A0A096LPE0_HUMAN Loading...

Ribosomal protein L13a

AlphaFold DB , UniProt , Accession A0A096LPE0, Species HUMAN (Homo sapiens, Human), Gene RPL13A, Length 48 aa.

						>A0A096LPE0_HUMAN|A0A096LPE0|RPL13A
MAEVQVLVLDGRGHLLGRLAAIVAKQAGRWWSYAVKASTFLAISTETS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41	Very low	55.2	Low	244 Å²	244	124.6 Å²	124.6	100%	1.202	70%	0.699	S	S	*	*				0	112.5	0	-61.7	-165.6	-172.7	0	0	106.7	E3	M1-E3 PolarHBondContact O-N 2.75Å
2	A	53.7	Low	55.9	Low	98 Å²	98	133.3 Å²	133.3	81%	0.81	71%	0.713	S	S	*	*			trans	-82.3	105.7	-179	0	0	0	0	0	108.2	V4	A2-V4 PolarHBondContact O-N 3.36Å
3	E	43.3	Very low	56.6	Low	178 Å²	178	128.5 Å²	128.5	83%	0.832	71%	0.714	S	S	*	*			trans	-69.1	98	175.7	-149.2	176.9	171	0	0	107.8	M1 Q5	M1-E3 PolarHBondContact O-N 2.75Å; E3-Q5 PolarHBondContact O-N 2.91Å
4	V	55.8	Low	56.9	Low	122 Å²	122	132.4 Å²	132.4	74%	0.739	72%	0.723	S	S	*	*			trans	-70.9	98.1	173.8	173.1	0	0	0	0	106.6	A2 V6	A2-V4 PolarHBondContact O-N 3.36Å; V4-V6 VanDerWaalsContact C-N 3.32Å; V4-V6 HydrophobicContact CG1-CG2 4.01Å; V4-V6 PolarHBondContact O-N 3.15Å
5	Q	57.7	Low	57.4	Low	179 Å²	179	128.7 Å²	128.7	84%	0.836	70%	0.702	S	S	*	*			trans	-69	87.8	178.3	-69.3	-172.5	87.5	0	0	109.7	E3 L7	E3-Q5 PolarHBondContact O-N 2.91Å; Q5-L7 PolarHBondContact O-N 3.03Å
6	V	55.1	Low	58	Low	113 Å²	113	127.3 Å²	127.3	69%	0.685	69%	0.693	S	S	*	*			trans	-76.6	101.2	170.6	-178.7	0	0	0	0	108.1	V4 V8	V4-V6 VanDerWaalsContact C-N 3.32Å; V4-V6 HydrophobicContact CG1-CG2 4.01Å; V4-V6 PolarHBondContact O-N 3.15Å; V6-V8 HydrophobicContact CG1-CG2 3.99Å; V6-V8 PolarHBondContact O-N 3.45Å
7	L	58.3	Low	59.1	Low	81 Å²	81	123.1 Å²	123.1	42%	0.424	69%	0.686	S	S	.	*			trans	-79.7	94.1	178.6	-174.5	67.3	0	0	0	110	Q5 L9 I22	Q5-L7 PolarHBondContact O-N 3.03Å; L7-L9 HydrophobicContact CD1-CD2 4.45Å; L7-L9 HydrophobicContact CD2-CD1 3.89Å; L7-L9 HydrophobicContact CD2-CD2 4.28Å; L7-L9 HydrophobicContact CD2-CG 4.34Å; L7-L9 HydrophobicContact CG-CD1 3.9Å; L7-L9 HydrophobicContact CG-CD2 4.18Å; L7-L9 HydrophobicContact CG-CG 3.95Å; L7-I22 HydrophobicContact CD2-CG2 4.07Å
8	V	59.5	Low	60.3	Low	132 Å²	132	126.3 Å²	126.3	80%	0.8	69%	0.686	S	S	*	*			trans	-87.2	121	173.2	-176.1	0	0	0	0	109.3	V6	V6-V8 HydrophobicContact CG1-CG2 3.99Å; V6-V8 PolarHBondContact O-N 3.45Å
9	L	60.3	Low	61.1	Low	68 Å²	68	121 Å²	121	36%	0.356	66%	0.657	S	S	.	*			trans	-117.8	119.8	-173.4	-64.8	141.1	0	0	0	110.4	L7 L19 V23	L7-L9 HydrophobicContact CD1-CD2 4.45Å; L7-L9 HydrophobicContact CD2-CD1 3.89Å; L7-L9 HydrophobicContact CD2-CD2 4.28Å; L7-L9 HydrophobicContact CD2-CG 4.34Å; L7-L9 HydrophobicContact CG-CD1 3.9Å; L7-L9 HydrophobicContact CG-CD2 4.18Å; L7-L9 HydrophobicContact CG-CG 3.95Å; L9-L19 HydrophobicContact CB-CD1 4.1Å; L9-L19 HydrophobicContact CB-CD2 4.11Å; L9-L19 HydrophobicContact CD2-CB 4.09Å; L9-L19 HydrophobicContact CD2-CD1 4.44Å; L9-L19 HydrophobicContact CD2-CD2 3.1Å; L9-L19 HydrophobicContact CD2-CG 3.95Å; L9-L19 HydrophobicContact CG-CD2 4.17Å; L9-V23 HydrophobicContact CD1-CG2 4.23Å
10	D	58.8	Low	62.1	Low	121 Å²	121	118 Å²	118	65%	0.647	65%	0.649	S	S	*	*			trans	-92.6	132.4	174.6	-175.9	29.5	0	0	0	111.7
11	G	63.4	Low	63.2	Low	35 Å²	35	115.1 Å²	115.1	36%	0.361	64%	0.641	S	S	.	*			trans	-117.1	28.6	-151.7	0	0	0	0	0	116.6
12	R	63.8	Low	65.4	Low	229 Å²	229	106.7 Å²	106.7	86%	0.864	60%	0.6	S	S	*	*	S	Bend	trans	-98.1	93	-179.1	-73.9	-175.6	178	-164.8	0.7	112.9	H14	R12-H14 PolarHBondContact O-N 3.24Å
13	G	65.7	Low	66.9	Low	70 Å²	70	105.5 Å²	105.5	72%	0.722	58%	0.583	S	S	*	*	S	Bend	trans	101.7	-38	144.8	0	0	0	0	0	119.4
14	H	60.7	Low	69	Low	183 Å²	183	100 Å²	100	85%	0.847	57%	0.568	S	S	*	*	S	Bend	trans	-133.7	-17.2	-179.9	-154.5	65.9	0	0	0	113.7	R12	R12-H14 PolarHBondContact O-N 3.24Å
15	L	63.7	Low	70.5	Confident	78 Å²	78	101.2 Å²	101.2	41%	0.408	56%	0.563	S	S	.	*	S	Bend	trans	-75.8	-28.5	177.6	-72	162.1	0	0	0	111.7	G17 R18 L19	L15-G17 VanDerWaalsContact C-N 3.3Å; L15-G17 PolarHBondContact O-N 3.5Å; L15-G17 VanDerWaalsContact O-N 3.08Å; L15-R18 CarbonylContact O-C 3.48Å; L15-R18 WeakPolarHBondContact O-CA 3.12Å; L15-R18 WeakPolarHBondContact O-CB 3.42Å; L15-R18 PolarHBondContact O-N 3.33Å; L15-L19 HydrophobicContact CB-CD1 4.17Å; L15-L19 HydrophobicContact CB-CD2 4.23Å; L15-L19 HydrophobicContact CB-CG 4.06Å; L15-L19 VanDerWaalsContact O-CG 3.26Å; L15-L19 WeakPolarHBondContact O-CG 3.45Å; L15-L19 PolarHBondContact O-N 3.34Å
16	L	66.6	Low	71.8	Confident	105 Å²	105	95.7 Å²	95.7	55%	0.55	54%	0.537	S	S	.	.	H	α-helix	trans	-49.4	-42.2	-173.8	-74.9	169.5	0	0	0	114.6	L19 A20	L16-L19 PolarHBondContact O-N 3.07Å; L16-A20 WeakPolarHBondContact O-CB 3.37Å; L16-A20 PolarHBondContact O-N 3.47Å
17	G	77.2	Confident	73.3	Confident	56 Å²	56	93 Å²	93	58%	0.577	53%	0.526	S	S	*	.	H	α-helix	trans	-67.2	-37.2	175.5	0	0	0	0	0	113.2	L15 A21	L15-G17 VanDerWaalsContact C-N 3.3Å; L15-G17 PolarHBondContact O-N 3.5Å; L15-G17 VanDerWaalsContact O-N 3.08Å; G17-A21 WeakPolarHBondContact O-CB 3.32Å; G17-A21 PolarHBondContact O-N 3.03Å
18	R	80.3	Confident	74.6	Confident	181 Å²	181	91 Å²	91	68%	0.683	53%	0.526	S	S	*	.	H	α-helix	trans	-72.6	-38.4	175.4	-157.1	-178.7	-145.2	177.4	6.7	111.8	L15 A21 I22	L15-R18 CarbonylContact O-C 3.48Å; L15-R18 WeakPolarHBondContact O-CA 3.12Å; L15-R18 WeakPolarHBondContact O-CB 3.42Å; L15-R18 PolarHBondContact O-N 3.33Å; R18-A21 PolarHBondContact O-N 3.07Å; R18-I22 HydrophobicContact CG-CD1 4.46Å; R18-I22 VanDerWaalsContact O-CG1 3.28Å; R18-I22 WeakPolarHBondContact O-CG1 3.34Å; R18-I22 PolarHBondContact O-N 3.05Å
19	L	76.8	Confident	75.9	Confident	26 Å²	26	90.2 Å²	90.2	14%	0.136	51%	0.509	C	S	.	.	H	α-helix	trans	-64.6	-46.3	173.9	-54.4	177.8	0	0	0	109.6	L9 L15 L16 A21 I22 V23	L9-L19 HydrophobicContact CB-CD1 4.1Å; L9-L19 HydrophobicContact CB-CD2 4.11Å; L9-L19 HydrophobicContact CD2-CB 4.09Å; L9-L19 HydrophobicContact CD2-CD1 4.44Å; L9-L19 HydrophobicContact CD2-CD2 3.1Å; L9-L19 HydrophobicContact CD2-CG 3.95Å; L9-L19 HydrophobicContact CG-CD2 4.17Å; L15-L19 HydrophobicContact CB-CD1 4.17Å; L15-L19 HydrophobicContact CB-CD2 4.23Å; L15-L19 HydrophobicContact CB-CG 4.06Å; L15-L19 VanDerWaalsContact O-CG 3.26Å; L15-L19 WeakPolarHBondContact O-CG 3.45Å; L15-L19 PolarHBondContact O-N 3.34Å; L16-L19 PolarHBondContact O-N 3.07Å; L19-A21 VanDerWaalsContact C-N 3.28Å; L19-A21 PolarHBondContact O-N 2.86Å; L19-I22 PolarHBondContact O-N 3.36Å; L19-V23 WeakPolarHBondContact O-CB 3.37Å; L19-V23 VanDerWaalsContact O-CG2 3.24Å; L19-V23 WeakPolarHBondContact O-CG2 3.45Å; L19-V23 PolarHBondContact O-N 3.23Å
20	A	81.3	Confident	77.2	Confident	60 Å²	60	95.9 Å²	95.9	50%	0.496	53%	0.525	S	S	.	.	H	α-helix	trans	-57.9	-40.8	174.5	0	0	0	0	0	111.5	L16 A24	L16-A20 WeakPolarHBondContact O-CB 3.37Å; L16-A20 PolarHBondContact O-N 3.47Å; A20-A24 WeakPolarHBondContact O-CB 3.49Å; A20-A24 PolarHBondContact O-N 3.36Å
21	A	84.8	Confident	78.6	Confident	59 Å²	59	99 Å²	99	49%	0.488	53%	0.528	S	S	.	.	H	α-helix	trans	-66.9	-40.8	176.1	0	0	0	0	0	113	G17 R18 L19 K25	G17-A21 WeakPolarHBondContact O-CB 3.32Å; G17-A21 PolarHBondContact O-N 3.03Å; R18-A21 PolarHBondContact O-N 3.07Å; L19-A21 VanDerWaalsContact C-N 3.28Å; L19-A21 PolarHBondContact O-N 2.86Å; A21-K25 VanDerWaalsContact O-CB 3.31Å; A21-K25 WeakPolarHBondContact O-CB 3.27Å; A21-K25 PolarHBondContact O-N 3.46Å
22	I	86.8	Confident	79.8	Confident	67 Å²	67	101.1 Å²	101.1	34%	0.344	54%	0.538	S	S	.	.	H	α-helix	trans	-66.6	-46.3	176.6	-68.6	165	0	0	0	110.3	L7 R18 L19 K25 Q26	L7-I22 HydrophobicContact CD2-CG2 4.07Å; R18-I22 HydrophobicContact CG-CD1 4.46Å; R18-I22 VanDerWaalsContact O-CG1 3.28Å; R18-I22 WeakPolarHBondContact O-CG1 3.34Å; R18-I22 PolarHBondContact O-N 3.05Å; L19-I22 PolarHBondContact O-N 3.36Å; I22-K25 PolarHBondContact O-N 3.37Å; I22-Q26 WeakPolarHBondContact O-CB 3.17Å; I22-Q26 PolarHBondContact O-N 3.33Å
23	V	84.6	Confident	80.9	Confident	73 Å²	73	98 Å²	98	44%	0.442	53%	0.527	S	S	.	.	H	α-helix	trans	-61.5	-46.7	177	171.4	0	0	0	0	110.4	L9 L19 K25 Q26 A27	L9-V23 HydrophobicContact CD1-CG2 4.23Å; L19-V23 WeakPolarHBondContact O-CB 3.37Å; L19-V23 VanDerWaalsContact O-CG2 3.24Å; L19-V23 WeakPolarHBondContact O-CG2 3.45Å; L19-V23 PolarHBondContact O-N 3.23Å; V23-K25 VanDerWaalsContact C-N 3.34Å; V23-K25 PolarHBondContact O-N 2.88Å; V23-Q26 PolarHBondContact O-N 2.91Å; V23-A27 VanDerWaalsContact O-CB 3.22Å; V23-A27 WeakPolarHBondContact O-CB 3.3Å; V23-A27 PolarHBondContact O-N 2.85Å
24	A	87.8	Confident	82	Confident	63 Å²	63	96.9 Å²	96.9	52%	0.521	51%	0.511	S	S	.	.	H	α-helix	trans	-60.4	-42.4	176.7	0	0	0	0	0	112.1	A20 Q26 G28	A20-A24 WeakPolarHBondContact O-CB 3.49Å; A20-A24 PolarHBondContact O-N 3.36Å; A24-Q26 VanDerWaalsContact C-N 3.33Å; A24-Q26 PolarHBondContact O-N 2.86Å; A24-G28 PolarHBondContact O-N 3.39Å
25	K	87.6	Confident	83.4	Confident	146 Å²	146	91.4 Å²	91.4	64%	0.635	49%	0.491	S	S	*	.	H	α-helix	trans	-65.9	-36.4	177.1	-167.7	172.3	-170.7	174	0	112.3	A21 I22 V23 R29	A21-K25 VanDerWaalsContact O-CB 3.31Å; A21-K25 WeakPolarHBondContact O-CB 3.27Å; A21-K25 PolarHBondContact O-N 3.46Å; I22-K25 PolarHBondContact O-N 3.37Å; V23-K25 VanDerWaalsContact C-N 3.34Å; V23-K25 PolarHBondContact O-N 2.88Å; K25-R29 PolarHBondContact O-N 3.22Å
26	Q	85.5	Confident	84.5	Confident	64 Å²	64	94.2 Å²	94.2	30%	0.299	50%	0.499	S	S	.	.	H	α-helix	trans	-76.4	-43.1	179.4	-140.8	164.7	95.2	0	0	111.3	I22 V23 A24 G28 R29 W30	I22-Q26 WeakPolarHBondContact O-CB 3.17Å; I22-Q26 PolarHBondContact O-N 3.33Å; V23-Q26 PolarHBondContact O-N 2.91Å; A24-Q26 VanDerWaalsContact C-N 3.33Å; A24-Q26 PolarHBondContact O-N 2.86Å; Q26-G28 VanDerWaalsContact C-N 3.33Å; Q26-G28 PolarHBondContact O-N 3.01Å; Q26-R29 WeakPolarHBondContact O-CB 3.46Å; Q26-R29 PolarHBondContact O-N 3.28Å; Q26-R29 VanDerWaalsContact O-N 3.1Å; Q26-W30 PolarHBondContact O-N 3.06Å
27	A	86.1	Confident	85.5	Confident	55 Å²	55	92 Å²	92	46%	0.455	50%	0.496	S	S	.	.	H	α-helix	trans	-59.6	-41.4	173.6	0	0	0	0	0	111.9	V23 R29 W30 W31	V23-A27 VanDerWaalsContact O-CB 3.22Å; V23-A27 WeakPolarHBondContact O-CB 3.3Å; V23-A27 PolarHBondContact O-N 2.85Å; A27-R29 VanDerWaalsContact C-N 3.32Å; A27-R29 PolarHBondContact O-N 3.46Å; A27-W30 PolarHBondContact O-N 3.41Å; A27-W31 PolarHBondContact O-N 3.38Å
28	G	86.2	Confident	85.8	Confident	41 Å²	41	93.1 Å²	93.1	42%	0.423	50%	0.495	S	S	.	.	H	α-helix	trans	-61.7	-37.5	173.6	0	0	0	0	0	113.1	A24 Q26 S32	A24-G28 PolarHBondContact O-N 3.39Å; Q26-G28 VanDerWaalsContact C-N 3.33Å; Q26-G28 PolarHBondContact O-N 3.01Å; G28-S32 PolarHBondContact O-N 2.91Å
29	R	87	Confident	85.8	Confident	115 Å²	115	88 Å²	88	43%	0.434	49%	0.485	S	S	.	.	H	α-helix	trans	-67.9	-43.2	172.7	-75.7	-168.5	-67.7	-105.6	2.8	112.1	K25 Q26 A27 W31 S32 Y33	K25-R29 PolarHBondContact O-N 3.22Å; Q26-R29 WeakPolarHBondContact O-CB 3.46Å; Q26-R29 PolarHBondContact O-N 3.28Å; Q26-R29 VanDerWaalsContact O-N 3.1Å; A27-R29 VanDerWaalsContact C-N 3.32Å; A27-R29 PolarHBondContact O-N 3.46Å; R29-W31 VanDerWaalsContact C-N 3.29Å; R29-W31 PolarHBondContact O-N 2.88Å; R29-S32 PolarHBondContact O-N 2.87Å; R29-Y33 HydrophobicContact CB-CE2 4.25Å; R29-Y33 WeakPolarHBondContact O-CD2 3.22Å; R29-Y33 PolarHBondContact O-N 3.41Å; R29-Y33 VanDerWaalsContact O-N 3.12Å
30	W	86.1	Confident	86.2	Confident	186 Å²	186	93.6 Å²	93.6	71%	0.705	51%	0.508	S	S	*	.	H	α-helix	trans	-60.9	-38.1	177.1	-84.2	52.3	0	0	0	112.3	Q26 A27 S32 Y33 A34	Q26-W30 PolarHBondContact O-N 3.06Å; A27-W30 PolarHBondContact O-N 3.41Å; W30-S32 PolarHBondContact O-N 3.38Å; W30-Y33 PolarHBondContact O-N 3.41Å; W30-A34 WeakPolarHBondContact O-CB 3.02Å; W30-A34 PolarHBondContact O-N 3.43Å
31	W	88.3	Confident	86.3	Confident	187 Å²	187	96.3 Å²	96.3	71%	0.708	51%	0.514	S	S	*	.	H	α-helix	trans	-58.6	-46.4	173.7	-177.5	-101	0	0	0	112.1	A27 R29 Y33 A34 V35	A27-W31 PolarHBondContact O-N 3.38Å; R29-W31 VanDerWaalsContact C-N 3.29Å; R29-W31 PolarHBondContact O-N 2.88Å; W31-Y33 VanDerWaalsContact C-N 3.33Å; W31-Y33 PolarHBondContact O-N 3.22Å; W31-A34 PolarHBondContact O-N 3.22Å; W31-V35 HydrophobicContact CD2-CG2 4.47Å; W31-V35 HydrophobicContact CZ2-CG2 4.37Å; W31-V35 WeakPolarHBondContact O-CG2 3.46Å; W31-V35 PolarHBondContact O-N 3.48Å
32	S	88.3	Confident	86.1	Confident	79 Å²	79	95.9 Å²	95.9	55%	0.552	51%	0.51	S	S	*	.	H	α-helix	trans	-61.9	-38.8	175.7	-74.4	0	0	0	0	112.9	G28 R29 W30 K36	G28-S32 PolarHBondContact O-N 2.91Å; R29-S32 PolarHBondContact O-N 2.87Å; W30-S32 PolarHBondContact O-N 3.38Å; S32-K36 VanDerWaalsContact O-CB 3.3Å; S32-K36 WeakPolarHBondContact O-CB 3.16Å; S32-K36 PolarHBondContact O-N 2.9Å
33	Y	87.8	Confident	85.7	Confident	163 Å²	163	97.2 Å²	97.2	64%	0.639	52%	0.517	S	S	*	.	H	α-helix	trans	-66.8	-40.8	175	-67.8	-61.7	0	0	0	112.1	R29 W30 W31 K36 A37	R29-Y33 HydrophobicContact CB-CE2 4.25Å; R29-Y33 WeakPolarHBondContact O-CD2 3.22Å; R29-Y33 PolarHBondContact O-N 3.41Å; R29-Y33 VanDerWaalsContact O-N 3.12Å; W30-Y33 PolarHBondContact O-N 3.41Å; W31-Y33 VanDerWaalsContact C-N 3.33Å; W31-Y33 PolarHBondContact O-N 3.22Å; Y33-K36 PolarHBondContact O-N 3.12Å; Y33-A37 VanDerWaalsContact O-CB 3.27Å; Y33-A37 WeakPolarHBondContact O-CB 3.39Å; Y33-A37 PolarHBondContact O-N 3.1Å
34	A	88	Confident	85	Confident	48 Å²	48	97 Å²	97	40%	0.397	52%	0.518	S	S	.	.	H	α-helix	trans	-62.3	-48.5	176.6	0	0	0	0	0	111.3	W30 W31 K36 A37 S38	W30-A34 WeakPolarHBondContact O-CB 3.02Å; W30-A34 PolarHBondContact O-N 3.43Å; W31-A34 PolarHBondContact O-N 3.22Å; A34-K36 VanDerWaalsContact C-N 3.33Å; A34-K36 PolarHBondContact O-N 3.21Å; A34-A37 PolarHBondContact O-N 2.88Å; A34-S38 WeakPolarHBondContact O-CB 3.21Å; A34-S38 PolarHBondContact O-N 2.82Å; A34-S38 PolarHBondContact O-OG 3.4Å; A34-S38 VanDerWaalsContact O-OG 3.07Å
35	V	90.3	Very high	83.9	Confident	68 Å²	68	98.3 Å²	98.3	41%	0.412	52%	0.52	S	S	.	.	H	α-helix	trans	-57.9	-47.4	175.9	171.5	0	0	0	0	110.8	W31 A37 S38 T39	W31-V35 HydrophobicContact CD2-CG2 4.47Å; W31-V35 HydrophobicContact CZ2-CG2 4.37Å; W31-V35 WeakPolarHBondContact O-CG2 3.46Å; W31-V35 PolarHBondContact O-N 3.48Å; V35-A37 PolarHBondContact O-N 2.98Å; V35-S38 PolarHBondContact O-N 3Å; V35-T39 PolarHBondContact O-N 3.31Å; V35-T39 PolarHBondContact O-OG1 2.93Å; V35-T39 VanDerWaalsContact O-OG1 3.06Å
36	K	88.1	Confident	82.6	Confident	136 Å²	136	98.9 Å²	98.9	59%	0.591	53%	0.525	S	S	*	.	H	α-helix	trans	-63.8	-43.2	-179.1	-148.8	169.6	-169.9	168.4	0	111.2	S32 Y33 A34 T39 F40	S32-K36 VanDerWaalsContact O-CB 3.3Å; S32-K36 WeakPolarHBondContact O-CB 3.16Å; S32-K36 PolarHBondContact O-N 2.9Å; Y33-K36 PolarHBondContact O-N 3.12Å; A34-K36 VanDerWaalsContact C-N 3.33Å; A34-K36 PolarHBondContact O-N 3.21Å; K36-T39 PolarHBondContact O-N 3.47Å; K36-F40 HydrophobicContact CG-CD2 4.13Å; K36-F40 HydrophobicContact CG-CE2 3.97Å; K36-F40 WeakPolarHBondContact O-CB 3.24Å; K36-F40 WeakPolarHBondContact O-CD2 3.36Å; K36-F40 PolarHBondContact O-N 3.44Å
37	A	86.8	Confident	81.4	Confident	59 Å²	59	101.2 Å²	101.2	49%	0.488	54%	0.543	S	S	.	.	H	α-helix	trans	-62.2	-40.5	175	0	0	0	0	0	112.2	Y33 A34 V35 F40 L41	Y33-A37 VanDerWaalsContact O-CB 3.27Å; Y33-A37 WeakPolarHBondContact O-CB 3.39Å; Y33-A37 PolarHBondContact O-N 3.1Å; A34-A37 PolarHBondContact O-N 2.88Å; V35-A37 PolarHBondContact O-N 2.98Å; A37-F40 PolarHBondContact O-N 3.01Å; A37-L41 WeakPolarHBondContact O-CB 3.35Å; A37-L41 PolarHBondContact O-N 3.34Å
38	S	82.6	Confident	79.8	Confident	79 Å²	79	106.6 Å²	106.6	55%	0.552	58%	0.578	S	S	*	*	H	α-helix	trans	-64.2	-41.7	174.7	-63.6	0	0	0	0	112.4	A34 V35 L41 A42	A34-S38 WeakPolarHBondContact O-CB 3.21Å; A34-S38 PolarHBondContact O-N 2.82Å; A34-S38 PolarHBondContact O-OG 3.4Å; A34-S38 VanDerWaalsContact O-OG 3.07Å; V35-S38 PolarHBondContact O-N 3Å; S38-L41 PolarHBondContact O-N 2.8Å; S38-A42 WeakPolarHBondContact O-CB 3.46Å; S38-A42 PolarHBondContact O-N 3.32Å
39	T	81.6	Confident	79.5	Confident	75 Å²	75	109.9 Å²	109.9	46%	0.46	59%	0.585	S	S	.	*	H	α-helix	trans	-65.6	-42.9	174.6	-53.8	0	0	0	0	111.6	V35 K36 L41 A42 I43	V35-T39 PolarHBondContact O-N 3.31Å; V35-T39 PolarHBondContact O-OG1 2.93Å; V35-T39 VanDerWaalsContact O-OG1 3.06Å; K36-T39 PolarHBondContact O-N 3.47Å; T39-L41 VanDerWaalsContact C-N 3.32Å; T39-L41 PolarHBondContact O-N 3.17Å; T39-A42 PolarHBondContact O-N 3.2Å; T39-I43 HydrophobicContact CG2-CD1 3.92Å; T39-I43 WeakPolarHBondContact O-CG1 3.26Å; T39-I43 PolarHBondContact O-N 3.08Å
40	F	83.9	Confident	79.1	Confident	143 Å²	143	109.6 Å²	109.6	63%	0.627	59%	0.593	S	S	*	*	H	α-helix	trans	-59	-43.4	173.6	-91.3	-69.5	0	0	0	111.8	K36 A37 S44	K36-F40 HydrophobicContact CG-CD2 4.13Å; K36-F40 HydrophobicContact CG-CE2 3.97Å; K36-F40 WeakPolarHBondContact O-CB 3.24Å; K36-F40 WeakPolarHBondContact O-CD2 3.36Å; K36-F40 PolarHBondContact O-N 3.44Å; A37-F40 PolarHBondContact O-N 3.01Å; F40-S44 WeakPolarHBondContact O-CB 3.31Å; F40-S44 PolarHBondContact O-N 2.75Å
41	L	84.8	Confident	78.7	Confident	117 Å²	117	105.3 Å²	105.3	61%	0.613	59%	0.587	S	S	*	*	H	α-helix	trans	-64.2	-47.3	177.5	-176.4	63.1	0	0	0	111.2	A37 S38 T39 I43 S44 T45	A37-L41 WeakPolarHBondContact O-CB 3.35Å; A37-L41 PolarHBondContact O-N 3.34Å; S38-L41 PolarHBondContact O-N 2.8Å; T39-L41 VanDerWaalsContact C-N 3.32Å; T39-L41 PolarHBondContact O-N 3.17Å; L41-I43 PolarHBondContact O-N 2.78Å; L41-S44 WeakPolarHBondContact O-CB 3.33Å; L41-S44 PolarHBondContact O-N 3.19Å; L41-S44 VanDerWaalsContact O-N 3.15Å; L41-T45 WeakPolarHBondContact O-CG2 3.28Å; L41-T45 PolarHBondContact O-N 2.92Å
42	A	79.8	Confident	78.1	Confident	49 Å²	49	100.5 Å²	100.5	41%	0.405	58%	0.58	S	S	.	*	H	α-helix	trans	-57	-49.8	179.5	0	0	0	0	0	111.9	S38 T39 S44 T45 E46	S38-A42 WeakPolarHBondContact O-CB 3.46Å; S38-A42 PolarHBondContact O-N 3.32Å; T39-A42 PolarHBondContact O-N 3.2Å; A42-S44 VanDerWaalsContact C-N 3.29Å; A42-S44 PolarHBondContact O-N 3.2Å; A42-T45 PolarHBondContact O-N 2.8Å; A42-T45 PolarHBondContact O-OG1 3.33Å; A42-E46 PolarHBondContact O-N 3.35Å
43	I	78.8	Confident	77.5	Confident	96 Å²	96	101.9 Å²	101.9	49%	0.492	58%	0.582	S	S	.	*	H	α-helix	trans	-62.2	-38.7	177.7	-64.7	167.3	0	0	0	110.9	T39 L41 T45 E46 T47	T39-I43 HydrophobicContact CG2-CD1 3.92Å; T39-I43 WeakPolarHBondContact O-CG1 3.26Å; T39-I43 PolarHBondContact O-N 3.08Å; L41-I43 PolarHBondContact O-N 2.78Å; I43-T45 PolarHBondContact O-N 3Å; I43-E46 PolarHBondContact O-N 2.94Å; I43-T47 PolarHBondContact O-N 3.46Å; I43-T47 PolarHBondContact O-OG1 2.82Å
44	S	69.5	Low	76.8	Confident	68 Å²	68	97.8 Å²	97.8	48%	0.476	58%	0.578	S	S	.	*	H	α-helix	trans	-66.5	-24.5	177.2	-170.9	0	0	0	0	113.3	F40 L41 A42 T47	F40-S44 WeakPolarHBondContact O-CB 3.31Å; F40-S44 PolarHBondContact O-N 2.75Å; L41-S44 WeakPolarHBondContact O-CB 3.33Å; L41-S44 PolarHBondContact O-N 3.19Å; L41-S44 VanDerWaalsContact O-N 3.15Å; A42-S44 VanDerWaalsContact C-N 3.29Å; A42-S44 PolarHBondContact O-N 3.2Å; S44-T47 PolarHBondContact O-OG1 3.42Å
45	T	64.8	Low	76	Confident	91 Å²	91	101.4 Å²	101.4	56%	0.558	59%	0.591	S	S	*	*	H	α-helix	trans	-80.5	-23.8	175.8	73.8	0	0	0	0	113.1	L41 A42 I43 T47	L41-T45 WeakPolarHBondContact O-CG2 3.28Å; L41-T45 PolarHBondContact O-N 2.92Å; A42-T45 PolarHBondContact O-N 2.8Å; A42-T45 PolarHBondContact O-OG1 3.33Å; I43-T45 PolarHBondContact O-N 3Å; T45-T47 VanDerWaalsContact C-N 3.33Å
46	E	61.1	Low	74.9	Confident	158 Å²	158	103.9 Å²	103.9	74%	0.738	61%	0.605	S	S	*	*	H	α-helix	trans	-82.7	-12.3	178.4	-65.9	-178.2	104.6	0	0	112.6	A42 I43	A42-E46 PolarHBondContact O-N 3.35Å; I43-E46 PolarHBondContact O-N 2.94Å
47	T	59.9	Low	73.8	Confident	112 Å²	112	101.3 Å²	101.3	69%	0.687	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.4	12.1	-178.9	58.8	0	0	0	0	114.5	I43 S44 T45	I43-T47 PolarHBondContact O-N 3.46Å; I43-T47 PolarHBondContact O-OG1 2.82Å; S44-T47 PolarHBondContact O-OG1 3.42Å; T45-T47 VanDerWaalsContact C-N 3.33Å
48	S	52.5	Low	72.7	Confident	168 Å²	168	105.1 Å²	105.1	100%	1.175	62%	0.617	S	S	*	*			trans	-106.5	0	174.2	-72.9	0	0	0	0	112.7

Retrieved 48 of 48 residues in 28.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).