	.	.	H	α-helix	trans	-67	-47.4	175.4	-177.6	-100.8	0	111.7	F4 L5 L10 G11 N12	F4-F8 VanDerWaalsContact O-CB 3.22Å; F4-F8 WeakPolarHBondContact O-CB 3.23Å; F4-F8 PolarHBondContact O-N 2.82Å; L5-F8 PolarHBondContact O-N 3.07Å; F8-L10 PolarHBondContact O-N 3.38Å; F8-G11 PolarHBondContact O-N 3.32Å; F8-N12 WeakPolarHBondContact CD1-ND2 3.34Å; F8-N12 VanDerWaalsContact CE1-ND2 3.29Å; F8-N12 WeakPolarHBondContact CE1-ND2 3.22Å; F8-N12 WeakPolarHBondContact CE2-ND2 3.29Å; F8-N12 WeakPolarHBondContact CZ-ND2 3.48Å; F8-N12 PolarHBondContact O-N 3.44Å; F8-N12 PolarHBondContact O-ND2 2.94Å
9	T	77.1	Confident	76.3	Confident	70 Å²	70	95.5 Å²	95.5	43%	0.429	52%	0.518	S	S	.	.	H	α-helix	trans	-60.9	-44.5	177.5	-62.2	0	0	111.2	L5 L6 N12 V13	L5-T9 WeakPolarHBondContact O-CB 3.21Å; L5-T9 PolarHBondContact O-N 2.9Å; L5-T9 PolarHBondContact O-OG1 2.97Å; L6-T9 PolarHBondContact O-N 2.91Å; T9-N12 PolarHBondContact O-N 2.97Å; T9-V13 VanDerWaalsContact O-CG2 3.3Å; T9-V13 WeakPolarHBondContact O-CG2 3.3Å; T9-V13 PolarHBondContact O-N 2.89Å; T9-V13 VanDerWaalsContact O-N 3.1Å
10	L	83.1	Confident	75.7	Confident	105 Å²	105	98 Å²	98	55%	0.55	53%	0.526	S	S	.	.	H	α-helix	trans	-67.3	-41.1	177.8	-69.8	172.8	0	111.9	L6 F8 N12 V13 V14	L6-L10 HydrophobicContact CG-CD1 4.18Å; L6-L10 WeakPolarHBondContact O-CB 3.42Å; L6-L10 VanDerWaalsContact O-CG 3.23Å; L6-L10 WeakPolarHBondContact O-CG 3.3Å; L6-L10 PolarHBondContact O-N 2.91Å; F8-L10 PolarHBondContact O-N 3.38Å; L10-N12 VanDerWaalsContact C-N 3.34Å; L10-N12 PolarHBondContact O-N 3.1Å; L10-V13 PolarHBondContact O-N 3.35Å; L10-V14 WeakPolarHBondContact O-CB 3.32Å; L10-V14 VanDerWaalsContact O-CG2 3.3Å; L10-V14 WeakPolarHBondContact O-CG2 3.24Å; L10-V14 PolarHBondContact O-N 3.37Å
11	G	80.3	Confident	75.4	Confident	45 Å²	45	97.8 Å²	97.8	46%	0.464	53%	0.525	S	S	.	.	H	α-helix	trans	-62.6	-36.5	176	0	0	0	113.7	G7 F8 G15	G7-G11 PolarHBondContact O-N 3.46Å; F8-G11 PolarHBondContact O-N 3.32Å; G11-G15 PolarHBondContact O-N 3.44Å
12	N	77.2	Confident	75.5	Confident	49 Å²	49	96.5 Å²	96.5	26%	0.262	51%	0.511	S	S	.	.	H	α-helix	trans	-71.4	-42.2	176.2	-81.9	-85.6	0	112.3	F8 T9 L10 G15 M16	F8-N12 WeakPolarHBondContact CD1-ND2 3.34Å; F8-N12 VanDerWaalsContact CE1-ND2 3.29Å; F8-N12 WeakPolarHBondContact CE1-ND2 3.22Å; F8-N12 WeakPolarHBondContact CE2-ND2 3.29Å; F8-N12 WeakPolarHBondContact CZ-ND2 3.48Å; F8-N12 PolarHBondContact O-N 3.44Å; F8-N12 PolarHBondContact O-ND2 2.94Å; T9-N12 PolarHBondContact O-N 2.97Å; L10-N12 VanDerWaalsContact C-N 3.34Å; L10-N12 PolarHBondContact O-N 3.1Å; N12-G15 PolarHBondContact O-N 3.46Å; N12-M16 WeakPolarHBondContact O-CB 3.47Å; N12-M16 WeakPolarHBondContact O-CG 3.38Å; N12-M16 PolarHBondContact O-N 2.78Å
13	V	82.3	Confident	75	Confident	83 Å²	83	97.2 Å²	97.2	50%	0.503	52%	0.516	S	S	.	.	H	α-helix	trans	-64.7	-43.6	178.2	172.7	0	0	110.6	T9 L10 Y17	T9-V13 VanDerWaalsContact O-CG2 3.3Å; T9-V13 WeakPolarHBondContact O-CG2 3.3Å; T9-V13 PolarHBondContact O-N 2.89Å; T9-V13 VanDerWaalsContact O-N 3.1Å; L10-V13 PolarHBondContact O-N 3.35Å; V13-Y17 VanDerWaalsContact O-CB 3.29Å; V13-Y17 WeakPolarHBondContact O-CB 3.29Å; V13-Y17 PolarHBondContact O-N 3.43Å
14	V	80.7	Confident	74.6	Confident	82 Å²	82	93.3 Å²	93.3	50%	0.497	52%	0.517	S	S	.	.	H	α-helix	trans	-67.2	-41	176.2	172.3	0	0	111.3	L10 Y17 L18	L10-V14 WeakPolarHBondContact O-CB 3.32Å; L10-V14 VanDerWaalsContact O-CG2 3.3Å; L10-V14 WeakPolarHBondContact O-CG2 3.24Å; L10-V14 PolarHBondContact O-N 3.37Å; V14-Y17 PolarHBondContact O-N 3.43Å; V14-L18 HydrophobicContact CG1-CD1 3.53Å; V14-L18 HydrophobicContact CG1-CG 4.43Å; V14-L18 WeakPolarHBondContact O-CB 3.48Å; V14-L18 VanDerWaalsContact O-CD1 3.32Å; V14-L18 WeakPolarHBondContact O-CD1 3.38Å; V14-L18 WeakPolarHBondContact O-CG 3.34Å; V14-L18 PolarHBondContact O-N 3.47Å
15	G	76.3	Confident	73.8	Confident	28 Å²	28	91.1 Å²	91.1	29%	0.289	51%	0.512	S	S	.	.	H	α-helix	trans	-62.3	-41.7	177	0	0	0	113.4	G11 N12 A19	G11-G15 PolarHBondContact O-N 3.44Å; N12-G15 PolarHBondContact O-N 3.46Å; G15-A19 WeakPolarHBondContact O-CB 3.38Å; G15-A19 PolarHBondContact O-N 3.2Å
16	M	73.4	Confident	73	Confident	107 Å²	107	90.3 Å²	90.3	53%	0.527	53%	0.529	S	S	.	.	H	α-helix	trans	-67	-43.1	173.1	-73.3	-171.6	-71.2	111.6	N12 L18 A19 Q20	N12-M16 WeakPolarHBondContact O-CB 3.47Å; N12-M16 WeakPolarHBondContact O-CG 3.38Å; N12-M16 PolarHBondContact O-N 2.78Å; M16-L18 VanDerWaalsContact C-N 3.3Å; M16-L18 PolarHBondContact O-N 3.26Å; M16-A19 PolarHBondContact O-N 2.95Å; M16-Q20 WeakPolarHBondContact O-CB 3.43Å; M16-Q20 VanDerWaalsContact O-CG 3.27Å; M16-Q20 WeakPolarHBondContact O-CG 3.36Å; M16-Q20 PolarHBondContact O-N 3.39Å
17	Y	76.4	Confident	72	Confident	153 Å²	153	87.8 Å²	87.8	60%	0.6	52%	0.521	S	S	*	.	H	α-helix	trans	-60.9	-42.7	178.8	-166.5	-101	0	111.2	V13 V14 Q20 N21	V13-Y17 VanDerWaalsContact O-CB 3.29Å; V13-Y17 WeakPolarHBondContact O-CB 3.29Å; V13-Y17 PolarHBondContact O-N 3.43Å; V14-Y17 PolarHBondContact O-N 3.43Å; Y17-Q20 PolarHBondContact O-N 2.74Å; Y17-N21 WeakPolarHBondContact CE1-ND2 3.28Å; Y17-N21 WeakPolarHBondContact O-CB 3.37Å; Y17-N21 PolarHBondContact O-N 3.04Å; Y17-N21 PolarHBondContact O-ND2 3.37Å
18	L	74.9	Confident	70.8	Confident	84 Å²	84	90 Å²	90	44%	0.44	53%	0.527	S	S	.	.	H	α-helix	trans	-66.8	-42	175.1	-73.6	154	0	111.9	V14 M16 Q20 N21 Y22	V14-L18 HydrophobicContact CG1-CD1 3.53Å; V14-L18 HydrophobicContact CG1-CG 4.43Å; V14-L18 WeakPolarHBondContact O-CB 3.48Å; V14-L18 VanDerWaalsContact O-CD1 3.32Å; V14-L18 WeakPolarHBondContact O-CD1 3.38Å; V14-L18 WeakPolarHBondContact O-CG 3.34Å; V14-L18 PolarHBondContact O-N 3.47Å; M16-L18 VanDerWaalsContact C-N 3.3Å; M16-L18 PolarHBondContact O-N 3.26Å; L18-Q20 VanDerWaalsContact C-N 3.29Å; L18-Q20 PolarHBondContact O-N 2.96Å; L18-N21 PolarHBondContact O-N 2.91Å; L18-Y22 HydrophobicContact CD2-CD2 4.13Å; L18-Y22 HydrophobicContact CD2-CE2 3.87Å; L18-Y22 WeakPolarHBondContact O-CB 3.35Å; L18-Y22 WeakPolarHBondContact O-CD2 3.22Å; L18-Y22 PolarHBondContact O-N 3.37Å
19	A	69.5	Low	70	Confident	39 Å²	39	89.8 Å²	89.8	32%	0.322	53%	0.533	S	S	.	.	H	α-helix	trans	-61.7	-37.4	177.6	0	0	0	112.5	G15 M16	G15-A19 WeakPolarHBondContact O-CB 3.38Å; G15-A19 PolarHBondContact O-N 3.2Å; M16-A19 PolarHBondContact O-N 2.95Å
20	Q	64.2	Low	69.2	Low	144 Å²	144	91.5 Å²	91.5	67%	0.673	54%	0.543	S	S	*	.	H	α-helix	trans	-78.4	-31.7	-179.9	-69.9	179	-47.5	113.6	M16 Y17 L18	M16-Q20 WeakPolarHBondContact O-CB 3.43Å; M16-Q20 VanDerWaalsContact O-CG 3.27Å; M16-Q20 WeakPolarHBondContact O-CG 3.36Å; M16-Q20 PolarHBondContact O-N 3.39Å; Y17-Q20 PolarHBondContact O-N 2.74Å; L18-Q20 VanDerWaalsContact C-N 3.29Å; L18-Q20 PolarHBondContact O-N 2.96Å
21	N	70.3	Confident	68.2	Low	94 Å²	94	90.7 Å²	90.7	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-86.2	-15.1	179.7	-75.4	-84.7	0	112.7	Y17 L18	Y17-N21 WeakPolarHBondContact CE1-ND2 3.28Å; Y17-N21 WeakPolarHBondContact O-CB 3.37Å; Y17-N21 PolarHBondContact O-N 3.04Å; Y17-N21 PolarHBondContact O-ND2 3.37Å; L18-N21 PolarHBondContact O-N 2.91Å
22	Y	66.6	Low	67.2	Low	164 Å²	164	94.7 Å²	94.7	64%	0.643	55%	0.552	S	S	*	*			trans	-127.7	49.4	-178.9	-65	-88	0	111.7	L18 G24	L18-Y22 HydrophobicContact CD2-CD2 4.13Å; L18-Y22 HydrophobicContact CD2-CE2 3.87Å; L18-Y22 WeakPolarHBondContact O-CB 3.35Å; L18-Y22 WeakPolarHBondContact O-CD2 3.22Å; L18-Y22 PolarHBondContact O-N 3.37Å; Y22-G24 PolarHBondContact O-N 3.02Å
23	D	62	Low	66.7	Low	150 Å²	150	93.8 Å²	93.8	80%	0.802	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.7	9.1	-173.3	-153.7	-108.5	0	116.5
24	G	61.8	Low	65.7	Low	74 Å²	74	91.8 Å²	91.8	76%	0.763	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.8	8.8	-178.3	0	0	0	116.1	Y22	Y22-G24 PolarHBondContact O-N 3.02Å
25	I	56.5	Low	65	Low	124 Å²	124	92.1 Å²	92.1	64%	0.636	55%	0.55	S	S	*	*	S	Bend	trans	-132.9	106.2	177.7	-38.9	177.4	0	107.2	S27	I25-S27 WeakPolarHBondContact CB-OG 3.19Å; I25-S27 WeakPolarHBondContact CG2-OG 3.21Å; I25-S27 WeakPolarHBondContact O-CA 3.24Å; I25-S27 VanDerWaalsContact O-CB 3.22Å; I25-S27 WeakPolarHBondContact O-CB 3.5Å; I25-S27 PolarHBondContact O-N 2.87Å; I25-S27 PolarHBondContact O-OG 3.39Å
26	G	61.3	Low	64.6	Low	90 Å²	90	96.3 Å²	96.3	93%	0.928	56%	0.562	S	S	*	*			trans	-55.9	84.7	169.1	0	0	0	110.1
27	S	57.6	Low	64.2	Low	55 Å²	55	100.2 Å²	100.2	39%	0.385	57%	0.571	S	S	.	*			trans	-108.2	117.4	-157.6	-71.3	0	0	110.4	I25 S29	I25-S27 WeakPolarHBondContact CB-OG 3.19Å; I25-S27 WeakPolarHBondContact CG2-OG 3.21Å; I25-S27 WeakPolarHBondContact O-CA 3.24Å; I25-S27 VanDerWaalsContact O-CB 3.22Å; I25-S27 WeakPolarHBondContact O-CB 3.5Å; I25-S27 PolarHBondContact O-N 2.87Å; I25-S27 PolarHBondContact O-OG 3.39Å; S27-S29 PolarHBondContact O-N 3.08Å; S27-S29 PolarHBondContact O-OG 3.27Å; S27-S29 VanDerWaalsContact O-OG 3.11Å
28	P	57.2	Low	63.6	Low	91 Å²	91	102.7 Å²	102.7	59%	0.591	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.2	4.5	-171.4	23	-34.3	0	116.5	V30 S31 Q32	P28-V30 VanDerWaalsContact C-N 3.33Å; P28-V30 PolarHBondContact O-N 3.11Å; P28-S31 PolarHBondContact O-N 3.2Å; P28-Q32 VanDerWaalsContact O-CB 3.24Å; P28-Q32 WeakPolarHBondContact O-CB 3.45Å; P28-Q32 PolarHBondContact O-N 3.46Å
29	S	62.4	Low	63.2	Low	55 Å²	55	103.4 Å²	103.4	39%	0.385	58%	0.584	S	S	.	*	H	α-helix	trans	-53.3	-41.6	172.3	59.8	0	0	114	S27 A33	S27-S29 PolarHBondContact O-N 3.08Å; S27-S29 PolarHBondContact O-OG 3.27Å; S27-S29 VanDerWaalsContact O-OG 3.11Å; S29-A33 VanDerWaalsContact O-CB 3.28Å; S29-A33 WeakPolarHBondContact O-CB 3.44Å; S29-A33 PolarHBondContact O-N 3.23Å
30	V	60	Low	63.1	Low	105 Å²	105	106.3 Å²	106.3	64%	0.636	59%	0.593	S	S	*	*	H	α-helix	trans	-73.5	-38.3	177.5	176	0	0	111.4	P28 G34	P28-V30 VanDerWaalsContact C-N 3.33Å; P28-V30 PolarHBondContact O-N 3.11Å; V30-G34 PolarHBondContact O-N 2.73Å; V30-G34 VanDerWaalsContact O-N 3.11Å
31	S	60.5	Low	62.9	Low	88 Å²	88	101.4 Å²	101.4	62%	0.615	58%	0.582	S	S	*	*	H	α-helix	trans	-70.3	-34.8	177.2	-51.7	0	0	112.3	P28 G34 V35	P28-S31 PolarHBondContact O-N 3.2Å; S31-G34 PolarHBondContact O-N 2.98Å; S31-V35 WeakPolarHBondContact O-CG2 3.27Å; S31-V35 PolarHBondContact O-N 3.24Å; S31-V35 VanDerWaalsContact O-N 3.17Å
32	Q	59.8	Low	62.6	Low	129 Å²	129	100.3 Å²	100.3	60%	0.603	58%	0.582	S	S	*	*	H	α-helix	trans	-79.2	-33.6	178.9	-165.1	170.3	26.9	112.5	P28 G34 V35 Q36	P28-Q32 VanDerWaalsContact O-CB 3.24Å; P28-Q32 WeakPolarHBondContact O-CB 3.45Å; P28-Q32 PolarHBondContact O-N 3.46Å; Q32-G34 PolarHBondContact O-N 2.84Å; Q32-V35 PolarHBondContact O-N 3.03Å; Q32-Q36 PolarHBondContact O-N 3.26Å
33	A	66.8	Low	62.4	Low	30 Å²	30	99.6 Å²	99.6	25%	0.248	59%	0.588	C	S	.	*	H	α-helix	trans	-61	-34.7	165.9	0	0	0	111.4	S29 W37	S29-A33 VanDerWaalsContact O-CB 3.28Å; S29-A33 WeakPolarHBondContact O-CB 3.44Å; S29-A33 PolarHBondContact O-N 3.23Å; A33-W37 PolarHBondContact O-N 3.11Å
34	G	61.8	Low	62.2	Low	41 Å²	41	100.4 Å²	100.4	42%	0.423	59%	0.587	S	S	.	*	H	α-helix	trans	-65.5	-37.9	172.8	0	0	0	114.3	V30 S31 Q32 W38	V30-G34 PolarHBondContact O-N 2.73Å; V30-G34 VanDerWaalsContact O-N 3.11Å; S31-G34 PolarHBondContact O-N 2.98Å; Q32-G34 PolarHBondContact O-N 2.84Å; G34-W38 PolarHBondContact O-N 3.4Å
35	V	64.9	Low	61.6	Low	89 Å²	89	107.2 Å²	107.2	54%	0.539	61%	0.605	S	S	.	*	H	α-helix	trans	-70.1	-43.1	175.5	174.9	0	0	111.1	S31 Q32 W37 W38 D39	S31-V35 WeakPolarHBondContact O-CG2 3.27Å; S31-V35 PolarHBondContact O-N 3.24Å; S31-V35 VanDerWaalsContact O-N 3.17Å; Q32-V35 PolarHBondContact O-N 3.03Å; V35-W37 VanDerWaalsContact C-N 3.26Å; V35-W37 PolarHBondContact O-N 3.17Å; V35-W38 PolarHBondContact O-N 3.44Å; V35-D39 PolarHBondContact O-N 3.34Å
36	Q	69.3	Low	61.9	Low	117 Å²	117	106.4 Å²	106.4	55%	0.547	60%	0.603	S	S	.	*	H	α-helix	trans	-64.9	-25.9	178.3	-89.4	-176.7	-50.6	114.2	Q32	Q32-Q36 PolarHBondContact O-N 3.26Å
37	W	64.3	Low	61.9	Low	189 Å²	189	107.2 Å²	107.2	72%	0.716	59%	0.586	S	S	*	*	H	α-helix	trans	-80.9	-34.9	175.8	-127.6	46.9	0	112.7	A33 V35 L40 G41	A33-W37 PolarHBondContact O-N 3.11Å; V35-W37 VanDerWaalsContact C-N 3.26Å; V35-W37 PolarHBondContact O-N 3.17Å; W37-L40 PolarHBondContact O-N 3.11Å; W37-G41 PolarHBondContact O-N 3.3Å; W37-G41 VanDerWaalsContact O-N 3.08Å
38	W	64.4	Low	62.1	Low	204 Å²	204	110.1 Å²	110.1	77%	0.773	60%	0.597	S	S	*	*	H	α-helix	trans	-63	-46.8	176.9	-161.6	-52.2	0	111.2	G34 V35 L40 G41 S42	G34-W38 PolarHBondContact O-N 3.4Å; V35-W38 PolarHBondContact O-N 3.44Å; W38-L40 VanDerWaalsContact C-N 3.3Å; W38-L40 PolarHBondContact O-N 3.26Å; W38-G41 PolarHBondContact O-N 3.24Å; W38-S42 PolarHBondContact O-N 3.28Å; W38-S42 VanDerWaalsContact O-N 3.11Å; W38-S42 PolarHBondContact O-OG 2.69Å
39	D	66.4	Low	62.4	Low	100 Å²	100	111.2 Å²	111.2	54%	0.535	60%	0.598	S	S	.	*	H	α-helix	trans	-66.8	-29.8	178.3	-74.9	-54.7	0	113.1	V35 S42 L43	V35-D39 PolarHBondContact O-N 3.34Å; D39-S42 PolarHBondContact O-N 2.94Å; D39-L43 PolarHBondContact O-N 2.75Å
40	L	66.8	Low	62.4	Low	99 Å²	99	114.8 Å²	114.8	52%	0.518	61%	0.611	S	S	.	*	H	α-helix	trans	-74.6	-28.5	176	-147	74.8	0	112.8	W37 W38	W37-L40 PolarHBondContact O-N 3.11Å; W38-L40 VanDerWaalsContact C-N 3.3Å; W38-L40 PolarHBondContact O-N 3.26Å
41	G	60.3	Low	62.6	Low	42 Å²	42	115.4 Å²	115.4	43%	0.433	61%	0.609	S	S	.	*	H	α-helix	trans	-75.6	-27.8	171.8	0	0	0	113.4	W37 W38 L43 Q44	W37-G41 PolarHBondContact O-N 3.3Å; W37-G41 VanDerWaalsContact O-N 3.08Å; W38-G41 PolarHBondContact O-N 3.24Å; G41-L43 VanDerWaalsContact C-N 3.31Å; G41-Q44 PolarHBondContact O-N 2.67Å
42	S	64.6	Low	62.7	Low	71 Å²	71	117.4 Å²	117.4	50%	0.497	61%	0.609	S	S	.	*	H	α-helix	trans	-76.3	-14.2	173.9	-62.6	0	0	114.2	W38 D39	W38-S42 PolarHBondContact O-N 3.28Å; W38-S42 VanDerWaalsContact O-N 3.11Å; W38-S42 PolarHBondContact O-OG 2.69Å; D39-S42 PolarHBondContact O-N 2.94Å
43	L	61.1	Low	63	Low	149 Å²	149	116.5 Å²	116.5	78%	0.78	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-5.2	172.9	-104.5	121.5	0	113.7	D39 G41	D39-L43 PolarHBondContact O-N 2.75Å; G41-L43 VanDerWaalsContact C-N 3.31Å
44	Q	59.3	Low	62.7	Low	167 Å²	167	123.7 Å²	123.7	78%	0.78	64%	0.639	S	S	*	*			trans	-112.8	11	-179.9	-64.7	-179.4	41.2	113.4	G41	G41-Q44 PolarHBondContact O-N 2.67Å
45	L	48.8	Very low	62.7	Low	216 Å²	216	131.2 Å²	131.2	100%	1.131	66%	0.659	S	S	*	*			trans	-126.8	0	178.2	-152.7	137.3	0	110.8

Retrieved 45 of 45 residues in 8.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).