A0A096M3Y3_POEFO Loading...

RING-type domain-containing protein

AlphaFold DB , UniProt , Accession A0A096M3Y3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 76 aa.

						>A0A096M3Y3_POEFO|A0A096M3Y3
MEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQLCSLTKHEDNDKDK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.5	Very low	81.5	Confident	241 Å²	241	91 Å²	91	100%	1.187	43%	0.428	S	S	*	.				0	132	0	-76.7	176.8	-169.6	0	0	107.5
2	E	58.7	Low	82.9	Confident	186 Å²	186	91.9 Å²	91.9	87%	0.869	43%	0.432	S	S	*	.			trans	-65.7	132.5	175.8	-150.3	174.4	-174	0	0	108.7
3	K	64.9	Low	84.1	Confident	133 Å²	133	87.5 Å²	87.5	58%	0.578	42%	0.417	S	S	*	.			trans	-62.3	139.9	179.1	-69.3	-166.8	-179.1	-154	0	109.5	R5 D59	K3-R5 VanDerWaalsContact C-N 3.29Å; K3-R5 PolarHBondContact O-N 2.98Å; K3-D59 WeakPolarHBondContact CE-OD2 3.5Å; K3-D59 IonicContact NZ-OD2 2.85Å; K3-D59 PolarHBondContact NZ-OD2 3.42Å
4	L	69.3	Low	85.1	Confident	50 Å²	50	87.1 Å²	87.1	26%	0.262	43%	0.428	S	S	.	.			trans	-66	84	179.8	-166.2	85.7	0	0	0	110.3	A7 C18	L4-A7 HydrophobicContact CD2-CB 3.51Å; L4-A7 HydrophobicContact CG-CB 3.97Å; L4-C18 VanDerWaalsContact CD1-SG 3.51Å
5	R	75.6	Confident	86	Confident	187 Å²	187	88.7 Å²	88.7	71%	0.706	43%	0.432	S	S	*	.			trans	-90.6	141.8	174.8	-69	-172.8	179.6	-175	0.7	110.5	K3	K3-R5 VanDerWaalsContact C-N 3.29Å; K3-R5 PolarHBondContact O-N 2.98Å
6	D	90.7	Very high	86.6	Confident	67 Å²	67	88.1 Å²	88.1	36%	0.358	43%	0.43	S	S	.	.	S	Bend	trans	52.1	59.3	-176.4	-165.8	1.2	0	0	0	111.5	R8 F19	D6-R8 VanDerWaalsContact CG-NH2 3.33Å; D6-R8 PolarHBondContact O-N 3.35Å; D6-R8 IonicContact OD1-CZ 3.93Å; D6-R8 IonicContact OD1-NE 3.92Å; D6-R8 PolarHBondContact OD1-NE 3.39Å; D6-R8 IonicContact OD1-NH2 3.04Å; D6-R8 PolarHBondContact OD1-NH2 3.08Å; D6-R8 IonicContact OD2-CZ 2.69Å; D6-R8 IonicContact OD2-NE 2.8Å; D6-R8 IonicContact OD2-NH2 3.14Å; D6-R8 PolarHBondContact OD2-NH2 3.44Å; D6-F19 HydrophobicContact CB-CB 3.86Å; D6-F19 VanDerWaalsContact CG-CB 3.47Å; D6-F19 VanDerWaalsContact O-CB 3.24Å; D6-F19 WeakPolarHBondContact O-CB 3.39Å; D6-F19 PolarHBondContact O-N 3.33Å; D6-F19 WeakPolarHBondContact OD2-CB 3.46Å; D6-F19 WeakPolarHBondContact OD2-CD1 3.23Å; D6-F19 WeakPolarHBondContact OD2-CG 3.37Å
7	A	95.8	Very high	87.1	Confident	4 Å²	4	84.6 Å²	84.6	3%	0.033	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.8	132.9	-178.1	0	0	0	0	0	111.3	L4 L16 C17 C48 A51	L4-A7 HydrophobicContact CD2-CB 3.51Å; L4-A7 HydrophobicContact CG-CB 3.97Å; A7-L16 HydrophobicContact CB-CD2 4.4Å; A7-C17 WeakPolarHBondContact CA-O 3.41Å; A7-C48 HydrophobicContact CB-CB 4.21Å; A7-C48 PolarHBondContact O-N 2.89Å; A7-A51 HydrophobicContact CB-CB 3.46Å; A7-A51 VanDerWaalsContact CB-CB 3.46Å
8	R	97.7	Very high	87.5	Confident	39 Å²	39	81.4 Å²	81.4	15%	0.147	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	143.3	177.9	-59.6	-58.7	171.2	143.9	3.4	111	D6 L16 C17 F19 I22 L45 V46	D6-R8 VanDerWaalsContact CG-NH2 3.33Å; D6-R8 PolarHBondContact O-N 3.35Å; D6-R8 IonicContact OD1-CZ 3.93Å; D6-R8 IonicContact OD1-NE 3.92Å; D6-R8 PolarHBondContact OD1-NE 3.39Å; D6-R8 IonicContact OD1-NH2 3.04Å; D6-R8 PolarHBondContact OD1-NH2 3.08Å; D6-R8 IonicContact OD2-CZ 2.69Å; D6-R8 IonicContact OD2-NE 2.8Å; D6-R8 IonicContact OD2-NH2 3.14Å; D6-R8 PolarHBondContact OD2-NH2 3.44Å; R8-L16 CarbonylContact O-C 3.41Å; R8-L16 VanDerWaalsContact O-CA 3.3Å; R8-L16 WeakPolarHBondContact O-CA 3.37Å; R8-C17 PolarHBondContact N-O 3.41Å; R8-C17 PolarHBondContact O-N 3.33Å; R8-C17 PolarHBondContact O-SG 3.15Å; R8-F19 HydrophobicContact CG-CB 3.79Å; R8-F19 HydrophobicContact CG-CD2 3.85Å; R8-F19 HydrophobicContact CG-CG 4.26Å; R8-I22 HydrophobicContact CB-CG2 4.24Å; R8-I22 HydrophobicContact CG-CG2 4.32Å; R8-L45 HydrophobicContact CB-CB 4.22Å; R8-L45 HydrophobicContact CB-CD1 4.33Å; R8-L45 HydrophobicContact CB-CD2 4.25Å; R8-L45 HydrophobicContact CG-CD1 4.45Å; R8-V46 VanDerWaalsContact CA-O 3.31Å; R8-V46 WeakPolarHBondContact CA-O 3.23Å
9	L	98.1	Very high	87.9	Confident	32 Å²	32	79.6 Å²	79.6	17%	0.168	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	131.7	179.7	178.4	144.8	0	0	0	110.6	S14 K15 L16 V46 C48	L9-S14 WeakPolarHBondContact CD1-O 3.37Å; L9-K15 WeakPolarHBondContact CA-O 3.5Å; L9-L16 HydrophobicContact CB-CD2 4.08Å; L9-L16 HydrophobicContact CD1-CD2 4.31Å; L9-V46 HydrophobicContact CB-CB 4.27Å; L9-V46 HydrophobicContact CD2-CB 4.24Å; L9-V46 HydrophobicContact CD2-CG2 4.31Å; L9-V46 PolarHBondContact N-O 2.8Å; L9-V46 PolarHBondContact O-N 3.17Å; L9-C48 WeakPolarHBondContact CB-SG 3.44Å
10	C	98.3	Very high	88.3	Confident	4 Å²	4	78.8 Å²	78.8	3%	0.027	40%	0.395	C	S	.	.			trans	-71.7	125.9	171.8	176.7	0	0	0	0	109.8	H12 S14 K15	C10-H12 PolarHBondContact O-N 2.95Å; C10-S14 VanDerWaalsContact O-CA 3.28Å; C10-S14 WeakPolarHBondContact O-CA 3.39Å; C10-S14 PolarHBondContact O-N 3.25Å; C10-K15 PolarHBondContact N-O 3.36Å
11	P	98.4	Very high	88.6	Confident	58 Å²	58	78 Å²	78	38%	0.377	40%	0.397	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.3	-18.6	-178.6	28	-35.9	0	0	0	113.7	L40 E44	P11-L40 HydrophobicContact CG-CD1 4.08Å; P11-E44 HydrophobicContact CG-CB 4.4Å
12	H	98.4	Very high	90.8	Very high	102 Å²	102	66.7 Å²	66.7	47%	0.472	34%	0.341	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89	-32	-177	-56.5	-61.6	0	0	0	114.2	C10 A38 P39	C10-H12 PolarHBondContact O-N 2.95Å; H12-A38 HydrophobicContact CB-CB 3.98Å; H12-P39 PolarHBondContact NE2-O 3.46Å
13	C	98.5	Very high	92.6	Very high	35 Å²	35	64 Å²	64	24%	0.236	32%	0.323	C	S	.	.	T	Hydrogen-bonded Turn	trans	-133.1	4.1	-174.3	68.2	0	0	0	0	114.2	K15 C36	C13-K15 PolarHBondContact O-N 2.98Å; C13-C36 HydrophobicContact CB-CB 3.65Å; C13-C36 VanDerWaalsContact SG-SG 3.63Å
14	S	97.8	Very high	94.2	Very high	82 Å²	82	64.8 Å²	64.8	57%	0.573	32%	0.322	S	S	*	.			trans	58.5	12.2	176.7	-50.8	0	0	0	0	115.3	L9 C10	L9-S14 WeakPolarHBondContact CD1-O 3.37Å; C10-S14 VanDerWaalsContact O-CA 3.28Å; C10-S14 WeakPolarHBondContact O-CA 3.39Å; C10-S14 PolarHBondContact O-N 3.25Å
15	K	97.9	Very high	95.5	Very high	111 Å²	111	67 Å²	67	48%	0.483	33%	0.328	S	S	.	.			trans	-70.3	135.5	174.7	-77.7	-65.5	-170.7	179.6	0	111.1	L9 C10 C13 H35	L9-K15 WeakPolarHBondContact CA-O 3.5Å; C10-K15 PolarHBondContact N-O 3.36Å; C13-K15 PolarHBondContact O-N 2.98Å; K15-H35 HydrophobicContact CB-CB 4.39Å; K15-H35 WeakPolarHBondContact CE-NE2 3.47Å; K15-H35 HydrophobicContact CG-CB 4.07Å
16	L	96.4	Very high	96.5	Very high	78 Å²	78	59.2 Å²	59.2	41%	0.408	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.8	148.1	174.8	-71	165.2	0	0	0	111.3	A7 R8 L9 C48	A7-L16 HydrophobicContact CB-CD2 4.4Å; R8-L16 CarbonylContact O-C 3.41Å; R8-L16 VanDerWaalsContact O-CA 3.3Å; R8-L16 WeakPolarHBondContact O-CA 3.37Å; L9-L16 HydrophobicContact CB-CD2 4.08Å; L9-L16 HydrophobicContact CD1-CD2 4.31Å; L16-C48 HydrophobicContact CD2-CB 3.99Å
17	C	94.8	Very high	96.7	Very high	29 Å²	29	61.4 Å²	61.4	20%	0.196	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.2	160	175.8	54.8	0	0	0	0	110.1	A7 R8 I22	A7-C17 WeakPolarHBondContact CA-O 3.41Å; R8-C17 PolarHBondContact N-O 3.41Å; R8-C17 PolarHBondContact O-N 3.33Å; R8-C17 PolarHBondContact O-SG 3.15Å; C17-I22 HydrophobicContact CB-CB 4.45Å; C17-I22 VanDerWaalsContact SG-CB 3.57Å
18	C	94.7	Very high	96.8	Very high	28 Å²	28	67.2 Å²	67.2	19%	0.189	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.7	144	171.7	-40.7	0	0	0	0	110.1	L4 S20 C21 I22	L4-C18 VanDerWaalsContact CD1-SG 3.51Å; C18-S20 VanDerWaalsContact C-N 3.33Å; C18-S20 PolarHBondContact O-N 3.42Å; C18-C21 HydrophobicContact CB-CB 4.12Å; C18-C21 PolarHBondContact O-N 3.31Å; C18-I22 WeakPolarHBondContact O-CG2 3.34Å; C18-I22 PolarHBondContact O-N 2.96Å
19	F	95.5	Very high	96.5	Very high	47 Å²	47	71.3 Å²	71.3	21%	0.206	36%	0.363	C	S	.	.	H	α-helix	trans	-57.4	-43.2	176.4	-179.5	-126.9	0	0	0	113	D6 R8 C21 I22 R23 L42	D6-F19 HydrophobicContact CB-CB 3.86Å; D6-F19 VanDerWaalsContact CG-CB 3.47Å; D6-F19 VanDerWaalsContact O-CB 3.24Å; D6-F19 WeakPolarHBondContact O-CB 3.39Å; D6-F19 PolarHBondContact O-N 3.33Å; D6-F19 WeakPolarHBondContact OD2-CB 3.46Å; D6-F19 WeakPolarHBondContact OD2-CD1 3.23Å; D6-F19 WeakPolarHBondContact OD2-CG 3.37Å; R8-F19 HydrophobicContact CG-CB 3.79Å; R8-F19 HydrophobicContact CG-CD2 3.85Å; R8-F19 HydrophobicContact CG-CG 4.26Å; F19-C21 VanDerWaalsContact C-N 3.34Å; F19-C21 PolarHBondContact O-N 3.43Å; F19-I22 WeakPolarHBondContact O-CG2 3.34Å; F19-I22 PolarHBondContact O-N 3.23Å; F19-R23 WeakPolarHBondContact O-CB 3.28Å; F19-R23 PolarHBondContact O-N 3.4Å; F19-L42 HydrophobicContact CD2-CD1 4.46Å; F19-L42 HydrophobicContact CE2-CD1 3.81Å; F19-L42 HydrophobicContact CE2-CD2 4.21Å; F19-L42 HydrophobicContact CE2-CG 4.07Å; F19-L42 HydrophobicContact CZ-CD2 4.32Å
20	S	95.1	Very high	96.3	Very high	62 Å²	62	77.8 Å²	77.8	43%	0.434	39%	0.385	S	S	.	.	H	α-helix	trans	-59.2	-44.7	177.3	54.9	0	0	0	0	112	C18 R24	C18-S20 VanDerWaalsContact C-N 3.33Å; C18-S20 PolarHBondContact O-N 3.42Å; S20-R24 WeakPolarHBondContact O-CB 3.38Å; S20-R24 PolarHBondContact O-N 2.81Å
21	C	95.2	Very high	96.2	Very high	64 Å²	64	80.5 Å²	80.5	43%	0.432	41%	0.408	S	S	.	.	H	α-helix	trans	-64.9	-50.2	-179.9	-61.2	0	0	0	0	111.8	C18 F19 R24 W25	C18-C21 HydrophobicContact CB-CB 4.12Å; C18-C21 PolarHBondContact O-N 3.31Å; F19-C21 VanDerWaalsContact C-N 3.34Å; F19-C21 PolarHBondContact O-N 3.43Å; C21-R24 PolarHBondContact O-N 3.18Å; C21-W25 WeakPolarHBondContact O-CB 3.46Å; C21-W25 PolarHBondContact O-N 3.21Å
22	I	96.1	Very high	96.2	Very high	3 Å²	3	81.3 Å²	81.3	2%	0.015	41%	0.407	C	S	.	.	H	α-helix	trans	-71.7	-33.4	-178	-166.7	60.8	0	0	0	112.1	R8 C17 C18 F19 W25 L26 P34 L45	R8-I22 HydrophobicContact CB-CG2 4.24Å; R8-I22 HydrophobicContact CG-CG2 4.32Å; C17-I22 HydrophobicContact CB-CB 4.45Å; C17-I22 VanDerWaalsContact SG-CB 3.57Å; C18-I22 WeakPolarHBondContact O-CG2 3.34Å; C18-I22 PolarHBondContact O-N 2.96Å; F19-I22 WeakPolarHBondContact O-CG2 3.34Å; F19-I22 PolarHBondContact O-N 3.23Å; I22-W25 HydrophobicContact CD1-CB 4.47Å; I22-W25 PolarHBondContact O-N 3.15Å; I22-L26 HydrophobicContact CD1-CD1 4.49Å; I22-L26 HydrophobicContact CD1-CG 4.23Å; I22-L26 HydrophobicContact CG1-CD1 4.05Å; I22-L26 HydrophobicContact CG1-CG 4.22Å; I22-L26 WeakPolarHBondContact O-CB 3.31Å; I22-L26 VanDerWaalsContact O-CG 3.27Å; I22-L26 WeakPolarHBondContact O-CG 3.49Å; I22-L26 PolarHBondContact O-N 3.42Å; I22-P34 HydrophobicContact CD1-CG 4.05Å; I22-L45 HydrophobicContact CB-CD1 4.31Å; I22-L45 HydrophobicContact CG1-CD1 3.84Å; I22-L45 HydrophobicContact CG1-CD2 4.04Å; I22-L45 HydrophobicContact CG2-CD1 3.46Å; I22-L45 VanDerWaalsContact CG2-CD1 3.46Å
23	R	96.7	Very high	96.2	Very high	128 Å²	128	76.8 Å²	76.8	48%	0.483	39%	0.386	S	S	.	.	H	α-helix	trans	-60.8	-48.3	171.7	-173.8	-179.7	73.7	-178.9	3	110.9	F19 W25 L26 T27 L42	F19-R23 WeakPolarHBondContact O-CB 3.28Å; F19-R23 PolarHBondContact O-N 3.4Å; R23-W25 VanDerWaalsContact C-N 3.34Å; R23-W25 PolarHBondContact O-N 3.2Å; R23-L26 PolarHBondContact O-N 3.06Å; R23-T27 WeakPolarHBondContact O-CB 3.14Å; R23-T27 PolarHBondContact O-N 3.38Å; R23-T27 PolarHBondContact O-OG1 3.1Å; R23-L42 HydrophobicContact CB-CD1 3.83Å; R23-L42 HydrophobicContact CG-CD1 3.99Å; R23-L42 HydrophobicContact CG-CD2 4.11Å
24	R	96.6	Very high	96.1	Very high	150 Å²	150	78.3 Å²	78.3	57%	0.566	40%	0.396	S	S	*	.	H	α-helix	trans	-57.3	-48.9	175.9	-170.9	-179.8	-66.6	144.7	1.8	111	S20 C21 L26 T27 E28	S20-R24 WeakPolarHBondContact O-CB 3.38Å; S20-R24 PolarHBondContact O-N 2.81Å; C21-R24 PolarHBondContact O-N 3.18Å; R24-L26 PolarHBondContact O-N 3.32Å; R24-T27 PolarHBondContact O-N 3.34Å; R24-E28 WeakPolarHBondContact CD-OE2 3.45Å; R24-E28 HydrophobicContact CG-CG 4.18Å; R24-E28 WeakPolarHBondContact CG-OE1 3.43Å; R24-E28 WeakPolarHBondContact CG-OE2 3.3Å; R24-E28 VanDerWaalsContact O-CB 3.28Å; R24-E28 WeakPolarHBondContact O-CB 3.4Å; R24-E28 PolarHBondContact O-N 3.39Å
25	W	97	Very high	96.1	Very high	98 Å²	98	79.7 Å²	79.7	37%	0.371	39%	0.393	S	S	.	.	H	α-helix	trans	-58.6	-49.1	180	-179.6	-90	0	0	0	113	C21 I22 R23 T27 Q29 R30 Q32 P34	C21-W25 WeakPolarHBondContact O-CB 3.46Å; C21-W25 PolarHBondContact O-N 3.21Å; I22-W25 HydrophobicContact CD1-CB 4.47Å; I22-W25 PolarHBondContact O-N 3.15Å; R23-W25 VanDerWaalsContact C-N 3.34Å; R23-W25 PolarHBondContact O-N 3.2Å; W25-T27 VanDerWaalsContact C-N 3.31Å; W25-T27 PolarHBondContact O-N 3.24Å; W25-Q29 HydrophobicContact CD2-CB 4.15Å; W25-Q29 HydrophobicContact CD2-CG 4.35Å; W25-Q29 HydrophobicContact CE3-CB 4.2Å; W25-Q29 HydrophobicContact CE3-CG 3.96Å; W25-Q29 HydrophobicContact CZ3-CB 4.48Å; W25-Q29 HydrophobicContact CZ3-CG 4.25Å; W25-Q29 WeakPolarHBondContact O-CA 3.33Å; W25-Q29 VanDerWaalsContact O-CB 3.31Å; W25-Q29 WeakPolarHBondContact O-CB 3.24Å; W25-Q29 PolarHBondContact O-N 3.16Å; W25-R30 PolarHBondContact O-N 2.95Å; W25-Q32 PolarHBondContact NE1-O 3.42Å; W25-P34 HydrophobicContact CD2-CB 4.07Å; W25-P34 HydrophobicContact CG-CB 4.49Å; W25-P34 HydrophobicContact CH2-CB 4.44Å; W25-P34 HydrophobicContact CZ2-CB 3.92Å
26	L	97.2	Very high	96.1	Very high	22 Å²	22	76.8 Å²	76.8	12%	0.115	39%	0.386	C	S	.	.	H	α-helix	trans	-69.3	-29.3	-177.6	-66.4	178.3	0	0	0	112.9	I22 R23 R24 L40 L42 L45	I22-L26 HydrophobicContact CD1-CD1 4.49Å; I22-L26 HydrophobicContact CD1-CG 4.23Å; I22-L26 HydrophobicContact CG1-CD1 4.05Å; I22-L26 HydrophobicContact CG1-CG 4.22Å; I22-L26 WeakPolarHBondContact O-CB 3.31Å; I22-L26 VanDerWaalsContact O-CG 3.27Å; I22-L26 WeakPolarHBondContact O-CG 3.49Å; I22-L26 PolarHBondContact O-N 3.42Å; R23-L26 PolarHBondContact O-N 3.06Å; R24-L26 PolarHBondContact O-N 3.32Å; L26-L40 HydrophobicContact CD1-CD2 4.45Å; L26-L40 HydrophobicContact CD1-CG 4.35Å; L26-L40 HydrophobicContact CD2-CB 4.23Å; L26-L40 HydrophobicContact CD2-CD2 4.41Å; L26-L40 HydrophobicContact CD2-CG 4.42Å; L26-L40 WeakPolarHBondContact CD2-O 3.44Å; L26-L42 HydrophobicContact CD1-CD1 4.27Å; L26-L45 HydrophobicContact CD1-CD1 4.28Å
27	T	95.6	Very high	96.2	Very high	113 Å²	113	82.3 Å²	82.3	69%	0.693	40%	0.402	S	S	*	.	H	α-helix	trans	-86.3	-41.5	179.1	-57	0	0	0	0	113	R23 R24 W25	R23-T27 WeakPolarHBondContact O-CB 3.14Å; R23-T27 PolarHBondContact O-N 3.38Å; R23-T27 PolarHBondContact O-OG1 3.1Å; R24-T27 PolarHBondContact O-N 3.34Å; W25-T27 VanDerWaalsContact C-N 3.31Å; W25-T27 PolarHBondContact O-N 3.24Å
28	E	96.2	Very high	96.4	Very high	126 Å²	126	82.1 Å²	82.1	59%	0.589	40%	0.402	S	S	*	.	H	α-helix	trans	-99.1	-22.4	-170.1	-63.2	175.4	-166	0	0	113.8	R24	R24-E28 WeakPolarHBondContact CD-OE2 3.45Å; R24-E28 HydrophobicContact CG-CG 4.18Å; R24-E28 WeakPolarHBondContact CG-OE1 3.43Å; R24-E28 WeakPolarHBondContact CG-OE2 3.3Å; R24-E28 VanDerWaalsContact O-CB 3.28Å; R24-E28 WeakPolarHBondContact O-CB 3.4Å; R24-E28 PolarHBondContact O-N 3.39Å
29	Q	91.6	Very high	96.5	Very high	126 Å²	126	85.5 Å²	85.5	59%	0.589	42%	0.423	S	S	*	.	T	Hydrogen-bonded Turn	trans	-112.4	-78.3	-173.8	-58.3	-63.7	-36.5	0	0	111.4	W25	W25-Q29 HydrophobicContact CD2-CB 4.15Å; W25-Q29 HydrophobicContact CD2-CG 4.35Å; W25-Q29 HydrophobicContact CE3-CB 4.2Å; W25-Q29 HydrophobicContact CE3-CG 3.96Å; W25-Q29 HydrophobicContact CZ3-CB 4.48Å; W25-Q29 HydrophobicContact CZ3-CG 4.25Å; W25-Q29 WeakPolarHBondContact O-CA 3.33Å; W25-Q29 VanDerWaalsContact O-CB 3.31Å; W25-Q29 WeakPolarHBondContact O-CB 3.24Å; W25-Q29 PolarHBondContact O-N 3.16Å
30	R	94.1	Very high	96.7	Very high	168 Å²	168	83.3 Å²	83.3	63%	0.634	41%	0.414	S	S	*	.			trans	-153	142.5	-174.9	-66.4	-172.4	171.4	-177.3	-3.3	110.4	W25 Q32	W25-R30 PolarHBondContact O-N 2.95Å; R30-Q32 PolarHBondContact O-N 2.98Å
31	A	96.6	Very high	96.8	Very high	61 Å²	61	84.6 Å²	84.6	50%	0.504	41%	0.413	S	S	.	.	S	Bend	trans	-75.2	51.8	173.1	0	0	0	0	0	112.4	L40	A31-L40 CarbonylContact C-O 3.53Å; A31-L40 PolarHBondContact O-N 2.92Å
32	Q	98.2	Very high	96.9	Very high	75 Å²	75	84.7 Å²	84.7	35%	0.35	41%	0.409	S	S	.	.	B	Isolated β-bridge	trans	-141.2	147.4	-178.8	-69.6	172.6	5	0	0	109.7	W25 R30 A38	W25-Q32 PolarHBondContact NE1-O 3.42Å; R30-Q32 PolarHBondContact O-N 2.98Å; Q32-A38 CarbonylContact C-O 3.49Å; Q32-A38 VanDerWaalsContact CA-O 3.23Å; Q32-A38 WeakPolarHBondContact CA-O 3.17Å
33	C	98	Very high	96.9	Very high	6 Å²	6	94.3 Å²	94.3	4%	0.041	45%	0.445	C	S	.	.			trans	-58	131.5	172.9	-178.9	0	0	0	0	110.8	H35 C36 R37 A38 L40	C33-H35 PolarHBondContact O-N 2.9Å; C33-H35 VanDerWaalsContact O-N 3.15Å; C33-H35 PolarHBondContact SG-N 2.7Å; C33-H35 VanDerWaalsContact SG-N 3.43Å; C33-C36 WeakPolarHBondContact CB-SG 3.2Å; C33-C36 VanDerWaalsContact SG-SG 3.68Å; C33-R37 VanDerWaalsContact O-CA 3.23Å; C33-R37 WeakPolarHBondContact O-CA 3.28Å; C33-R37 PolarHBondContact O-N 3.21Å; C33-A38 PolarHBondContact N-O 3.3Å; C33-L40 HydrophobicContact CB-CD2 3.99Å
34	P	97.3	Very high	97	Very high	68 Å²	68	91.7 Å²	91.7	44%	0.442	44%	0.438	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.8	-21	178	25.4	-34.5	0	0	0	113.2	I22 W25	I22-P34 HydrophobicContact CD1-CG 4.05Å; W25-P34 HydrophobicContact CD2-CB 4.07Å; W25-P34 HydrophobicContact CG-CB 4.49Å; W25-P34 HydrophobicContact CH2-CB 4.44Å; W25-P34 HydrophobicContact CZ2-CB 3.92Å
35	H	98.1	Very high	97.1	Very high	110 Å²	110	85.2 Å²	85.2	51%	0.509	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	-93.4	-63.8	-179.2	-178.5	-95.6	0	0	0	112.5	K15 C33	K15-H35 HydrophobicContact CB-CB 4.39Å; K15-H35 WeakPolarHBondContact CE-NE2 3.47Å; K15-H35 HydrophobicContact CG-CB 4.07Å; C33-H35 PolarHBondContact O-N 2.9Å; C33-H35 VanDerWaalsContact O-N 3.15Å; C33-H35 PolarHBondContact SG-N 2.7Å; C33-H35 VanDerWaalsContact SG-N 3.43Å
36	C	98.2	Very high	97.1	Very high	50 Å²	50	84 Å²	84	34%	0.338	42%	0.418	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.6	-5.8	-174	66.8	0	0	0	0	114.5	C13 C33 A38	C13-C36 HydrophobicContact CB-CB 3.65Å; C13-C36 VanDerWaalsContact SG-SG 3.63Å; C33-C36 WeakPolarHBondContact CB-SG 3.2Å; C33-C36 VanDerWaalsContact SG-SG 3.68Å; C36-A38 PolarHBondContact O-N 2.93Å
37	R	97.7	Very high	97.2	Very high	195 Å²	195	85.4 Å²	85.4	74%	0.736	43%	0.426	S	S	*	.			trans	61	4.5	-178.7	-50.4	179.1	-178.3	-163.3	-0.4	115.4	C33	C33-R37 VanDerWaalsContact O-CA 3.23Å; C33-R37 WeakPolarHBondContact O-CA 3.28Å; C33-R37 PolarHBondContact O-N 3.21Å
38	A	98.2	Very high	97.2	Very high	24 Å²	24	80.3 Å²	80.3	20%	0.198	40%	0.395	C	S	.	.			trans	-59.4	144.2	171.1	0	0	0	0	0	110.1	H12 Q32 C33 C36 L40	H12-A38 HydrophobicContact CB-CB 3.98Å; Q32-A38 CarbonylContact C-O 3.49Å; Q32-A38 VanDerWaalsContact CA-O 3.23Å; Q32-A38 WeakPolarHBondContact CA-O 3.17Å; C33-A38 PolarHBondContact N-O 3.3Å; C36-A38 PolarHBondContact O-N 2.93Å; A38-L40 PolarHBondContact O-N 3.08Å
39	P	98.3	Very high	97.1	Very high	99 Å²	99	84.3 Å²	84.3	64%	0.643	40%	0.404	S	S	*	.	B	Isolated β-bridge	trans	-51.6	136.3	171	-23.8	33.9	0	0	0	110.3	H12	H12-P39 PolarHBondContact NE2-O 3.46Å
40	L	98.3	Very high	97.3	Very high	2 Å²	2	85.2 Å²	85.2	1%	0.01	40%	0.402	C	S	.	.			trans	-151.7	131.9	-175.1	-174.3	65.8	0	0	0	110.7	P11 L26 A31 C33 A38 E44 L45	P11-L40 HydrophobicContact CG-CD1 4.08Å; L26-L40 HydrophobicContact CD1-CD2 4.45Å; L26-L40 HydrophobicContact CD1-CG 4.35Å; L26-L40 HydrophobicContact CD2-CB 4.23Å; L26-L40 HydrophobicContact CD2-CD2 4.41Å; L26-L40 HydrophobicContact CD2-CG 4.42Å; L26-L40 WeakPolarHBondContact CD2-O 3.44Å; A31-L40 CarbonylContact C-O 3.53Å; A31-L40 PolarHBondContact O-N 2.92Å; C33-L40 HydrophobicContact CB-CD2 3.99Å; A38-L40 PolarHBondContact O-N 3.08Å; L40-E44 HydrophobicContact CD1-CB 4.09Å; L40-L45 HydrophobicContact CD2-CD2 3.96Å
41	Q	97.8	Very high	97.3	Very high	89 Å²	89	77.4 Å²	77.4	42%	0.416	37%	0.374	S	S	.	.			trans	-113	157.1	171.4	-54.3	-175.6	8.8	0	0	111.5	R43 E44	Q41-R43 HydrophobicContact CB-CG 4.43Å; Q41-R43 PolarHBondContact O-N 3.23Å; Q41-R43 VanDerWaalsContact O-N 3.16Å; Q41-E44 HydrophobicContact CB-CG 4.34Å; Q41-E44 WeakPolarHBondContact CB-OE1 3.23Å; Q41-E44 VanDerWaalsContact CG-OE1 3.28Å; Q41-E44 WeakPolarHBondContact CG-OE1 3.46Å; Q41-E44 PolarHBondContact N-OE1 2.69Å; Q41-E44 WeakPolarHBondContact O-CB 3.16Å; Q41-E44 PolarHBondContact O-N 3.01Å
42	L	96.8	Very high	97	Very high	66 Å²	66	80.7 Å²	80.7	35%	0.346	38%	0.379	S	S	.	.	G	3₁₀ helix	trans	-57.5	-36.2	-174.4	-164.1	72.9	0	0	0	113.1	F19 R23 L26 E44 L45	F19-L42 HydrophobicContact CD2-CD1 4.46Å; F19-L42 HydrophobicContact CE2-CD1 3.81Å; F19-L42 HydrophobicContact CE2-CD2 4.21Å; F19-L42 HydrophobicContact CE2-CG 4.07Å; F19-L42 HydrophobicContact CZ-CD2 4.32Å; R23-L42 HydrophobicContact CB-CD1 3.83Å; R23-L42 HydrophobicContact CG-CD1 3.99Å; R23-L42 HydrophobicContact CG-CD2 4.11Å; L26-L42 HydrophobicContact CD1-CD1 4.27Å; L42-E44 VanDerWaalsContact C-N 3.25Å; L42-E44 PolarHBondContact O-N 2.96Å; L42-L45 HydrophobicContact CD1-CD1 3.85Å; L42-L45 WeakPolarHBondContact O-CB 3.43Å; L42-L45 PolarHBondContact O-N 3.21Å
43	R	97.5	Very high	96.7	Very high	205 Å²	205	82 Å²	82	77%	0.774	39%	0.385	S	S	*	.	G	3₁₀ helix	trans	-70	-19.1	-179.8	66.2	175.6	179.2	-107.8	-0.6	114.2	Q41 L45	Q41-R43 HydrophobicContact CB-CG 4.43Å; Q41-R43 PolarHBondContact O-N 3.23Å; Q41-R43 VanDerWaalsContact O-N 3.16Å; R43-L45 VanDerWaalsContact C-N 3.32Å
44	E	97.9	Very high	96.6	Very high	73 Å²	73	85.5 Å²	85.5	34%	0.341	41%	0.406	S	S	.	.	G	3₁₀ helix	trans	-85.2	-12.4	-178.3	-59.2	175.9	-108.7	0	0	111.9	P11 L40 Q41 L42 V46	P11-E44 HydrophobicContact CG-CB 4.4Å; L40-E44 HydrophobicContact CD1-CB 4.09Å; Q41-E44 HydrophobicContact CB-CG 4.34Å; Q41-E44 WeakPolarHBondContact CB-OE1 3.23Å; Q41-E44 VanDerWaalsContact CG-OE1 3.28Å; Q41-E44 WeakPolarHBondContact CG-OE1 3.46Å; Q41-E44 PolarHBondContact N-OE1 2.69Å; Q41-E44 WeakPolarHBondContact O-CB 3.16Å; Q41-E44 PolarHBondContact O-N 3.01Å; L42-E44 VanDerWaalsContact C-N 3.25Å; L42-E44 PolarHBondContact O-N 2.96Å; E44-V46 PolarHBondContact O-N 3.11Å
45	L	98.1	Very high	96.3	Very high	13 Å²	13	84 Å²	84	7%	0.068	40%	0.395	C	S	.	.			trans	-68.5	127.6	178.6	-70.4	168.4	0	0	0	111.3	R8 I22 L26 L40 L42 R43	R8-L45 HydrophobicContact CB-CB 4.22Å; R8-L45 HydrophobicContact CB-CD1 4.33Å; R8-L45 HydrophobicContact CB-CD2 4.25Å; R8-L45 HydrophobicContact CG-CD1 4.45Å; I22-L45 HydrophobicContact CB-CD1 4.31Å; I22-L45 HydrophobicContact CG1-CD1 3.84Å; I22-L45 HydrophobicContact CG1-CD2 4.04Å; I22-L45 HydrophobicContact CG2-CD1 3.46Å; I22-L45 VanDerWaalsContact CG2-CD1 3.46Å; L26-L45 HydrophobicContact CD1-CD1 4.28Å; L40-L45 HydrophobicContact CD2-CD2 3.96Å; L42-L45 HydrophobicContact CD1-CD1 3.85Å; L42-L45 WeakPolarHBondContact O-CB 3.43Å; L42-L45 PolarHBondContact O-N 3.21Å; R43-L45 VanDerWaalsContact C-N 3.32Å
46	V	98.2	Very high	96	Very high	73 Å²	73	84 Å²	84	44%	0.442	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	129.4	174.9	-178.3	0	0	0	0	109	R8 L9 E44 C48	R8-V46 VanDerWaalsContact CA-O 3.31Å; R8-V46 WeakPolarHBondContact CA-O 3.23Å; L9-V46 HydrophobicContact CB-CB 4.27Å; L9-V46 HydrophobicContact CD2-CB 4.24Å; L9-V46 HydrophobicContact CD2-CG2 4.31Å; L9-V46 PolarHBondContact N-O 2.8Å; L9-V46 PolarHBondContact O-N 3.17Å; E44-V46 PolarHBondContact O-N 3.11Å; V46-C48 PolarHBondContact O-N 3.43Å
47	N	97.6	Very high	95.8	Very high	52 Å²	52	86.5 Å²	86.5	28%	0.278	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	112.6	170.9	-172.8	-30	0	0	0	109.8	R49	N47-R49 VanDerWaalsContact C-N 3.34Å; N47-R49 PolarHBondContact O-N 3.06Å; N47-R49 VanDerWaalsContact O-N 3.1Å; N47-R49 PolarHBondContact OD1-N 2.92Å
48	C	96.6	Very high	95.6	Very high	6 Å²	6	81.5 Å²	81.5	4%	0.041	39%	0.39	C	S	.	.			trans	-86.2	75.7	177.1	-69.2	0	0	0	0	110.5	A7 L9 L16 V46 W50 A51	A7-C48 HydrophobicContact CB-CB 4.21Å; A7-C48 PolarHBondContact O-N 2.89Å; L9-C48 WeakPolarHBondContact CB-SG 3.44Å; L16-C48 HydrophobicContact CD2-CB 3.99Å; V46-C48 PolarHBondContact O-N 3.43Å; C48-W50 HydrophobicContact CB-CZ2 4.33Å; C48-W50 PolarHBondContact O-N 3.38Å; C48-W50 VanDerWaalsContact O-N 3.08Å; C48-A51 HydrophobicContact CB-CB 3.97Å; C48-A51 VanDerWaalsContact O-CB 3.23Å; C48-A51 WeakPolarHBondContact O-CB 3.4Å; C48-A51 PolarHBondContact O-N 3.07Å
49	R	95.1	Very high	95.2	Very high	209 Å²	209	82.8 Å²	82.8	79%	0.789	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	-25	-178.1	-59.7	-179.7	-174.2	-85.3	2.5	114.2	N47	N47-R49 VanDerWaalsContact C-N 3.34Å; N47-R49 PolarHBondContact O-N 3.06Å; N47-R49 VanDerWaalsContact O-N 3.1Å; N47-R49 PolarHBondContact OD1-N 2.92Å
50	W	94.1	Very high	95	Very high	145 Å²	145	81.4 Å²	81.4	55%	0.549	38%	0.383	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.9	-12.2	178.7	53.3	-101	0	0	0	113.7	C48 E52 E53 V54	C48-W50 HydrophobicContact CB-CZ2 4.33Å; C48-W50 PolarHBondContact O-N 3.38Å; C48-W50 VanDerWaalsContact O-N 3.08Å; W50-E52 VanDerWaalsContact C-N 3.28Å; W50-E52 PolarHBondContact O-N 3.41Å; W50-E53 PolarHBondContact O-N 3.37Å; W50-V54 HydrophobicContact CE3-CB 4.29Å; W50-V54 HydrophobicContact CE3-CG2 3.72Å; W50-V54 HydrophobicContact CZ3-CB 4.49Å; W50-V54 HydrophobicContact CZ3-CG2 4.17Å; W50-V54 PolarHBondContact O-N 3.02Å; W50-V54 VanDerWaalsContact O-N 3.15Å
51	A	93.9	Very high	94.8	Very high	4 Å²	4	86.6 Å²	86.6	3%	0.033	41%	0.41	C	S	.	.	H	α-helix	trans	-66.5	-30.8	-172.2	0	0	0	0	0	112.9	A7 C48 T55	A7-A51 HydrophobicContact CB-CB 3.46Å; A7-A51 VanDerWaalsContact CB-CB 3.46Å; C48-A51 HydrophobicContact CB-CB 3.97Å; C48-A51 VanDerWaalsContact O-CB 3.23Å; C48-A51 WeakPolarHBondContact O-CB 3.4Å; C48-A51 PolarHBondContact O-N 3.07Å; A51-T55 WeakPolarHBondContact O-CB 3.4Å; A51-T55 PolarHBondContact O-N 2.85Å; A51-T55 PolarHBondContact O-OG1 2.78Å
52	E	91.1	Very high	94.5	Very high	131 Å²	131	87.7 Å²	87.7	61%	0.612	42%	0.416	S	S	*	.	H	α-helix	trans	-64.6	-50	177.5	-177	165.3	-155.7	0	0	111.3	W50 V54 T55 Q56	W50-E52 VanDerWaalsContact C-N 3.28Å; W50-E52 PolarHBondContact O-N 3.41Å; E52-V54 PolarHBondContact O-N 3.48Å; E52-T55 PolarHBondContact O-N 2.9Å; E52-Q56 PolarHBondContact O-N 3.22Å
53	E	92.8	Very high	94.2	Very high	102 Å²	102	89.9 Å²	89.9	48%	0.477	43%	0.427	S	S	.	.	H	α-helix	trans	-57.4	-48.5	175.7	-179.3	59.7	-141.7	0	0	111.2	W50 T55 Q56 Q57	W50-E53 PolarHBondContact O-N 3.37Å; E53-T55 VanDerWaalsContact C-N 3.31Å; E53-T55 PolarHBondContact O-N 3.16Å; E53-Q56 WeakPolarHBondContact O-CB 3.27Å; E53-Q56 PolarHBondContact O-N 2.78Å; E53-Q56 VanDerWaalsContact O-N 3.17Å; E53-Q57 WeakPolarHBondContact O-CG 3.48Å; E53-Q57 PolarHBondContact O-N 3.3Å; E53-Q57 PolarHBondContact OE1-NE2 2.87Å
54	V	94.1	Very high	93.8	Very high	80 Å²	80	83 Å²	83	49%	0.485	41%	0.41	S	S	.	.	H	α-helix	trans	-61.4	-40.6	179	171.8	0	0	0	0	111.7	W50 E52 Q56 Q57 L58	W50-V54 HydrophobicContact CE3-CB 4.29Å; W50-V54 HydrophobicContact CE3-CG2 3.72Å; W50-V54 HydrophobicContact CZ3-CB 4.49Å; W50-V54 HydrophobicContact CZ3-CG2 4.17Å; W50-V54 PolarHBondContact O-N 3.02Å; W50-V54 VanDerWaalsContact O-N 3.15Å; E52-V54 PolarHBondContact O-N 3.48Å; V54-Q56 VanDerWaalsContact C-N 3.34Å; V54-Q57 PolarHBondContact O-N 3.04Å; V54-L58 WeakPolarHBondContact O-CB 3.4Å; V54-L58 PolarHBondContact O-N 2.8Å
55	T	92.3	Very high	93.1	Very high	36 Å²	36	83.3 Å²	83.3	22%	0.221	42%	0.42	C	S	.	.	H	α-helix	trans	-67.5	-37.6	178	-54.2	0	0	0	0	111	A51 E52 E53 L58 D59	A51-T55 WeakPolarHBondContact O-CB 3.4Å; A51-T55 PolarHBondContact O-N 2.85Å; A51-T55 PolarHBondContact O-OG1 2.78Å; E52-T55 PolarHBondContact O-N 2.9Å; E53-T55 VanDerWaalsContact C-N 3.31Å; E53-T55 PolarHBondContact O-N 3.16Å; T55-L58 PolarHBondContact O-N 3.44Å; T55-D59 PolarHBondContact O-N 2.97Å
56	Q	91.4	Very high	92	Very high	110 Å²	110	88.1 Å²	88.1	51%	0.514	45%	0.445	S	S	.	.	H	α-helix	trans	-63.9	-45.5	175.6	-177.5	173.7	0.6	0	0	112	E52 E53 V54 L58 D59 T60	E52-Q56 PolarHBondContact O-N 3.22Å; E53-Q56 WeakPolarHBondContact O-CB 3.27Å; E53-Q56 PolarHBondContact O-N 2.78Å; E53-Q56 VanDerWaalsContact O-N 3.17Å; V54-Q56 VanDerWaalsContact C-N 3.34Å; Q56-L58 VanDerWaalsContact C-N 3.28Å; Q56-L58 PolarHBondContact O-N 3.2Å; Q56-D59 PolarHBondContact O-N 2.97Å; Q56-T60 PolarHBondContact O-N 2.92Å; Q56-T60 VanDerWaalsContact O-N 3.08Å; Q56-T60 PolarHBondContact O-OG1 2.88Å
57	Q	94	Very high	90.8	Very high	102 Å²	102	88.2 Å²	88.2	48%	0.477	45%	0.446	S	S	.	.	H	α-helix	trans	-62.6	-37.6	175.5	-64.1	-62.3	-27.2	0	0	111.5	E53 V54 T60 L61	E53-Q57 WeakPolarHBondContact O-CG 3.48Å; E53-Q57 PolarHBondContact O-N 3.3Å; E53-Q57 PolarHBondContact OE1-NE2 2.87Å; V54-Q57 PolarHBondContact O-N 3.04Å; Q57-T60 WeakPolarHBondContact O-CB 3.31Å; Q57-T60 PolarHBondContact O-N 2.87Å; Q57-L61 WeakPolarHBondContact O-CG 3.47Å; Q57-L61 PolarHBondContact O-N 2.89Å
58	L	92.8	Very high	89.2	Confident	90 Å²	90	93.4 Å²	93.4	47%	0.471	47%	0.466	S	S	.	.	H	α-helix	trans	-65.5	-42.9	176.1	-171.1	64.1	0	0	0	112.1	V54 T55 Q56 T60 L61 Q62	V54-L58 WeakPolarHBondContact O-CB 3.4Å; V54-L58 PolarHBondContact O-N 2.8Å; T55-L58 PolarHBondContact O-N 3.44Å; Q56-L58 VanDerWaalsContact C-N 3.28Å; Q56-L58 PolarHBondContact O-N 3.2Å; L58-T60 VanDerWaalsContact C-N 3.28Å; L58-T60 PolarHBondContact O-N 3.36Å; L58-L61 PolarHBondContact O-N 3.5Å; L58-Q62 WeakPolarHBondContact O-CG 3.28Å; L58-Q62 PolarHBondContact O-N 3.02Å
59	D	91.5	Very high	87.5	Confident	52 Å²	52	99.8 Å²	99.8	28%	0.278	50%	0.495	S	S	.	.	H	α-helix	trans	-57.6	-43.2	174.1	-72.7	-16	0	0	0	110.7	K3 T55 Q56 Q62 L63	K3-D59 WeakPolarHBondContact CE-OD2 3.5Å; K3-D59 IonicContact NZ-OD2 2.85Å; K3-D59 PolarHBondContact NZ-OD2 3.42Å; T55-D59 PolarHBondContact O-N 2.97Å; Q56-D59 PolarHBondContact O-N 2.97Å; D59-Q62 PolarHBondContact O-N 3.15Å; D59-L63 PolarHBondContact O-N 3.47Å
60	T	93.4	Very high	85.8	Confident	70 Å²	70	96.7 Å²	96.7	43%	0.429	49%	0.489	S	S	.	.	H	α-helix	trans	-62.1	-45.9	175.9	-61.3	0	0	0	0	112	Q56 Q57 L58 Q62 L63 C64	Q56-T60 PolarHBondContact O-N 2.92Å; Q56-T60 VanDerWaalsContact O-N 3.08Å; Q56-T60 PolarHBondContact O-OG1 2.88Å; Q57-T60 WeakPolarHBondContact O-CB 3.31Å; Q57-T60 PolarHBondContact O-N 2.87Å; L58-T60 VanDerWaalsContact C-N 3.28Å; L58-T60 PolarHBondContact O-N 3.36Å; T60-Q62 VanDerWaalsContact C-N 3.32Å; T60-Q62 PolarHBondContact O-N 2.89Å; T60-L63 PolarHBondContact O-N 3.44Å; T60-C64 PolarHBondContact O-N 2.99Å; T60-C64 PolarHBondContact O-SG 3.35Å; T60-C64 VanDerWaalsContact O-SG 3.35Å
61	L	93.8	Very high	84.1	Confident	110 Å²	110	95.4 Å²	95.4	58%	0.576	49%	0.493	S	S	*	.	H	α-helix	trans	-62.3	-38.6	178	-73.7	172.8	0	0	0	112.5	Q57 L58 S65	Q57-L61 WeakPolarHBondContact O-CG 3.47Å; Q57-L61 PolarHBondContact O-N 2.89Å; L58-L61 PolarHBondContact O-N 3.5Å; L61-S65 PolarHBondContact O-N 2.82Å; L61-S65 PolarHBondContact O-OG 3.43Å
62	Q	91.3	Very high	82.3	Confident	113 Å²	113	101.5 Å²	101.5	53%	0.528	53%	0.525	S	S	.	.	H	α-helix	trans	-65.9	-42	175.6	-72.8	-175.4	-24.5	0	0	111.3	L58 D59 T60 S65 L66	L58-Q62 WeakPolarHBondContact O-CG 3.28Å; L58-Q62 PolarHBondContact O-N 3.02Å; D59-Q62 PolarHBondContact O-N 3.15Å; T60-Q62 VanDerWaalsContact C-N 3.32Å; T60-Q62 PolarHBondContact O-N 2.89Å; Q62-S65 WeakPolarHBondContact O-CB 3.36Å; Q62-S65 PolarHBondContact O-N 3.05Å; Q62-L66 PolarHBondContact O-N 3.37Å
63	L	90.3	Very high	80.7	Confident	111 Å²	111	101 Å²	101	58%	0.581	53%	0.527	S	S	*	.	H	α-helix	trans	-63.8	-44.1	177	-170.9	64.7	0	0	0	112.3	D59 T60 S65 L66 T67	D59-L63 PolarHBondContact O-N 3.47Å; T60-L63 PolarHBondContact O-N 3.44Å; L63-S65 PolarHBondContact O-N 3.46Å; L63-L66 PolarHBondContact O-N 2.95Å; L63-L66 VanDerWaalsContact O-N 3.15Å; L63-T67 PolarHBondContact O-N 2.93Å; L63-T67 VanDerWaalsContact O-N 3.11Å
64	C	89.1	Confident	78.9	Confident	62 Å²	62	105 Å²	105	42%	0.419	54%	0.543	S	S	.	.	H	α-helix	trans	-62.5	-26.1	175.7	-69.2	0	0	0	0	113.3	T60 T67 K68	T60-C64 PolarHBondContact O-N 2.99Å; T60-C64 PolarHBondContact O-SG 3.35Å; T60-C64 VanDerWaalsContact O-SG 3.35Å; C64-T67 PolarHBondContact O-OG1 3.04Å; C64-K68 WeakPolarHBondContact O-CG 3.15Å
65	S	82.9	Confident	77.1	Confident	78 Å²	78	107.9 Å²	107.9	55%	0.545	56%	0.555	S	S	.	*	H	α-helix	trans	-76.5	-33.8	177.5	-56.7	0	0	0	0	111.5	L61 Q62 L63	L61-S65 PolarHBondContact O-N 2.82Å; L61-S65 PolarHBondContact O-OG 3.43Å; Q62-S65 WeakPolarHBondContact O-CB 3.36Å; Q62-S65 PolarHBondContact O-N 3.05Å; L63-S65 PolarHBondContact O-N 3.46Å
66	L	76.6	Confident	75.1	Confident	115 Å²	115	118 Å²	118	60%	0.602	60%	0.596	S	S	*	*	H	α-helix	trans	-71.6	-43.5	176.3	-68.6	164.6	0	0	0	111.8	Q62 L63 K68 H69 E70	Q62-L66 PolarHBondContact O-N 3.37Å; L63-L66 PolarHBondContact O-N 2.95Å; L63-L66 VanDerWaalsContact O-N 3.15Å; L66-K68 VanDerWaalsContact C-N 3.28Å; L66-K68 PolarHBondContact O-N 3.02Å; L66-H69 PolarHBondContact O-N 3.21Å; L66-E70 PolarHBondContact O-N 3.36Å
67	T	73.1	Confident	74.3	Confident	74 Å²	74	118.4 Å²	118.4	45%	0.454	60%	0.6	S	S	.	*	H	α-helix	trans	-63.4	-32.8	179.6	55.6	0	0	0	0	113	L63 C64 H69	L63-T67 PolarHBondContact O-N 2.93Å; L63-T67 VanDerWaalsContact O-N 3.11Å; C64-T67 PolarHBondContact O-OG1 3.04Å; T67-H69 VanDerWaalsContact C-N 3.28Å; T67-H69 PolarHBondContact O-N 2.99Å
68	K	63.3	Low	73.3	Confident	162 Å²	162	119.3 Å²	119.3	70%	0.704	61%	0.607	S	S	*	*	H	α-helix	trans	-67.5	-26.5	174.7	-74.3	179.2	179.6	-175.3	0	113.7	C64 L66	C64-K68 WeakPolarHBondContact O-CG 3.15Å; L66-K68 VanDerWaalsContact C-N 3.28Å; L66-K68 PolarHBondContact O-N 3.02Å
69	H	61.8	Low	72.2	Confident	139 Å²	139	120.9 Å²	120.9	64%	0.644	61%	0.614	S	S	*	*	H	α-helix	trans	-83.4	-28.3	-177.6	-150.2	-65.3	0	0	0	112.2	L66 T67	L66-H69 PolarHBondContact O-N 3.21Å; T67-H69 VanDerWaalsContact C-N 3.28Å; T67-H69 PolarHBondContact O-N 2.99Å
70	E	58	Low	71	Confident	144 Å²	144	124.9 Å²	124.9	67%	0.673	63%	0.634	S	S	*	*	H	α-helix	trans	-75.2	-32.7	176.6	-66.2	-171.6	133.3	0	0	112.9	L66	L66-E70 PolarHBondContact O-N 3.36Å
71	D	58	Low	69.7	Low	118 Å²	118	128.4 Å²	128.4	63%	0.631	65%	0.647	S	S	*	*	H	α-helix	trans	-67	-39.9	175.4	-123.4	-93.8	0	0	0	111.3	D73 K74	D71-D73 VanDerWaalsContact C-N 3.31Å; D71-D73 PolarHBondContact O-N 3.43Å; D71-K74 PolarHBondContact O-N 2.83Å
72	N	57.2	Low	68	Low	132 Å²	132	129.6 Å²	129.6	71%	0.706	65%	0.652	S	S	*	*	H	α-helix	trans	-75.6	-15.1	-174.9	-148.1	45.8	0	0	0	114.2
73	D	56.3	Low	66.4	Low	121 Å²	121	130.8 Å²	130.8	65%	0.647	66%	0.66	S	S	*	*	H	α-helix	trans	-91.4	-21.3	177.7	-148.8	-99.6	0	0	0	112.1	D71 D75	D71-D73 VanDerWaalsContact C-N 3.31Å; D71-D73 PolarHBondContact O-N 3.43Å; D73-D75 VanDerWaalsContact C-N 3.34Å
74	K	55.9	Low	64.5	Low	187 Å²	187	132.3 Å²	132.3	81%	0.813	67%	0.667	S	S	*	*	H	α-helix	trans	-77.8	-17.4	176.3	-89.5	-178.8	173.1	174.4	0	114.3	D71	D71-K74 PolarHBondContact O-N 2.83Å
75	D	56.2	Low	62.5	Low	140 Å²	140	138.2 Å²	138.2	75%	0.749	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.4	14.5	179.5	-78.9	-34.6	0	0	0	113.7	D73	D73-D75 VanDerWaalsContact C-N 3.34Å
76	K	50.8	Low	60.7	Low	248 Å²	248	143.6 Å²	143.6	100%	1.078	70%	0.7	S	S	*	*			trans	-115.5	0	177.7	-164.3	177.9	-179.9	-175.3	0	114

Retrieved 76 of 76 residues in 18.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).