A0A096LPK3_HUMAN Loading...

ALG13 UDP-N-acetylglucosaminyltransferase subunit

AlphaFold DB , UniProt , Accession A0A096LPK3, Species HUMAN (Homo sapiens, Human), Gene ALG13, Length 35 aa.

						>A0A096LPK3_HUMAN|A0A096LPK3|ALG13
IACVSAPDSLQVSEGGEQAAAWLATRHLRPYCQPR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	58.1	Low	58.4	Low	172 Å²	172	103.7 Å²	103.7	88%	0.882	61%	0.611	S	S	*	*				0	114.2	0	-65.8	170.1	0	0	0	106.6	C32	I1-C32 HydrophobicContact CG2-CB 3.27Å
2	A	56.9	Low	58	Low	46 Å²	46	100.8 Å²	100.8	38%	0.38	60%	0.595	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.9	123.6	177.8	0	0	0	0	0	107.9	C32 Q33	A2-C32 WeakPolarHBondContact O-CA 3.14Å; A2-Q33 PolarHBondContact O-N 3.28Å; A2-Q33 PolarHBondContact N-O 2.06Å
3	C	70.3	Confident	57.3	Low	78 Å²	78	101.2 Å²	101.2	53%	0.527	61%	0.606	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.4	125.1	177	-53.8	0	0	0	0	108.5	C32	C3-C32 HydrophobicContact CB-CB 4.04Å; C3-C32 WeakPolarHBondContact CB-SG 3.14Å; C3-C32 WeakPolarHBondContact SG-CB 3.4Å; C3-C32 CovalentContact SG-SG 2.06Å; C3-C32 PolarHBondContact SG-SG 3.01Å
4	V	64.3	Low	57.1	Low	61 Å²	61	108.6 Å²	108.6	37%	0.37	63%	0.631	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.3	126.4	174.2	-71	0	0	0	0	108.4	A6 Y31	V4-A6 PolarHBondContact O-N 3.49Å; V4-Y31 HydrophobicContact CG2-CD2 4.27Å; V4-Y31 PolarHBondContact N-O 3.27Å; V4-Y31 WeakPolarHBondContact CG2-O 3.35Å; V4-Y31 HydrophobicContact CG2-CG 4.39Å; V4-Y31 HydrophobicContact CG2-CE2 3.83Å; V4-Y31 HydrophobicContact CG2-CE1 3.67Å; V4-Y31 HydrophobicContact CG2-CD1 4.12Å
5	S	63.3	Low	57	Low	110 Å²	110	106.9 Å²	106.9	77%	0.769	65%	0.645	S	S	*	*	P	Polyproline II helix	trans	-57.4	138	164.9	-60.1	0	0	0	0	107.6
6	A	60.7	Low	56.8	Low	25 Å²	25	100.7 Å²	100.7	21%	0.207	61%	0.61	C	S	.	*	P	Polyproline II helix	trans	-56.4	142.8	179.3	0	0	0	0	0	110.2	V4 D8 L28	V4-A6 PolarHBondContact O-N 3.49Å; A6-D8 PolarHBondContact O-N 3.19Å; A6-L28 HydrophobicContact CB-CG 4.29Å; A6-L28 HydrophobicContact CB-CD2 4.33Å; A6-L28 HydrophobicContact CB-CB 3.54Å; A6-L28 HydrophobicContact CB-CD1 4.33Å
7	P	58.3	Low	56.9	Low	80 Å²	80	105.2 Å²	105.2	52%	0.519	62%	0.623	S	S	.	*	P	Polyproline II helix	trans	-60.3	124.4	178.9	24.1	-32	0	0	0	109.2	S9	P7-S9 PolarHBondContact O-N 3.47Å
8	D	53.5	Low	56.8	Low	156 Å²	156	109.1 Å²	109.1	83%	0.834	63%	0.634	S	S	*	*	S	Bend	trans	-60.6	109.6	169.2	-99	-81.3	0	0	0	107.9	A6	A6-D8 PolarHBondContact O-N 3.19Å
9	S	49.8	Very low	56.7	Low	101 Å²	101	105.8 Å²	105.8	71%	0.706	62%	0.621	S	S	*	*			trans	67.1	88.5	166.6	-40.4	0	0	0	0	115.5	P7 Q11	P7-S9 PolarHBondContact O-N 3.47Å; S9-Q11 PolarHBondContact O-N 3.06Å; S9-Q11 VanDerWaalsContact O-N 3.11Å
10	L	54.1	Low	56.8	Low	119 Å²	119	102.5 Å²	102.5	62%	0.623	61%	0.606	S	S	*	*			trans	-59.6	114.7	159.1	-152.6	103.6	0	0	0	107.6	V12 L23	L10-V12 WeakPolarHBondContact O-CG2 3.49Å; L10-V12 PolarHBondContact O-N 3.11Å; L10-L23 HydrophobicContact CB-CD1 4.44Å; L10-L23 HydrophobicContact CD2-CD1 3.89Å
11	Q	52.8	Low	56.8	Low	193 Å²	193	100.3 Å²	100.3	90%	0.902	60%	0.599	S	S	*	*			trans	-60.9	106.2	176.9	-99	-179.4	-16.9	0	0	109.4	S9 S13	S9-Q11 PolarHBondContact O-N 3.06Å; S9-Q11 VanDerWaalsContact O-N 3.11Å; Q11-S13 PolarHBondContact O-N 3.06Å
12	V	54.1	Low	56.6	Low	69 Å²	69	99.3 Å²	99.3	42%	0.418	59%	0.585	S	S	.	*			trans	-86.8	103.1	176.6	-123.2	0	0	0	0	107.9	L10 G16 A19 A20	L10-V12 WeakPolarHBondContact O-CG2 3.49Å; L10-V12 PolarHBondContact O-N 3.11Å; V12-G16 WeakPolarHBondContact CG1-O 3.18Å; V12-A19 HydrophobicContact CG1-CB 3.9Å; V12-A20 HydrophobicContact CG1-CB 4.31Å; V12-A20 HydrophobicContact CG2-CB 4.08Å
13	S	48.8	Very low	56.7	Low	106 Å²	106	100 Å²	100	74%	0.741	58%	0.581	S	S	*	*			trans	-63.4	149.8	172.1	-160.3	0	0	0	0	110.1	Q11 G15 G16	Q11-S13 PolarHBondContact O-N 3.06Å; S13-G15 CarbonylContact O-C 3.54Å; S13-G15 PolarHBondContact O-N 2.72Å; S13-G16 VanDerWaalsContact O-CA 3.28Å; S13-G16 WeakPolarHBondContact O-CA 3.39Å; S13-G16 PolarHBondContact O-N 2.95Å
14	E	54.2	Low	56	Low	205 Å²	205	100 Å²	100	96%	0.958	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-47.2	-3.6	-167.3	-111.6	174.9	98.1	0	0	119.6	G16	E14-G16 VanDerWaalsContact C-N 3.28Å
15	G	55.8	Low	55.6	Low	82 Å²	82	102 Å²	102	85%	0.845	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.5	15.3	162.2	0	0	0	0	0	113.7	S13	S13-G15 CarbonylContact O-C 3.54Å; S13-G15 PolarHBondContact O-N 2.72Å
16	G	54.3	Low	55.2	Low	8 Å²	8	104.1 Å²	104.1	8%	0.082	59%	0.591	C	S	.	*			trans	-101.3	-1.8	-157.1	0	0	0	0	0	116.3	V12 S13 E14 Q18 A19 A20	V12-G16 WeakPolarHBondContact CG1-O 3.18Å; S13-G16 VanDerWaalsContact O-CA 3.28Å; S13-G16 WeakPolarHBondContact O-CA 3.39Å; S13-G16 PolarHBondContact O-N 2.95Å; E14-G16 VanDerWaalsContact C-N 3.28Å; G16-Q18 PolarHBondContact O-N 3.38Å; G16-A19 CarbonylContact O-C 3.54Å; G16-A19 PolarHBondContact O-N 3.25Å; G16-A19 WeakPolarHBondContact O-CA 3.35Å; G16-A20 WeakPolarHBondContact O-CB 3.42Å; G16-A20 PolarHBondContact O-N 3.32Å
17	E	57.4	Low	55.1	Low	177 Å²	177	109.9 Å²	109.9	83%	0.827	61%	0.614	S	S	*	*	H	α-helix	trans	-59.3	-36.6	-178.1	-75.9	-171.1	88.7	0	0	112.5	A21	E17-A21 WeakPolarHBondContact O-CB 3.16Å; E17-A21 PolarHBondContact O-N 2.96Å
18	Q	56.3	Low	55.4	Low	176 Å²	176	111.4 Å²	111.4	82%	0.822	62%	0.617	S	S	*	*	H	α-helix	trans	-71.6	-36.1	173.3	-73.3	179.6	22.3	0	0	112.6	G16 W22	G16-Q18 PolarHBondContact O-N 3.38Å; Q18-W22 WeakPolarHBondContact O-CB 3.34Å; Q18-W22 PolarHBondContact O-N 3.21Å
19	A	54.5	Low	55.8	Low	47 Å²	47	113 Å²	113	39%	0.388	61%	0.611	S	S	.	*	H	α-helix	trans	-70.4	-38.6	176.9	0	0	0	0	0	111.7	V12 G16 W22 L23	V12-A19 HydrophobicContact CG1-CB 3.9Å; G16-A19 CarbonylContact O-C 3.54Å; G16-A19 PolarHBondContact O-N 3.25Å; G16-A19 WeakPolarHBondContact O-CA 3.35Å; A19-W22 PolarHBondContact O-N 3.32Å; A19-L23 WeakPolarHBondContact O-CB 3.49Å; A19-L23 PolarHBondContact O-N 3.42Å; A19-L23 WeakPolarHBondContact O-CG 3.38Å; A19-L23 WeakPolarHBondContact O-CD1 3.28Å
20	A	58	Low	56.5	Low	38 Å²	38	112.5 Å²	112.5	31%	0.314	61%	0.605	S	S	.	*	H	α-helix	trans	-64.2	-42.3	174.4	0	0	0	0	0	111.1	V12 G16 L23 A24	V12-A20 HydrophobicContact CG1-CB 4.31Å; V12-A20 HydrophobicContact CG2-CB 4.08Å; G16-A20 WeakPolarHBondContact O-CB 3.42Å; G16-A20 PolarHBondContact O-N 3.32Å; A20-L23 PolarHBondContact O-N 2.76Å; A20-A24 WeakPolarHBondContact O-CB 3.39Å; A20-A24 PolarHBondContact O-N 2.92Å
21	A	57.2	Low	57	Low	57 Å²	57	112.6 Å²	112.6	47%	0.471	60%	0.598	S	S	.	*	H	α-helix	trans	-67.1	-37.8	175.7	0	0	0	0	0	112.8	E17 L23 A24 T25	E17-A21 WeakPolarHBondContact O-CB 3.16Å; E17-A21 PolarHBondContact O-N 2.96Å; A21-L23 VanDerWaalsContact C-N 3.33Å; A21-A24 PolarHBondContact O-N 2.74Å; A21-T25 PolarHBondContact O-OG1 3.5Å; A21-T25 PolarHBondContact O-N 3.37Å
22	W	54.4	Low	57.8	Low	152 Å²	152	106.4 Å²	106.4	58%	0.576	58%	0.576	S	S	*	*	H	α-helix	trans	-68.5	-32.6	175.6	-155.8	84.8	0	0	0	112.5	Q18 A19 T25 R26	Q18-W22 WeakPolarHBondContact O-CB 3.34Å; Q18-W22 PolarHBondContact O-N 3.21Å; A19-W22 PolarHBondContact O-N 3.32Å; W22-T25 PolarHBondContact O-OG1 3.36Å; W22-R26 VanDerWaalsContact CZ2-CZ 3.48Å; W22-R26 PolarHBondContact O-N 2.9Å
23	L	57.9	Low	58.1	Low	59 Å²	59	108.1 Å²	108.1	31%	0.309	58%	0.579	S	S	.	*	H	α-helix	trans	-80.3	-35.4	174.7	-70	167.2	0	0	0	112.6	L10 A19 A20 A21 T25 R26	L10-L23 HydrophobicContact CB-CD1 4.44Å; L10-L23 HydrophobicContact CD2-CD1 3.89Å; A19-L23 WeakPolarHBondContact O-CB 3.49Å; A19-L23 PolarHBondContact O-N 3.42Å; A19-L23 WeakPolarHBondContact O-CG 3.38Å; A19-L23 WeakPolarHBondContact O-CD1 3.28Å; A20-L23 PolarHBondContact O-N 2.76Å; A21-L23 VanDerWaalsContact C-N 3.33Å; L23-T25 PolarHBondContact O-N 2.83Å; L23-R26 CarbonylContact O-C 3.43Å; L23-R26 PolarHBondContact O-N 3.29Å; L23-R26 VanDerWaalsContact O-O 3.05Å
24	A	57.4	Low	58	Low	79 Å²	79	108.3 Å²	108.3	65%	0.653	58%	0.577	S	S	*	*	H	α-helix	trans	-64.1	-30.3	178.5	0	0	0	0	0	112.3	A20 A21	A20-A24 WeakPolarHBondContact O-CB 3.39Å; A20-A24 PolarHBondContact O-N 2.92Å; A21-A24 PolarHBondContact O-N 2.74Å
25	T	54.4	Low	58.1	Low	104 Å²	104	112.5 Å²	112.5	64%	0.638	59%	0.585	S	S	*	*	H	α-helix	trans	-87.8	-23.3	176.3	43.9	0	0	0	0	113.2	A21 W22 L23 H27	A21-T25 PolarHBondContact O-OG1 3.5Å; A21-T25 PolarHBondContact O-N 3.37Å; W22-T25 PolarHBondContact O-OG1 3.36Å; L23-T25 PolarHBondContact O-N 2.83Å; T25-H27 PolarHBondContact O-N 2.71Å
26	R	56.4	Low	58.2	Low	153 Å²	153	114.1 Å²	114.1	58%	0.577	57%	0.572	S	S	*	*	S	Bend	trans	-90.5	83.8	171.6	-79.7	-178	167.7	-154	-0.5	109.5	W22 L23 L28	W22-R26 VanDerWaalsContact CZ2-CZ 3.48Å; W22-R26 PolarHBondContact O-N 2.9Å; L23-R26 CarbonylContact O-C 3.43Å; L23-R26 PolarHBondContact O-N 3.29Å; L23-R26 VanDerWaalsContact O-O 3.05Å; R26-L28 PolarHBondContact O-N 3.24Å
27	H	58.5	Low	58.4	Low	147 Å²	147	119.6 Å²	119.6	68%	0.681	60%	0.597	S	S	*	*			trans	-30	110.4	166.6	-66.1	-71.5	0	0	0	111.2	T25 R29	T25-H27 PolarHBondContact O-N 2.71Å; H27-R29 HydrophobicContact CB-CG 4.04Å; H27-R29 PolarHBondContact O-N 3.05Å
28	L	64.3	Low	58.5	Low	111 Å²	111	116.4 Å²	116.4	58%	0.581	59%	0.585	S	S	*	*			trans	-64.6	72.3	171.3	-74.7	174.1	0	0	0	108.6	A6 R26	A6-L28 HydrophobicContact CB-CG 4.29Å; A6-L28 HydrophobicContact CB-CD2 4.33Å; A6-L28 HydrophobicContact CB-CB 3.54Å; A6-L28 HydrophobicContact CB-CD1 4.33Å; R26-L28 PolarHBondContact O-N 3.24Å
29	R	61.9	Low	58.6	Low	190 Å²	190	112.9 Å²	112.9	72%	0.717	57%	0.571	S	S	*	*			trans	-71.9	137.3	179.1	-62.2	-160.1	-164	-163.5	5.9	107.8	H27 Y31	H27-R29 HydrophobicContact CB-CG 4.04Å; H27-R29 PolarHBondContact O-N 3.05Å; R29-Y31 PolarHBondContact O-N 2.99Å
30	P	64.8	Low	58.9	Low	90 Å²	90	117.1 Å²	117.1	58%	0.584	58%	0.582	S	S	*	*			trans	-54.1	121.8	169.2	24.1	-32.3	0	0	0	107.5
31	Y	64.1	Low	58.9	Low	122 Å²	122	122.3 Å²	122.3	48%	0.478	60%	0.6	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.2	135.2	175.8	67.6	-83.9	0	0	0	107.5	V4 R29 Q33	V4-Y31 HydrophobicContact CG2-CD2 4.27Å; V4-Y31 PolarHBondContact N-O 3.27Å; V4-Y31 WeakPolarHBondContact CG2-O 3.35Å; V4-Y31 HydrophobicContact CG2-CG 4.39Å; V4-Y31 HydrophobicContact CG2-CE2 3.83Å; V4-Y31 HydrophobicContact CG2-CE1 3.67Å; V4-Y31 HydrophobicContact CG2-CD1 4.12Å; R29-Y31 PolarHBondContact O-N 2.99Å; Y31-Q33 HydrophobicContact CD2-CG 3.77Å; Y31-Q33 HydrophobicContact CE2-CG 3.5Å; Y31-Q33 VanDerWaalsContact CE2-CG 3.5Å
32	C	69.8	Low	59	Low	63 Å²	63	127 Å²	127	43%	0.426	61%	0.609	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.3	117.7	-179.4	-49.1	0	0	0	0	108.9	I1 A2 C3	I1-C32 HydrophobicContact CG2-CB 3.27Å; A2-C32 WeakPolarHBondContact O-CA 3.14Å; C3-C32 HydrophobicContact CB-CB 4.04Å; C3-C32 WeakPolarHBondContact CB-SG 3.14Å; C3-C32 WeakPolarHBondContact SG-CB 3.4Å; C3-C32 CovalentContact SG-SG 2.06Å; C3-C32 PolarHBondContact SG-SG 3.01Å
33	Q	59.6	Low	59.4	Low	105 Å²	105	125.1 Å²	125.1	49%	0.491	61%	0.612	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.7	137.1	173.8	-67.6	-164.2	-31.8	0	0	109.2	A2 Y31 R35	A2-Q33 PolarHBondContact O-N 3.28Å; A2-Q33 PolarHBondContact N-O 2.06Å; Y31-Q33 HydrophobicContact CD2-CG 3.77Å; Y31-Q33 HydrophobicContact CE2-CG 3.5Å; Y31-Q33 VanDerWaalsContact CE2-CG 3.5Å; Q33-R35 PolarHBondContact O-N 2.99Å
34	P	46.5	Very low	59.5	Low	109 Å²	109	130.6 Å²	130.6	71%	0.708	64%	0.637	S	S	*	*	P	Polyproline II helix	trans	-59	137.7	159.3	27.4	-29.7	0	0	0	107.2
35	R	56.8	Low	59.7	Low	294 Å²	294	135.3 Å²	135.3	100%	1.109	64%	0.635	S	S	*	*			trans	-63.3	0	169.8	-88.2	-165.5	177.1	-161.4	0.6	109.6	Q33	Q33-R35 PolarHBondContact O-N 2.99Å

Retrieved 35 of 35 residues in 8.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).