A0A096LPG3_HUMAN Loading...

Cyclin dependent kinase like 5

AlphaFold DB , UniProt , Accession A0A096LPG3, Species HUMAN (Homo sapiens, Human), Gene CDKL5, Length 60 aa.

						>A0A096LPG3_HUMAN|A0A096LPG3|CDKL5
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.8	Very low	59.5	Low	242 Å²	242	124.8 Å²	124.8	100%	1.192	67%	0.665	S	S	*	*				0	109.2	0	-115	168.7	175.3	0	0	107.1	I3	M1-I3 PolarHBondContact O-N 2.89Å
2	K	41.4	Very low	62.1	Low	211 Å²	211	125 Å²	125	92%	0.917	66%	0.655	S	S	*	*	P	Polyproline II helix	trans	-73.1	116.7	176.7	-79.4	178	175.1	178.7	0	107.7
3	I	53.8	Low	64.6	Low	151 Å²	151	118.8 Å²	118.8	77%	0.774	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-60.1	124.8	173.8	-50.3	163.2	0	0	0	106.2	M1 N5	M1-I3 PolarHBondContact O-N 2.89Å; I3-N5 PolarHBondContact O-N 2.87Å
4	P	52.3	Low	66.8	Low	101 Å²	101	117.3 Å²	117.3	66%	0.656	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-59.6	134.3	-179.7	24	-32.2	0	0	0	109.2	I6	P4-I6 PolarHBondContact O-N 3.04Å
5	N	53.6	Low	68.6	Low	135 Å²	135	116.3 Å²	116.3	72%	0.722	60%	0.603	S	S	*	*			trans	-54.4	105.9	178.5	-174.4	-73.3	0	0	0	109.5	I3 G7 N8	I3-N5 PolarHBondContact O-N 2.87Å; N5-G7 PolarHBondContact O-N 2.94Å; N5-G7 VanDerWaalsContact O-N 3.07Å; N5-G7 WeakPolarHBondContact OD1-CA 3.49Å; N5-G7 PolarHBondContact OD1-N 3.31Å; N5-N8 PolarHBondContact O-N 2.75Å
6	I	57.6	Low	70.4	Confident	117 Å²	117	113.7 Å²	113.7	60%	0.6	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-61	-18.9	-176	-122.3	77	0	0	0	112.1	P4 N8 V9	P4-I6 PolarHBondContact O-N 3.04Å; I6-N8 PolarHBondContact O-N 2.84Å; I6-N8 VanDerWaalsContact O-N 3.13Å; I6-V9 PolarHBondContact O-N 3.31Å
7	G	57.6	Low	71.8	Confident	41 Å²	41	108.7 Å²	108.7	42%	0.423	57%	0.572	S	S	.	*	G	3₁₀ helix	trans	-58.1	-27	-177.3	0	0	0	0	0	113.9	N5 N11	N5-G7 PolarHBondContact O-N 2.94Å; N5-G7 VanDerWaalsContact O-N 3.07Å; N5-G7 WeakPolarHBondContact OD1-CA 3.49Å; N5-G7 PolarHBondContact OD1-N 3.31Å; G7-N11 PolarHBondContact O-ND2 3.36Å
8	N	62	Low	73.2	Confident	128 Å²	128	107.6 Å²	107.6	68%	0.684	57%	0.57	S	S	*	*	G	3₁₀ helix	trans	-89.2	-21.8	177.9	-124.5	23.3	0	0	0	114	N5 I6	N5-N8 PolarHBondContact O-N 2.75Å; I6-N8 PolarHBondContact O-N 2.84Å; I6-N8 VanDerWaalsContact O-N 3.13Å
9	V	71.3	Confident	74.4	Confident	73 Å²	73	107.1 Å²	107.1	44%	0.442	57%	0.572	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.2	-44.8	-177.1	179.7	0	0	0	0	110.5	I6 N11 K12 F13	I6-V9 PolarHBondContact O-N 3.31Å; V9-N11 PolarHBondContact O-N 2.83Å; V9-K12 PolarHBondContact O-N 2.79Å; V9-F13 HydrophobicContact CG1-CE2 3.96Å; V9-F13 VanDerWaalsContact O-CD2 3.23Å; V9-F13 WeakPolarHBondContact O-CD2 3.29Å; V9-F13 WeakPolarHBondContact O-CE2 3.48Å
10	M	80.3	Confident	75.4	Confident	68 Å²	68	103.3 Å²	103.3	34%	0.335	56%	0.559	S	S	.	*	G	3₁₀ helix	trans	-67.6	-21.1	-177.9	-75.8	-57.1	-134.8	0	0	114.2	K12 F13 L28 I41	M10-K12 PolarHBondContact O-N 3.45Å; M10-F13 PolarHBondContact O-N 2.85Å; M10-L28 HydrophobicContact CE-CD1 4.48Å; M10-I41 HydrophobicContact CE-CB 4.39Å; M10-I41 HydrophobicContact CE-CD1 4.16Å; M10-I41 HydrophobicContact CE-CG2 3.61Å; M10-I41 HydrophobicContact SD-CD1 3.68Å; M10-I41 HydrophobicContact SD-CG2 4.25Å
11	N	85.9	Confident	76.4	Confident	106 Å²	106	105.8 Å²	105.8	57%	0.567	57%	0.567	S	S	*	*	G	3₁₀ helix	trans	-63.4	-24.8	175.5	-89	-69.3	0	0	0	113.4	G7 V9 F13 K33	G7-N11 PolarHBondContact O-ND2 3.36Å; V9-N11 PolarHBondContact O-N 2.83Å; N11-F13 VanDerWaalsContact C-N 3.3Å; N11-K33 WeakPolarHBondContact O-CE 3.42Å; N11-K33 PolarHBondContact O-NZ 2.85Å
12	K	90.8	Very high	78.8	Confident	127 Å²	127	96.2 Å²	96.2	55%	0.552	53%	0.531	S	S	*	.	G	3₁₀ helix	trans	-79.3	-11.5	179.5	-60.4	-173.6	177.7	-171.3	0	113.9	V9 M10 H32 K33	V9-K12 PolarHBondContact O-N 2.79Å; M10-K12 PolarHBondContact O-N 3.45Å; K12-H32 PolarHBondContact O-CD2 2.8Å; K12-K33 WeakPolarHBondContact O-CB 3.38Å; K12-K33 WeakPolarHBondContact O-CG 3.18Å; K12-K33 PolarHBondContact O-N 3.26Å
13	F	94.3	Very high	80.9	Confident	44 Å²	44	90.2 Å²	90.2	19%	0.193	52%	0.521	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	139.9	-174.5	-58.9	-84.5	0	0	0	110.7	V9 M10 N11 C30 R31 H32 V39 I41	V9-F13 HydrophobicContact CG1-CE2 3.96Å; V9-F13 VanDerWaalsContact O-CD2 3.23Å; V9-F13 WeakPolarHBondContact O-CD2 3.29Å; V9-F13 WeakPolarHBondContact O-CE2 3.48Å; M10-F13 PolarHBondContact O-N 2.85Å; N11-F13 VanDerWaalsContact C-N 3.3Å; F13-C30 HydrophobicContact CB-CB 4.05Å; F13-R31 CarbonylContact C-O 3.55Å; F13-R31 WeakPolarHBondContact CA-O 3.34Å; F13-H32 HydrophobicContact CD1-CB 3.96Å; F13-H32 AromaticContact CD1-CD2 3.87Å; F13-H32 HydrophobicContact CE1-CB 3.83Å; F13-H32 AromaticContact CE1-CD2 3.44Å; F13-H32 VanDerWaalsContact CE1-CD2 3.44Å; F13-H32 WeakPolarHBondContact CE1-CD2 3.44Å; F13-H32 AromaticContact CE1-CG 3.95Å; F13-H32 AromaticContact CZ-CD2 3.74Å; F13-V39 HydrophobicContact CD1-CG2 3.76Å; F13-V39 HydrophobicContact CE1-CG2 3.75Å; F13-I41 HydrophobicContact CB-CD1 4.06Å; F13-I41 HydrophobicContact CD1-CD1 4.2Å; F13-I41 HydrophobicContact CD2-CD1 3.96Å; F13-I41 HydrophobicContact CE2-CD1 4.49Å; F13-I41 HydrophobicContact CG-CD1 3.81Å
14	E	95.1	Very high	82.5	Confident	98 Å²	98	91.6 Å²	91.6	46%	0.458	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	127.4	168.2	177.7	-177.9	81.1	0	0	108.7	L16 C30 R31 K33	E14-L16 HydrophobicContact CG-CD2 4.37Å; E14-L16 PolarHBondContact O-N 3.4Å; E14-L16 WeakPolarHBondContact OE1-CD2 3.1Å; E14-C30 CarbonylContact O-C 3.42Å; E14-C30 WeakPolarHBondContact O-CA 3.37Å; E14-C30 WeakPolarHBondContact O-CB 3.41Å; E14-R31 HydrophobicContact CB-CB 4.49Å; E14-R31 PolarHBondContact N-O 2.85Å; E14-R31 PolarHBondContact O-N 2.84Å; E14-K33 HydrophobicContact CB-CG 4.49Å
15	I	94.5	Very high	84.4	Confident	103 Å²	103	87 Å²	87	53%	0.528	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	118.4	177.6	-59.5	168.7	0	0	0	108.2	L28	I15-L28 HydrophobicContact CD1-CD1 4.09Å; I15-L28 HydrophobicContact CG1-CD1 4.44Å; I15-L28 HydrophobicContact CG2-CB 4.47Å; I15-L28 HydrophobicContact CG2-CD2 4.35Å
16	L	96.4	Very high	86.4	Confident	74 Å²	74	82 Å²	82	39%	0.387	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	-25.8	177.4	-59.9	-178.6	0	0	0	112.3	E14 K29 R31 I38	E14-L16 HydrophobicContact CG-CD2 4.37Å; E14-L16 PolarHBondContact O-N 3.4Å; E14-L16 WeakPolarHBondContact OE1-CD2 3.1Å; L16-K29 HydrophobicContact CB-CB 4.33Å; L16-K29 HydrophobicContact CB-CD 4.29Å; L16-K29 HydrophobicContact CB-CG 4.18Å; L16-K29 HydrophobicContact CD1-CD 4.26Å; L16-K29 HydrophobicContact CD1-CG 4.19Å; L16-K29 PolarHBondContact N-O 3.21Å; L16-R31 HydrophobicContact CD1-CB 4.09Å; L16-R31 HydrophobicContact CD2-CB 4.38Å; L16-R31 HydrophobicContact CG-CB 4.26Å; L16-I38 HydrophobicContact CD1-CD1 3.86Å
17	G	95.8	Very high	88.2	Confident	29 Å²	29	78.5 Å²	78.5	30%	0.299	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	161.4	-176.4	177.7	0	0	0	0	0	113.4	L28 K29	G17-L28 CarbonylContact O-C 3.55Å; G17-L28 WeakPolarHBondContact O-CA 3.3Å; G17-K29 PolarHBondContact N-O 2.9Å; G17-K29 PolarHBondContact O-N 2.82Å
18	V	96.6	Very high	90	Very high	88 Å²	88	77.5 Å²	77.5	53%	0.533	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	132.6	174.2	178.5	0	0	0	0	109.2	E21 V26 L28	V18-E21 HydrophobicContact CG1-CG 4.02Å; V18-V26 HydrophobicContact CG1-CG1 3.68Å; V18-V26 HydrophobicContact CG2-CG1 4.09Å; V18-L28 HydrophobicContact CG2-CD2 3.85Å
19	V	95.9	Very high	91.6	Very high	99 Å²	99	76 Å²	76	60%	0.6	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.4	-32.7	174.5	-175.3	0	0	0	0	111.1	V27 K29	V19-V27 HydrophobicContact CB-CG1 4.27Å; V19-V27 PolarHBondContact N-O 3.46Å; V19-K29 HydrophobicContact CG2-CB 3.54Å; V19-K29 HydrophobicContact CG2-CG 4.45Å
20	G	94.7	Very high	92.8	Very high	31 Å²	31	72.5 Å²	72.5	32%	0.32	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-174.7	156.3	178.4	0	0	0	0	0	113.2	V27	G20-V27 PolarHBondContact N-O 3.45Å; G20-V27 PolarHBondContact O-N 3.2Å
21	E	95.3	Very high	93.6	Very high	155 Å²	155	73.9 Å²	73.9	72%	0.724	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.1	134.3	178.2	-60.9	-175.3	82.9	0	0	108.9	V18 V26	V18-E21 HydrophobicContact CG1-CG 4.02Å; E21-V26 HydrophobicContact CG-CG1 4.15Å; E21-V26 HydrophobicContact CG-CG2 4.14Å
22	G	88.8	Confident	94.1	Very high	42 Å²	42	70.4 Å²	70.4	43%	0.433	38%	0.379	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	175.7	176.1	0	0	0	0	0	111.6	Y24 G25	G22-Y24 PolarHBondContact O-N 2.8Å; G22-Y24 VanDerWaalsContact O-N 3.14Å; G22-G25 PolarHBondContact N-O 2.78Å; G22-G25 PolarHBondContact O-N 2.82Å
23	A	86.9	Confident	94.2	Very high	85 Å²	85	69.7 Å²	69.7	70%	0.702	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.5	-39	179.6	0	0	0	0	0	112.5
24	Y	88	Confident	94.3	Very high	180 Å²	180	75.5 Å²	75.5	71%	0.706	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95	-5	-172.6	-57.7	-77.5	0	0	0	115.2	G22 F44 K45	G22-Y24 PolarHBondContact O-N 2.8Å; G22-Y24 VanDerWaalsContact O-N 3.14Å; Y24-F44 WeakPolarHBondContact O-CA 3.5Å; Y24-K45 PolarHBondContact O-N 2.92Å
25	G	92.2	Very high	94.3	Very high	4 Å²	4	73.9 Å²	73.9	4%	0.041	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	163.4	-178.7	-170.7	0	0	0	0	0	115.7	G22 K43	G22-G25 PolarHBondContact N-O 2.78Å; G22-G25 PolarHBondContact O-N 2.82Å; G25-K43 CarbonylContact C-O 3.47Å; G25-K43 WeakPolarHBondContact CA-O 3.42Å
26	V	94	Very high	94.3	Very high	30 Å²	30	74.8 Å²	74.8	18%	0.182	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	134.3	179.2	-178	0	0	0	0	109.2	V18 E21 L28 K43	V18-V26 HydrophobicContact CG1-CG1 3.68Å; V18-V26 HydrophobicContact CG2-CG1 4.09Å; E21-V26 HydrophobicContact CG-CG1 4.15Å; E21-V26 HydrophobicContact CG-CG2 4.14Å; V26-L28 HydrophobicContact CG1-CD2 4.05Å; V26-K43 PolarHBondContact N-O 3.07Å; V26-K43 PolarHBondContact O-N 2.82Å
27	V	95.1	Very high	94.3	Very high	43 Å²	43	76.9 Å²	76.9	26%	0.261	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	119.8	174.2	-176.6	0	0	0	0	108.8	V19 G20 A40 K42	V19-V27 HydrophobicContact CB-CG1 4.27Å; V19-V27 PolarHBondContact N-O 3.46Å; G20-V27 PolarHBondContact N-O 3.45Å; G20-V27 PolarHBondContact O-N 3.2Å; V27-A40 HydrophobicContact CG1-CB 3.98Å; V27-K42 HydrophobicContact CG2-CB 4.4Å; V27-K42 HydrophobicContact CG2-CG 4.17Å
28	L	95.5	Very high	94.4	Very high	21 Å²	21	79.7 Å²	79.7	11%	0.11	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	137	179	-58.4	174	0	0	0	109.9	M10 I15 G17 V18 V26 A40 I41	M10-L28 HydrophobicContact CE-CD1 4.48Å; I15-L28 HydrophobicContact CD1-CD1 4.09Å; I15-L28 HydrophobicContact CG1-CD1 4.44Å; I15-L28 HydrophobicContact CG2-CB 4.47Å; I15-L28 HydrophobicContact CG2-CD2 4.35Å; G17-L28 CarbonylContact O-C 3.55Å; G17-L28 WeakPolarHBondContact O-CA 3.3Å; V18-L28 HydrophobicContact CG2-CD2 3.85Å; V26-L28 HydrophobicContact CG1-CD2 4.05Å; L28-A40 CarbonylContact O-C 3.53Å; L28-A40 VanDerWaalsContact O-CA 3.3Å; L28-A40 WeakPolarHBondContact O-CA 3.1Å; L28-I41 PolarHBondContact N-O 3.19Å; L28-I41 PolarHBondContact O-N 3.23Å
29	K	96.5	Very high	94.3	Very high	95 Å²	95	77.9 Å²	77.9	41%	0.413	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	124.8	163.8	-171.6	178.1	-179.3	176.9	0	107.3	L16 G17 V19 I38	L16-K29 HydrophobicContact CB-CB 4.33Å; L16-K29 HydrophobicContact CB-CD 4.29Å; L16-K29 HydrophobicContact CB-CG 4.18Å; L16-K29 HydrophobicContact CD1-CD 4.26Å; L16-K29 HydrophobicContact CD1-CG 4.19Å; L16-K29 PolarHBondContact N-O 3.21Å; G17-K29 PolarHBondContact N-O 2.9Å; G17-K29 PolarHBondContact O-N 2.82Å; V19-K29 HydrophobicContact CG2-CB 3.54Å; V19-K29 HydrophobicContact CG2-CG 4.45Å; K29-I38 HydrophobicContact CD-CG2 4.5Å; K29-I38 HydrophobicContact CG-CG2 4.1Å
30	C	96.4	Very high	94.3	Very high	0 Å²	0	76.8 Å²	76.8	0%	0	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	156.6	178.5	-56.3	0	0	0	0	111.2	F13 E14 I38 V39 I41	F13-C30 HydrophobicContact CB-CB 4.05Å; E14-C30 CarbonylContact O-C 3.42Å; E14-C30 WeakPolarHBondContact O-CA 3.37Å; E14-C30 WeakPolarHBondContact O-CB 3.41Å; C30-I38 WeakPolarHBondContact O-CA 3.23Å; C30-V39 HydrophobicContact CB-CG2 4.05Å; C30-V39 PolarHBondContact N-O 2.98Å; C30-V39 PolarHBondContact O-N 3.01Å; C30-I41 HydrophobicContact CB-CD1 3.97Å; C30-I41 HydrophobicContact CB-CG1 4.24Å
31	R	96.7	Very high	94.3	Very high	98 Å²	98	77 Å²	77	37%	0.37	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	127.2	168.5	-177.8	178.5	-67.3	-137.6	0.2	109.1	F13 E14 L16 K33 E37 I38	F13-R31 CarbonylContact C-O 3.55Å; F13-R31 WeakPolarHBondContact CA-O 3.34Å; E14-R31 HydrophobicContact CB-CB 4.49Å; E14-R31 PolarHBondContact N-O 2.85Å; E14-R31 PolarHBondContact O-N 2.84Å; L16-R31 HydrophobicContact CD1-CB 4.09Å; L16-R31 HydrophobicContact CD2-CB 4.38Å; L16-R31 HydrophobicContact CG-CB 4.26Å; R31-K33 PolarHBondContact O-N 2.88Å; R31-E37 CarbonylContact C-O 3.59Å; R31-E37 WeakPolarHBondContact CA-O 3.41Å; R31-I38 HydrophobicContact CB-CD1 4.1Å; R31-I38 HydrophobicContact CG-CD1 4.16Å
32	H	95.9	Very high	94.1	Very high	32 Å²	32	74.9 Å²	74.9	15%	0.148	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.2	125	169.4	-171.4	-119.7	0	0	0	109	K12 F13 E34 T35 H36 E37	K12-H32 PolarHBondContact O-CD2 2.8Å; F13-H32 HydrophobicContact CD1-CB 3.96Å; F13-H32 AromaticContact CD1-CD2 3.87Å; F13-H32 HydrophobicContact CE1-CB 3.83Å; F13-H32 AromaticContact CE1-CD2 3.44Å; F13-H32 VanDerWaalsContact CE1-CD2 3.44Å; F13-H32 WeakPolarHBondContact CE1-CD2 3.44Å; F13-H32 AromaticContact CE1-CG 3.95Å; F13-H32 AromaticContact CZ-CD2 3.74Å; H32-E34 VanDerWaalsContact C-N 3.3Å; H32-E34 PolarHBondContact O-N 3.14Å; H32-T35 WeakPolarHBondContact ND1-CG2 3.49Å; H32-T35 PolarHBondContact ND1-N 3.25Å; H32-T35 PolarHBondContact ND1-OG1 2.93Å; H32-H36 WeakPolarHBondContact O-CA 3.44Å; H32-H36 PolarHBondContact O-N 3.06Å; H32-E37 PolarHBondContact N-O 3.47Å
33	K	94.2	Very high	94.1	Very high	112 Å²	112	79.3 Å²	79.3	49%	0.487	40%	0.397	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.7	-33.2	-168.9	-71.5	176.4	-179.7	171.4	0	113.2	N11 K12 E14 R31	N11-K33 WeakPolarHBondContact O-CE 3.42Å; N11-K33 PolarHBondContact O-NZ 2.85Å; K12-K33 WeakPolarHBondContact O-CB 3.38Å; K12-K33 WeakPolarHBondContact O-CG 3.18Å; K12-K33 PolarHBondContact O-N 3.26Å; E14-K33 HydrophobicContact CB-CG 4.49Å; R31-K33 PolarHBondContact O-N 2.88Å
34	E	95.1	Very high	94.2	Very high	166 Å²	166	81.4 Å²	81.4	78%	0.776	39%	0.391	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90	-47.6	-175.8	-172	177.1	91.5	0	0	112.7	H32 H36	H32-E34 VanDerWaalsContact C-N 3.3Å; H32-E34 PolarHBondContact O-N 3.14Å; E34-H36 VanDerWaalsContact C-N 3.35Å
35	T	96.3	Very high	94	Very high	64 Å²	64	78.7 Å²	78.7	39%	0.393	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.3	-9.5	-177.7	64.6	0	0	0	0	113.1	H32 E37	H32-T35 WeakPolarHBondContact ND1-CG2 3.49Å; H32-T35 PolarHBondContact ND1-N 3.25Å; H32-T35 PolarHBondContact ND1-OG1 2.93Å; T35-E37 VanDerWaalsContact CB-OE2 3.29Å; T35-E37 WeakPolarHBondContact CB-OE2 3.47Å; T35-E37 PolarHBondContact O-N 3.13Å; T35-E37 WeakPolarHBondContact OG1-CG 3.44Å; T35-E37 PolarHBondContact OG1-OE2 3.49Å
36	H	94.3	Very high	93	Very high	122 Å²	122	85.5 Å²	85.5	57%	0.565	42%	0.418	S	S	*	.			trans	56.8	12.4	-172.2	-60.7	-58	0	0	0	115.1	H32 E34	H32-H36 WeakPolarHBondContact O-CA 3.44Å; H32-H36 PolarHBondContact O-N 3.06Å; E34-H36 VanDerWaalsContact C-N 3.35Å
37	E	97.3	Very high	91.3	Very high	119 Å²	119	89.9 Å²	89.9	56%	0.556	45%	0.45	S	S	*	.			trans	-68.9	141.1	178.1	-71.2	176.1	98.6	0	0	111.5	R31 H32 T35	R31-E37 CarbonylContact C-O 3.59Å; R31-E37 WeakPolarHBondContact CA-O 3.41Å; H32-E37 PolarHBondContact N-O 3.47Å; T35-E37 VanDerWaalsContact CB-OE2 3.29Å; T35-E37 WeakPolarHBondContact CB-OE2 3.47Å; T35-E37 PolarHBondContact O-N 3.13Å; T35-E37 WeakPolarHBondContact OG1-CG 3.44Å; T35-E37 PolarHBondContact OG1-OE2 3.49Å
38	I	96.6	Very high	89.4	Confident	88 Å²	88	96.6 Å²	96.6	45%	0.451	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	121.7	175.4	-55.6	-57.2	0	0	0	108.5	L16 K29 C30 R31	L16-I38 HydrophobicContact CD1-CD1 3.86Å; K29-I38 HydrophobicContact CD-CG2 4.5Å; K29-I38 HydrophobicContact CG-CG2 4.1Å; C30-I38 WeakPolarHBondContact O-CA 3.23Å; R31-I38 HydrophobicContact CB-CD1 4.1Å; R31-I38 HydrophobicContact CG-CD1 4.16Å
39	V	95.7	Very high	87.2	Confident	49 Å²	49	104 Å²	104	30%	0.297	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	159.5	-178.6	-59.9	0	0	0	0	110.8	F13 C30 I41	F13-V39 HydrophobicContact CD1-CG2 3.76Å; F13-V39 HydrophobicContact CE1-CG2 3.75Å; C30-V39 HydrophobicContact CB-CG2 4.05Å; C30-V39 PolarHBondContact N-O 2.98Å; C30-V39 PolarHBondContact O-N 3.01Å; V39-I41 HydrophobicContact CG2-CG1 4.31Å
40	A	95.6	Very high	84.6	Confident	76 Å²	76	107.4 Å²	107.4	63%	0.628	54%	0.535	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.2	129	170.5	0	0	0	0	0	109.7	V27 L28	V27-A40 HydrophobicContact CG1-CB 3.98Å; L28-A40 CarbonylContact O-C 3.53Å; L28-A40 VanDerWaalsContact O-CA 3.3Å; L28-A40 WeakPolarHBondContact O-CA 3.1Å
41	I	93.1	Very high	82.3	Confident	35 Å²	35	115.6 Å²	115.6	18%	0.179	57%	0.573	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.7	119.1	176.2	-56.1	-177	0	0	0	109	M10 F13 L28 C30 V39	M10-I41 HydrophobicContact CE-CB 4.39Å; M10-I41 HydrophobicContact CE-CD1 4.16Å; M10-I41 HydrophobicContact CE-CG2 3.61Å; M10-I41 HydrophobicContact SD-CD1 3.68Å; M10-I41 HydrophobicContact SD-CG2 4.25Å; F13-I41 HydrophobicContact CB-CD1 4.06Å; F13-I41 HydrophobicContact CD1-CD1 4.2Å; F13-I41 HydrophobicContact CD2-CD1 3.96Å; F13-I41 HydrophobicContact CE2-CD1 4.49Å; F13-I41 HydrophobicContact CG-CD1 3.81Å; L28-I41 PolarHBondContact N-O 3.19Å; L28-I41 PolarHBondContact O-N 3.23Å; C30-I41 HydrophobicContact CB-CD1 3.97Å; C30-I41 HydrophobicContact CB-CG1 4.24Å; V39-I41 HydrophobicContact CG2-CG1 4.31Å
42	K	91.3	Very high	79.9	Confident	111 Å²	111	117 Å²	117	48%	0.483	58%	0.584	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.8	109.9	175.3	-171.1	171.2	-176.1	177.2	0	109.9	V27 F44	V27-K42 HydrophobicContact CG2-CB 4.4Å; V27-K42 HydrophobicContact CG2-CG 4.17Å; K42-F44 HydrophobicContact CD-CE1 4.11Å; K42-F44 HydrophobicContact CD-CE2 4.42Å; K42-F44 HydrophobicContact CD-CZ 3.89Å; K42-F44 HydrophobicContact CG-CE2 4.31Å; K42-F44 HydrophobicContact CG-CZ 4.26Å
43	K	89.6	Confident	77.6	Confident	135 Å²	135	122.9 Å²	122.9	59%	0.587	62%	0.622	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85.9	112.6	169.1	-174.2	177.9	179.7	-176.7	0	108.3	G25 V26	G25-K43 CarbonylContact C-O 3.47Å; G25-K43 WeakPolarHBondContact CA-O 3.42Å; V26-K43 PolarHBondContact N-O 3.07Å; V26-K43 PolarHBondContact O-N 2.82Å
44	F	88.9	Confident	75.5	Confident	130 Å²	130	124.1 Å²	124.1	57%	0.57	63%	0.627	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-71.7	142.2	171.9	-65.9	-88.9	0	0	0	109.2	Y24 K42 D46	Y24-F44 WeakPolarHBondContact O-CA 3.5Å; K42-F44 HydrophobicContact CD-CE1 4.11Å; K42-F44 HydrophobicContact CD-CE2 4.42Å; K42-F44 HydrophobicContact CD-CZ 3.89Å; K42-F44 HydrophobicContact CG-CE2 4.31Å; K42-F44 HydrophobicContact CG-CZ 4.26Å; F44-D46 PolarHBondContact O-N 3.32Å
45	K	84.5	Confident	73.4	Confident	122 Å²	122	123.4 Å²	123.4	53%	0.53	62%	0.624	S	S	.	*			trans	-71.7	123.9	164.7	-72.1	172	-177.3	177.4	0	105.9	Y24 S47	Y24-K45 PolarHBondContact O-N 2.92Å; K45-S47 PolarHBondContact O-N 3.34Å
46	D	69.6	Low	71.2	Confident	148 Å²	148	125.4 Å²	125.4	79%	0.791	64%	0.636	S	S	*	*			trans	-59.9	107.5	169.2	-73.7	-86.5	0	0	0	107.4	F44 E48	F44-D46 PolarHBondContact O-N 3.32Å; D46-E48 PolarHBondContact O-N 3.08Å; D46-E48 VanDerWaalsContact O-N 3.08Å
47	S	59.1	Low	69.1	Low	122 Å²	122	125.9 Å²	125.9	85%	0.853	65%	0.648	S	S	*	*			trans	-86.6	50.1	-176.4	-163.6	0	0	0	0	110.4	K45	K45-S47 PolarHBondContact O-N 3.34Å
48	E	56	Low	67.1	Low	184 Å²	184	127.8 Å²	127.8	86%	0.86	66%	0.661	S	S	*	*			trans	-125.3	15.4	-178	-94.2	179.5	82.7	0	0	114.3	D46	D46-E48 PolarHBondContact O-N 3.08Å; D46-E48 VanDerWaalsContact O-N 3.08Å
49	E	48.6	Very low	65.4	Low	177 Å²	177	134.6 Å²	134.6	83%	0.827	68%	0.681	S	S	*	*			trans	-147	73.2	166.7	-148.2	-176.5	100.1	0	0	111.4
50	N	42.4	Very low	63.7	Low	165 Å²	165	144.9 Å²	144.9	88%	0.882	73%	0.726	S	S	*	*			trans	-142.7	87.4	138.9	-103.6	-99.2	0	0	0	105.8
51	E	47.5	Very low	62.1	Low	173 Å²	173	148.4 Å²	148.4	81%	0.808	73%	0.731	S	S	*	*			trans	-32.8	146.9	149.6	-166.4	159.6	69.3	0	0	111.4
52	E	46.3	Very low	60.5	Low	126 Å²	126	154.3 Å²	154.3	59%	0.589	76%	0.76	S	S	*	*			trans	84.8	70.4	176.6	-46.9	-172.6	87.8	0	0	117.2	K54	E52-K54 HydrophobicContact CB-CG 4.31Å; E52-K54 PolarHBondContact O-N 2.88Å; E52-K54 WeakPolarHBondContact OE1-CD 2.98Å; E52-K54 WeakPolarHBondContact OE1-CE 3.42Å; E52-K54 IonicContact OE1-NZ 2.68Å; E52-K54 PolarHBondContact OE1-NZ 2.68Å
53	V	48.3	Very low	58.8	Low	156 Å²	156	156.7 Å²	156.7	95%	0.945	78%	0.775	S	S	*	*			trans	-65	77.6	135.1	159.2	0	0	0	0	107.6
54	K	49.9	Very low	57	Low	138 Å²	138	158 Å²	158	60%	0.6	79%	0.787	S	S	*	*			trans	-83.8	135.7	146.4	-82.1	179	173.3	158.1	0	105.4	E52	E52-K54 HydrophobicContact CB-CG 4.31Å; E52-K54 PolarHBondContact O-N 2.88Å; E52-K54 WeakPolarHBondContact OE1-CD 2.98Å; E52-K54 WeakPolarHBondContact OE1-CE 3.42Å; E52-K54 IonicContact OE1-NZ 2.68Å; E52-K54 PolarHBondContact OE1-NZ 2.68Å
55	E	51.8	Low	55	Low	151 Å²	151	159.8 Å²	159.8	71%	0.706	80%	0.8	S	S	*	*			cis	-163.9	149.8	15.8	-107.6	164.2	85.9	0	0	107
56	T	49.9	Very low	53	Low	107 Å²	107	162.3 Å²	162.3	66%	0.656	82%	0.818	S	S	*	*			trans	49.6	106.5	148.2	57.2	0	0	0	0	120.5
57	T	48.6	Very low	51.8	Low	131 Å²	131	163.3 Å²	163.3	80%	0.804	82%	0.82	S	S	*	*			trans	-121.8	79.7	139.6	-46.7	0	0	0	0	108.1	R59	T57-R59 HydrophobicContact CG2-CG 4.5Å; T57-R59 PolarHBondContact O-N 3.45Å
58	L	56.9	Low	51.3	Low	160 Å²	160	166.5 Å²	166.5	84%	0.838	82%	0.817	S	S	*	*			trans	-72.1	115	157.8	-75.7	157.8	0	0	0	106.2
59	R	59.8	Low	50.9	Low	231 Å²	231	165 Å²	165	87%	0.872	81%	0.814	S	S	*	*			trans	-89.7	120.6	164.1	-88.7	178.5	171.4	159.5	-2.7	107.4	T57	T57-R59 HydrophobicContact CG2-CG 4.5Å; T57-R59 PolarHBondContact O-N 3.45Å
60	E	60.3	Low	51.1	Low	265 Å²	265	163.9 Å²	163.9	100%	1.238	81%	0.813	S	S	*	*			trans	-74.5	0	153.2	-170.2	171.7	90.7	0	0	109.5

Retrieved 60 of 60 residues in 81 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).