A0A096LP98_HUMAN Loading...

Vestigial like family member 4

AlphaFold DB , UniProt , Accession A0A096LP98, Species HUMAN (Homo sapiens, Human), Gene VGLL4, Length 59 aa.

						>A0A096LP98_HUMAN|A0A096LP98|VGLL4
METPLDVLSRAASLVHADDEKREAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKFS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	81.6	Confident	90.3	Very high	232 Å²	232	115.7 Å²	115.7	100%	1.143	62%	0.617	S	S	*	*				0	113.4	0	-62	-56.9	-75.7	0	0	106.3
2	E	86.2	Confident	89.6	Confident	155 Å²	155	109.5 Å²	109.5	72%	0.724	59%	0.594	S	S	*	*			trans	-65.4	139.2	173.5	-65.4	-177.8	137.6	0	0	108.8
3	T	95.7	Very high	88.7	Confident	64 Å²	64	106.5 Å²	106.5	39%	0.393	59%	0.586	S	S	.	*			trans	-80.6	155	177.8	74.7	0	0	0	0	109.9	L5 D6 V7	T3-L5 PolarHBondContact O-N 3.32Å; T3-L5 VanDerWaalsContact O-N 3.15Å; T3-D6 VanDerWaalsContact CB-OD2 3.29Å; T3-D6 WeakPolarHBondContact CB-OD2 3.19Å; T3-D6 WeakPolarHBondContact CG2-OD2 3.14Å; T3-D6 PolarHBondContact N-OD2 3.01Å; T3-D6 WeakPolarHBondContact O-CB 3.24Å; T3-D6 PolarHBondContact O-N 3.01Å; T3-D6 PolarHBondContact OG1-N 3.22Å; T3-D6 PolarHBondContact OG1-OD1 3.26Å; T3-D6 PolarHBondContact OG1-OD2 3.4Å; T3-V7 PolarHBondContact O-N 2.82Å
4	P	95.7	Very high	87.9	Confident	106 Å²	106	108.3 Å²	108.3	69%	0.688	59%	0.593	S	S	*	*	H	α-helix	trans	-55.8	-30.6	173.8	-27.5	35.9	0	0	0	113.6	L8	P4-L8 WeakPolarHBondContact O-CG 3.22Å; P4-L8 PolarHBondContact O-N 2.96Å
5	L	93.1	Very high	86.9	Confident	124 Å²	124	108 Å²	108	65%	0.649	60%	0.596	S	S	*	*	H	α-helix	trans	-70	-35.8	177.2	-68.8	177.1	0	0	0	112.5	T3 V7 L8 S9	T3-L5 PolarHBondContact O-N 3.32Å; T3-L5 VanDerWaalsContact O-N 3.15Å; L5-V7 VanDerWaalsContact C-N 3.31Å; L5-V7 PolarHBondContact O-N 3.44Å; L5-L8 PolarHBondContact O-N 2.92Å; L5-S9 WeakPolarHBondContact O-CB 3.44Å; L5-S9 PolarHBondContact O-N 3.15Å; L5-S9 PolarHBondContact O-OG 2.7Å
6	D	91.7	Very high	85.6	Confident	86 Å²	86	107.4 Å²	107.4	46%	0.46	59%	0.587	S	S	.	*	H	α-helix	trans	-65.2	-39.1	178.3	-58.4	-41.3	0	0	0	110.8	T3 S9 R10	T3-D6 VanDerWaalsContact CB-OD2 3.29Å; T3-D6 WeakPolarHBondContact CB-OD2 3.19Å; T3-D6 WeakPolarHBondContact CG2-OD2 3.14Å; T3-D6 PolarHBondContact N-OD2 3.01Å; T3-D6 WeakPolarHBondContact O-CB 3.24Å; T3-D6 PolarHBondContact O-N 3.01Å; T3-D6 PolarHBondContact OG1-N 3.22Å; T3-D6 PolarHBondContact OG1-OD1 3.26Å; T3-D6 PolarHBondContact OG1-OD2 3.4Å; D6-S9 PolarHBondContact O-N 2.78Å; D6-R10 WeakPolarHBondContact O-CB 3.33Å; D6-R10 PolarHBondContact O-N 3.42Å
7	V	93.6	Very high	84.1	Confident	83 Å²	83	104.1 Å²	104.1	50%	0.503	58%	0.577	S	S	.	*	H	α-helix	trans	-66	-45.1	176.9	179.3	0	0	0	0	111.2	T3 L5 R10 A11	T3-V7 PolarHBondContact O-N 2.82Å; L5-V7 VanDerWaalsContact C-N 3.31Å; L5-V7 PolarHBondContact O-N 3.44Å; V7-R10 PolarHBondContact O-N 2.75Å; V7-A11 WeakPolarHBondContact O-CB 3.32Å; V7-A11 PolarHBondContact O-N 2.59Å
8	L	90.9	Very high	82.8	Confident	117 Å²	117	106.2 Å²	106.2	61%	0.613	59%	0.587	S	S	*	*	H	α-helix	trans	-63.5	-41.8	176.8	-71.7	171	0	0	0	111.9	P4 L5 A11 A12	P4-L8 WeakPolarHBondContact O-CG 3.22Å; P4-L8 PolarHBondContact O-N 2.96Å; L5-L8 PolarHBondContact O-N 2.92Å; L8-A11 PolarHBondContact O-N 2.88Å; L8-A12 WeakPolarHBondContact O-CB 3.15Å; L8-A12 PolarHBondContact O-N 2.79Å
9	S	87.4	Confident	81.6	Confident	72 Å²	72	105.1 Å²	105.1	50%	0.503	58%	0.58	S	S	.	*	H	α-helix	trans	-63.5	-43.5	178.1	-57	0	0	0	0	111.2	L5 D6 A12 S13	L5-S9 WeakPolarHBondContact O-CB 3.44Å; L5-S9 PolarHBondContact O-N 3.15Å; L5-S9 PolarHBondContact O-OG 2.7Å; D6-S9 PolarHBondContact O-N 2.78Å; S9-A12 WeakPolarHBondContact O-CB 3.37Å; S9-A12 PolarHBondContact O-N 2.87Å; S9-S13 PolarHBondContact O-N 2.87Å; S9-S13 PolarHBondContact O-OG 2.71Å
10	R	89.1	Confident	80.5	Confident	184 Å²	184	106.6 Å²	106.6	69%	0.694	58%	0.583	S	S	*	*	H	α-helix	trans	-64.8	-39.9	176	-170.7	-178.8	-177.6	111.5	3.1	112.4	D6 V7 A12 S13 L14	D6-R10 WeakPolarHBondContact O-CB 3.33Å; D6-R10 PolarHBondContact O-N 3.42Å; V7-R10 PolarHBondContact O-N 2.75Å; R10-A12 VanDerWaalsContact C-N 3.35Å; R10-S13 PolarHBondContact O-N 2.81Å; R10-L14 PolarHBondContact O-N 2.89Å
11	A	87.9	Confident	79.5	Confident	50 Å²	50	109.6 Å²	109.6	41%	0.413	59%	0.59	S	S	.	*	H	α-helix	trans	-65.1	-38.9	174.7	0	0	0	0	0	111.8	V7 L8 L14 V15	V7-A11 WeakPolarHBondContact O-CB 3.32Å; V7-A11 PolarHBondContact O-N 2.59Å; L8-A11 PolarHBondContact O-N 2.88Å; A11-L14 PolarHBondContact O-N 2.74Å; A11-V15 PolarHBondContact O-N 2.89Å
12	A	82.9	Confident	78.3	Confident	41 Å²	41	106.1 Å²	106.1	34%	0.339	56%	0.564	S	S	.	*	H	α-helix	trans	-63	-41.5	174.7	0	0	0	0	0	111.9	L8 S9 R10 L14 V15 H16	L8-A12 WeakPolarHBondContact O-CB 3.15Å; L8-A12 PolarHBondContact O-N 2.79Å; S9-A12 WeakPolarHBondContact O-CB 3.37Å; S9-A12 PolarHBondContact O-N 2.87Å; R10-A12 VanDerWaalsContact C-N 3.35Å; A12-L14 VanDerWaalsContact C-N 3.27Å; A12-L14 PolarHBondContact O-N 2.94Å; A12-V15 WeakPolarHBondContact O-CG2 3.18Å; A12-V15 PolarHBondContact O-N 2.68Å; A12-H16 PolarHBondContact O-CD2 2.91Å; A12-H16 PolarHBondContact O-N 2.91Å
13	S	77.8	Confident	77	Confident	70 Å²	70	102.3 Å²	102.3	49%	0.49	55%	0.547	S	S	.	.	H	α-helix	trans	-61.4	-34.3	175.9	-61.9	0	0	0	0	113.1	S9 R10 H16 A17	S9-S13 PolarHBondContact O-N 2.87Å; S9-S13 PolarHBondContact O-OG 2.71Å; R10-S13 PolarHBondContact O-N 2.81Å; S13-H16 PolarHBondContact O-N 3.29Å; S13-A17 WeakPolarHBondContact O-CB 3.07Å; S13-A17 PolarHBondContact O-N 2.91Å
14	L	76.9	Confident	75.2	Confident	132 Å²	132	102.4 Å²	102.4	69%	0.691	55%	0.554	S	S	*	*	H	α-helix	trans	-68.9	-31.4	178	-75.4	155.5	0	0	0	113	R10 A11 A12	R10-L14 PolarHBondContact O-N 2.89Å; A11-L14 PolarHBondContact O-N 2.74Å; A12-L14 VanDerWaalsContact C-N 3.27Å; A12-L14 PolarHBondContact O-N 2.94Å
15	V	73.4	Confident	73.5	Confident	104 Å²	104	101.4 Å²	101.4	63%	0.63	56%	0.555	S	S	*	*	H	α-helix	trans	-82.2	-21.8	177.8	-57.4	0	0	0	0	112.9	A11 A12	A11-V15 PolarHBondContact O-N 2.89Å; A12-V15 WeakPolarHBondContact O-CG2 3.18Å; A12-V15 PolarHBondContact O-N 2.68Å
16	H	65.7	Low	71.7	Confident	99 Å²	99	101 Å²	101	46%	0.458	55%	0.552	S	S	.	*	H	α-helix	trans	-103.7	-0.9	179.5	-61.5	-56.4	0	0	0	113.9	A12 S13 D18 D19 E20	A12-H16 PolarHBondContact O-CD2 2.91Å; A12-H16 PolarHBondContact O-N 2.91Å; S13-H16 PolarHBondContact O-N 3.29Å; H16-D18 VanDerWaalsContact C-N 3.27Å; H16-D18 PolarHBondContact O-N 3.39Å; H16-D19 PolarHBondContact O-N 3.47Å; H16-D19 VanDerWaalsContact O-N 3.08Å; H16-E20 PolarHBondContact O-N 3.27Å
17	A	60.3	Low	70.1	Confident	51 Å²	51	104.7 Å²	104.7	42%	0.421	56%	0.56	S	S	.	*	H	α-helix	trans	-59.5	-33.5	-176.6	0	0	0	0	0	113.7	S13	S13-A17 WeakPolarHBondContact O-CB 3.07Å; S13-A17 PolarHBondContact O-N 2.91Å
18	D	59.7	Low	68.6	Low	142 Å²	142	104.3 Å²	104.3	76%	0.759	57%	0.573	S	S	*	*	H	α-helix	trans	-77.3	-33.3	175.9	-83.7	-54.8	0	0	0	112.5	H16 R22	H16-D18 VanDerWaalsContact C-N 3.27Å; H16-D18 PolarHBondContact O-N 3.39Å; D18-R22 VanDerWaalsContact O-CB 3.32Å; D18-R22 WeakPolarHBondContact O-CB 3.41Å; D18-R22 PolarHBondContact O-N 2.91Å
19	D	60.8	Low	67.2	Low	84 Å²	84	105.3 Å²	105.3	45%	0.449	57%	0.574	S	S	.	*	H	α-helix	trans	-72	-40	176.9	-86.3	-40.6	0	0	0	111.7	H16 K21 R22 E23	H16-D19 PolarHBondContact O-N 3.47Å; H16-D19 VanDerWaalsContact O-N 3.08Å; D19-K21 VanDerWaalsContact C-N 3.34Å; D19-K21 PolarHBondContact O-N 3.05Å; D19-R22 PolarHBondContact O-N 2.96Å; D19-E23 WeakPolarHBondContact O-CB 3.49Å; D19-E23 WeakPolarHBondContact O-CG 3.37Å; D19-E23 PolarHBondContact O-N 2.75Å
20	E	59.9	Low	65.9	Low	136 Å²	136	106.5 Å²	106.5	64%	0.636	58%	0.58	S	S	*	*	H	α-helix	trans	-61.6	-41.3	179.1	-72.3	-168.3	144.2	0	0	112.6	H16 A24	H16-E20 PolarHBondContact O-N 3.27Å; E20-A24 WeakPolarHBondContact O-CB 3.4Å; E20-A24 PolarHBondContact O-N 3.21Å
21	K	58.2	Low	64.7	Low	169 Å²	169	109.2 Å²	109.2	74%	0.735	59%	0.591	S	S	*	*	H	α-helix	trans	-71	-36.4	179	-154.6	-170.6	-172.3	-160.8	0	111.7	D19 A25	D19-K21 VanDerWaalsContact C-N 3.34Å; D19-K21 PolarHBondContact O-N 3.05Å; K21-A25 WeakPolarHBondContact O-CB 3.39Å; K21-A25 PolarHBondContact O-N 3.39Å; K21-A25 VanDerWaalsContact O-N 3.13Å
22	R	57.1	Low	63.1	Low	159 Å²	159	113.4 Å²	113.4	60%	0.6	61%	0.605	S	S	*	*	H	α-helix	trans	-68.4	-49	174.8	178	-175.4	169.4	104.6	1.2	111.2	D18 D19 A24 A25 L26	D18-R22 VanDerWaalsContact O-CB 3.32Å; D18-R22 WeakPolarHBondContact O-CB 3.41Å; D18-R22 PolarHBondContact O-N 2.91Å; D19-R22 PolarHBondContact O-N 2.96Å; R22-A24 VanDerWaalsContact C-N 3.35Å; R22-A24 PolarHBondContact O-N 3.13Å; R22-A25 PolarHBondContact O-N 3.22Å; R22-L26 HydrophobicContact CG-CD1 3.84Å; R22-L26 HydrophobicContact CG-CG 4.49Å; R22-L26 WeakPolarHBondContact O-CB 3.42Å; R22-L26 WeakPolarHBondContact O-CG 3.42Å; R22-L26 PolarHBondContact O-N 3.28Å
23	E	58.9	Low	62	Low	76 Å²	76	119.5 Å²	119.5	36%	0.355	63%	0.626	S	S	.	*	H	α-helix	trans	-63.6	-38.4	178.5	-73.6	-70	121.2	0	0	111.7	D19 L26 R27	D19-E23 WeakPolarHBondContact O-CB 3.49Å; D19-E23 WeakPolarHBondContact O-CG 3.37Å; D19-E23 PolarHBondContact O-N 2.75Å; E23-L26 PolarHBondContact O-N 2.87Å; E23-R27 WeakPolarHBondContact O-CB 3.42Å; E23-R27 WeakPolarHBondContact O-CG 3.29Å; E23-R27 PolarHBondContact O-N 3.15Å; E23-R27 IonicContact OE2-CZ 3.8Å; E23-R27 IonicContact OE2-NH1 3.87Å; E23-R27 IonicContact OE2-NH2 3.29Å; E23-R27 PolarHBondContact OE2-NH2 3.37Å
24	A	58.7	Low	61.2	Low	66 Å²	66	121.8 Å²	121.8	55%	0.545	64%	0.637	S	S	.	*	H	α-helix	trans	-67.7	-35.3	173.8	0	0	0	0	0	113.1	E20 R22	E20-A24 WeakPolarHBondContact O-CB 3.4Å; E20-A24 PolarHBondContact O-N 3.21Å; R22-A24 VanDerWaalsContact C-N 3.35Å; R22-A24 PolarHBondContact O-N 3.13Å
25	A	58.4	Low	60.5	Low	85 Å²	85	121.9 Å²	121.9	70%	0.702	64%	0.638	S	S	*	*	H	α-helix	trans	-73.4	-28.7	174.5	0	0	0	0	0	112.9	K21 R22	K21-A25 WeakPolarHBondContact O-CB 3.39Å; K21-A25 PolarHBondContact O-N 3.39Å; K21-A25 VanDerWaalsContact O-N 3.13Å; R22-A25 PolarHBondContact O-N 3.22Å
26	L	55.5	Low	59.9	Low	114 Å²	114	122.6 Å²	122.6	60%	0.597	65%	0.645	S	S	*	*	H	α-helix	trans	-83.3	-22.6	175.9	-68.3	171.9	0	0	0	113.1	R22 E23 G28	R22-L26 HydrophobicContact CG-CD1 3.84Å; R22-L26 HydrophobicContact CG-CG 4.49Å; R22-L26 WeakPolarHBondContact O-CB 3.42Å; R22-L26 WeakPolarHBondContact O-CG 3.42Å; R22-L26 PolarHBondContact O-N 3.28Å; E23-L26 PolarHBondContact O-N 2.87Å; L26-G28 PolarHBondContact O-N 3.33Å
27	R	59.2	Low	59.8	Low	164 Å²	164	123.5 Å²	123.5	62%	0.619	66%	0.657	S	S	*	*			trans	-74.2	48.4	172.9	-80	-178.3	179	96.1	21.1	112.5	E23 E29	E23-R27 WeakPolarHBondContact O-CB 3.42Å; E23-R27 WeakPolarHBondContact O-CG 3.29Å; E23-R27 PolarHBondContact O-N 3.15Å; E23-R27 IonicContact OE2-CZ 3.8Å; E23-R27 IonicContact OE2-NH1 3.87Å; E23-R27 IonicContact OE2-NH2 3.29Å; E23-R27 PolarHBondContact OE2-NH2 3.37Å; R27-E29 PolarHBondContact O-N 3.08Å
28	G	62.6	Low	59.8	Low	75 Å²	75	125.8 Å²	125.8	77%	0.773	68%	0.675	S	S	*	*			trans	-63.1	44.7	169.1	0	0	0	0	0	113.9	L26	L26-G28 PolarHBondContact O-N 3.33Å
29	E	61.4	Low	59.7	Low	138 Å²	138	122.6 Å²	122.6	65%	0.645	66%	0.664	S	S	*	*			trans	-87.6	124.2	178.7	-101	-72.6	162.7	0	0	109.1	R27 R31	R27-E29 PolarHBondContact O-N 3.08Å; E29-R31 PolarHBondContact O-N 3.21Å
30	P	59.7	Low	59.7	Low	98 Å²	98	123.2 Å²	123.2	64%	0.636	68%	0.681	S	S	*	*			trans	-59.1	107.3	169.8	25.1	-32.2	0	0	0	108	I32	P30-I32 VanDerWaalsContact C-N 3.34Å; P30-I32 PolarHBondContact O-N 3.25Å
31	R	63.3	Low	59.6	Low	241 Å²	241	123.9 Å²	123.9	91%	0.909	69%	0.688	S	S	*	*			trans	-26.9	92	172.2	55.1	-165.5	-77.9	-169.7	-1.4	111.2	E29 Q33	E29-R31 PolarHBondContact O-N 3.21Å; R31-Q33 PolarHBondContact O-N 2.97Å
32	I	54.3	Low	59.4	Low	138 Å²	138	120.7 Å²	120.7	71%	0.708	69%	0.687	S	S	*	*			trans	-57.7	109.5	178.9	-69.3	-67	0	0	0	105.4	P30 T34	P30-I32 VanDerWaalsContact C-N 3.34Å; P30-I32 PolarHBondContact O-N 3.25Å; I32-T34 VanDerWaalsContact C-N 3.29Å; I32-T34 PolarHBondContact O-N 3.43Å
33	Q	59.2	Low	59.4	Low	169 Å²	169	118.5 Å²	118.5	79%	0.79	70%	0.696	S	S	*	*			trans	-61.6	101.6	169.9	178.5	-179.8	74.6	0	0	104.7	R31 L35	R31-Q33 PolarHBondContact O-N 2.97Å; Q33-L35 PolarHBondContact O-N 3.18Å
34	T	61.7	Low	59.4	Low	117 Å²	117	122.3 Å²	122.3	72%	0.718	71%	0.713	S	S	*	*			trans	-57.1	109.5	176	-174.9	0	0	0	0	107.5	I32	I32-T34 VanDerWaalsContact C-N 3.29Å; I32-T34 PolarHBondContact O-N 3.43Å
35	L	63.1	Low	59.6	Low	135 Å²	135	130 Å²	130	71%	0.707	73%	0.728	S	S	*	*			trans	-55.7	139.6	171.2	-71.4	165.1	0	0	0	107.1	Q33 V37	Q33-L35 PolarHBondContact O-N 3.18Å; L35-V37 PolarHBondContact O-N 3.01Å
36	P	60.5	Low	59.6	Low	119 Å²	119	132 Å²	132	77%	0.773	73%	0.732	S	S	*	*			trans	-57.6	111.7	174.3	23.5	-30.6	0	0	0	107.6	A38	P36-A38 PolarHBondContact O-N 3.29Å
37	V	62.6	Low	59.9	Low	118 Å²	118	128.8 Å²	128.8	72%	0.715	73%	0.726	S	S	*	*			trans	-63.7	92.8	166	171.5	0	0	0	0	104.9	L35 S39	L35-V37 PolarHBondContact O-N 3.01Å; V37-S39 VanDerWaalsContact CG1-OG 3.24Å; V37-S39 WeakPolarHBondContact CG1-OG 3.49Å; V37-S39 PolarHBondContact O-N 3.4Å
38	A	60.9	Low	60.1	Low	98 Å²	98	125.4 Å²	125.4	81%	0.81	73%	0.726	S	S	*	*			trans	-65.7	74.1	157.6	0	0	0	0	0	106.5	P36 A40	P36-A38 PolarHBondContact O-N 3.29Å; A38-A40 PolarHBondContact O-N 3.32Å
39	S	57.8	Low	60.2	Low	75 Å²	75	127.1 Å²	127.1	52%	0.524	72%	0.723	S	S	.	*			trans	-64.3	94.6	153.6	-74.8	0	0	0	0	104	V37 L41	V37-S39 VanDerWaalsContact CG1-OG 3.24Å; V37-S39 WeakPolarHBondContact CG1-OG 3.49Å; V37-S39 PolarHBondContact O-N 3.4Å; S39-L41 PolarHBondContact O-N 3Å
40	A	60	Low	60.4	Low	97 Å²	97	124.8 Å²	124.8	80%	0.802	72%	0.72	S	S	*	*			trans	-52.2	78.4	139.8	0	0	0	0	0	106.3	A38 S42	A38-A40 PolarHBondContact O-N 3.32Å; A40-S42 PolarHBondContact O-N 2.78Å
41	L	58.3	Low	60.7	Low	151 Å²	151	127.4 Å²	127.4	79%	0.791	73%	0.727	S	S	*	*			trans	-63.2	90.4	160.4	-71.1	176.7	0	0	0	102.7	S39 S43	S39-L41 PolarHBondContact O-N 3Å; L41-S43 PolarHBondContact O-N 3.46Å; L41-S43 VanDerWaalsContact O-N 3.15Å
42	S	54.9	Low	60.5	Low	102 Å²	102	118.4 Å²	118.4	71%	0.713	70%	0.701	S	S	*	*			trans	-25.5	120.7	163.1	179.5	0	0	0	0	107.2	A40 H44	A40-S42 PolarHBondContact O-N 2.78Å; S42-H44 PolarHBondContact O-N 2.91Å
43	S	57	Low	60.9	Low	112 Å²	112	116 Å²	116	78%	0.783	70%	0.695	S	S	*	*			trans	-52	72.8	173.8	-65	0	0	0	0	110.3	L41 R45	L41-S43 PolarHBondContact O-N 3.46Å; L41-S43 VanDerWaalsContact O-N 3.15Å; S43-R45 PolarHBondContact O-N 3.47Å
44	H	58	Low	61	Low	156 Å²	156	113.1 Å²	113.1	72%	0.722	69%	0.693	S	S	*	*			trans	-80.2	86.1	164.6	-131.2	-19.5	0	0	0	103.5	S42 T46	S42-H44 PolarHBondContact O-N 2.91Å; H44-T46 PolarHBondContact O-N 3.27Å; H44-T46 PolarHBondContact O-OG1 3.48Å
45	R	62.3	Low	61.1	Low	228 Å²	228	115.2 Å²	115.2	86%	0.86	69%	0.692	S	S	*	*			trans	-58.6	82.4	152.5	-68	-169.7	173.4	-154.9	-0.7	106.1	S43 G47	S43-R45 PolarHBondContact O-N 3.47Å; R45-G47 PolarHBondContact O-N 3.06Å
46	T	59.3	Low	61.3	Low	128 Å²	128	117.4 Å²	117.4	79%	0.785	69%	0.691	S	S	*	*			trans	-67.3	45.1	148.5	35.3	0	0	0	0	108.7	H44	H44-T46 PolarHBondContact O-N 3.27Å; H44-T46 PolarHBondContact O-OG1 3.48Å
47	G	61.2	Low	61.9	Low	45 Å²	45	121.4 Å²	121.4	46%	0.464	70%	0.696	S	S	.	*	P	Polyproline II helix	trans	-71.3	148.1	154.8	0	0	0	0	0	106.7	R45	R45-G47 PolarHBondContact O-N 3.06Å
48	P	64.2	Low	62.1	Low	94 Å²	94	125.3 Å²	125.3	61%	0.61	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-51.3	139.3	175.3	22.5	-32	0	0	0	108.9	I51	P48-I51 HydrophobicContact CB-CD1 4.23Å; P48-I51 HydrophobicContact CB-CG1 4.33Å; P48-I51 HydrophobicContact CG-CD1 4.18Å
49	P	63.9	Low	62.2	Low	110 Å²	110	129.6 Å²	129.6	71%	0.714	73%	0.728	S	S	*	*	S	Bend	trans	-51.4	141.4	175.1	24	-33.1	0	0	0	107.8	I51	P49-I51 PolarHBondContact O-N 2.63Å
50	P	67	Low	62.4	Low	89 Å²	89	132.4 Å²	132.4	58%	0.578	74%	0.738	S	S	*	*			trans	-48.7	112.6	-165.9	17	-30.9	0	0	0	110.3	S52 K55	P50-S52 PolarHBondContact O-N 3.28Å; P50-K55 HydrophobicContact CG-CG 4.28Å
51	I	64.5	Low	62.5	Low	154 Å²	154	134.2 Å²	134.2	79%	0.79	74%	0.735	S	S	*	*			trans	-75.4	44	174.6	-39.9	171.2	0	0	0	108.3	P48 P49	P48-I51 HydrophobicContact CB-CD1 4.23Å; P48-I51 HydrophobicContact CB-CG1 4.33Å; P48-I51 HydrophobicContact CG-CD1 4.18Å; P49-I51 PolarHBondContact O-N 2.63Å
52	S	60.8	Low	62.8	Low	52 Å²	52	133.3 Å²	133.3	36%	0.364	73%	0.732	S	S	.	*			trans	-94.3	129.4	178.7	179.1	0	0	0	0	108.1	P50 S54 K55	P50-S52 PolarHBondContact O-N 3.28Å; S52-S54 PolarHBondContact O-N 3.39Å; S52-K55 PolarHBondContact O-N 3.2Å
53	P	61.2	Low	63.2	Low	88 Å²	88	135.1 Å²	135.1	57%	0.571	73%	0.733	S	S	*	*	G	3₁₀ helix	trans	-50.3	-31.9	176.9	-26.3	33.1	0	0	0	113.1	K55 R56	P53-K55 PolarHBondContact O-N 3.41Å; P53-R56 PolarHBondContact O-N 2.96Å
54	S	61.6	Low	63.6	Low	108 Å²	108	136.6 Å²	136.6	76%	0.755	73%	0.729	S	S	*	*	G	3₁₀ helix	trans	-68.6	-10.4	-178.6	-52	0	0	0	0	115	S52	S52-S54 PolarHBondContact O-N 3.39Å
55	K	63.4	Low	64	Low	160 Å²	160	135.3 Å²	135.3	70%	0.696	73%	0.73	S	S	*	*	G	3₁₀ helix	trans	-99.3	-5.1	176.7	-72.2	-81.2	-176.8	178.8	0	113.4	P50 S52 P53 K57	P50-K55 HydrophobicContact CG-CG 4.28Å; S52-K55 PolarHBondContact O-N 3.2Å; P53-K55 PolarHBondContact O-N 3.41Å; K55-K57 PolarHBondContact O-N 3.32Å
56	R	68.8	Low	64.1	Low	182 Å²	182	128.6 Å²	128.6	69%	0.687	72%	0.721	S	S	*	*	S	Bend	trans	-75.4	119.5	168.7	-72.8	-174.3	-60.8	-179.3	1.8	108.8	P53 F58	P53-R56 PolarHBondContact O-N 2.96Å; R56-F58 PolarHBondContact O-N 3.36Å
57	K	72.6	Confident	64.5	Low	203 Å²	203	128.7 Å²	128.7	88%	0.883	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-62.6	124.1	163.8	-72.6	178.1	178.4	-76.5	0	106.9	K55 S59	K55-K57 PolarHBondContact O-N 3.32Å; K57-S59 PolarHBondContact O-N 2.94Å
58	F	67	Low	64.7	Low	200 Å²	200	135.7 Å²	135.7	88%	0.877	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-63.8	126.9	174.9	-62.3	-83.6	0	0	0	108.6	R56	R56-F58 PolarHBondContact O-N 3.36Å
59	S	62	Low	64.8	Low	188 Å²	188	139.5 Å²	139.5	100%	1.315	75%	0.748	S	S	*	*			trans	-93.8	0	167.1	-179.1	0	0	0	0	109.8	K57	K57-S59 PolarHBondContact O-N 2.94Å

Retrieved 59 of 59 residues in 336.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).