A0A096M5R9_POEFO Loading...

Component of oligomeric golgi complex 5

AlphaFold DB , UniProt , Accession A0A096M5R9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 140 aa.

						>A0A096M5R9_POEFO|A0A096M5R9
MEDGKEVSTNSLLKDECYSDFLDEDFDVKTYTAQAIHHAVIAEQLAKLAQGISQLDKELHSQVVARHEDLLAQATGIESLEGVLQMMQTRISALQAAVERMRTKIVDPYNKIVGRITQLARLQVSLNIIYVIVNYVLQCC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39	Very low	51.5	Low	243 Å²	243	127.4 Å²	127.4	100%	1.197	70%	0.703	S	S	*	*				0	76.5	0	-77.2	176.3	170.3	0	0	106.6
2	E	44.1	Very low	52.5	Low	195 Å²	195	125.2 Å²	125.2	91%	0.911	69%	0.688	S	S	*	*			trans	-154.6	77.5	-173.9	-101.9	172.9	139.3	0	0	106.4
3	D	41.1	Very low	53.3	Low	137 Å²	137	121.9 Å²	121.9	73%	0.733	67%	0.669	S	S	*	*	S	Bend	trans	-152.1	-8.4	175.7	-150.5	16.7	0	0	0	112.8
4	G	49.3	Very low	54.3	Low	72 Å²	72	125.8 Å²	125.8	74%	0.742	68%	0.676	S	S	*	*	S	Bend	trans	-93.9	-5.4	-177.6	0	0	0	0	0	115.7
5	K	50	Low	55.5	Low	183 Å²	183	123.4 Å²	123.4	80%	0.796	66%	0.663	S	S	*	*	S	Bend	trans	-100.7	-27.8	-171.8	-154.3	170.4	-175.9	177	0	113.6
6	E	49	Very low	56.5	Low	142 Å²	142	126.4 Å²	126.4	66%	0.664	67%	0.672	S	S	*	*	H	α-helix	trans	-79.6	-24.5	-179.3	-65.5	-167.9	161.2	0	0	113.8	T9 N10	E6-T9 PolarHBondContact O-OG1 3.35Å; E6-T9 VanDerWaalsContact O-OG1 3.1Å; E6-N10 PolarHBondContact O-N 3.08Å; E6-N10 PolarHBondContact O-ND2 2.68Å
7	V	52.4	Low	57.4	Low	105 Å²	105	123.9 Å²	123.9	64%	0.636	67%	0.665	S	S	*	*	H	α-helix	trans	-72.7	-34.3	-179.5	-176.7	0	0	0	0	111.5	S11	V7-S11 PolarHBondContact O-N 2.93Å
8	S	55.9	Low	58.3	Low	83 Å²	83	122.1 Å²	122.1	58%	0.58	65%	0.648	S	S	*	*	H	α-helix	trans	-80.6	-24.3	-177.4	-166.6	0	0	0	0	113.7	S11	S8-S11 PolarHBondContact O-OG 3.01Å
9	T	58.8	Low	59.2	Low	76 Å²	76	118.8 Å²	118.8	47%	0.466	64%	0.636	S	S	.	*	H	α-helix	trans	-80.1	-39.8	175.7	51.3	0	0	0	0	110.8	E6 S11 L12 L13	E6-T9 PolarHBondContact O-OG1 3.35Å; E6-T9 VanDerWaalsContact O-OG1 3.1Å; T9-S11 VanDerWaalsContact C-N 3.27Å; T9-S11 PolarHBondContact O-N 3.15Å; T9-L12 PolarHBondContact O-N 2.95Å; T9-L13 WeakPolarHBondContact O-CG 3.28Å; T9-L13 PolarHBondContact O-N 2.61Å
10	N	62.3	Low	60	Low	90 Å²	90	117.4 Å²	117.4	48%	0.481	63%	0.628	S	S	.	*	H	α-helix	trans	-65	-25.7	176.4	-86.7	-69.1	0	0	0	114.1	E6 K14	E6-N10 PolarHBondContact O-N 3.08Å; E6-N10 PolarHBondContact O-ND2 2.68Å; N10-K14 WeakPolarHBondContact O-CG 3.46Å
11	S	64.3	Low	60.9	Low	75 Å²	75	116.1 Å²	116.1	52%	0.524	62%	0.618	S	S	.	*	H	α-helix	trans	-76	-31.9	174.1	53.8	0	0	0	0	113	V7 S8 T9	V7-S11 PolarHBondContact O-N 2.93Å; S8-S11 PolarHBondContact O-OG 3.01Å; T9-S11 VanDerWaalsContact C-N 3.27Å; T9-S11 PolarHBondContact O-N 3.15Å
12	L	63.6	Low	62.7	Low	101 Å²	101	109.1 Å²	109.1	53%	0.529	58%	0.584	S	S	.	*	H	α-helix	trans	-72.7	-37.1	178.8	-163.8	78.1	0	0	0	111.2	T9 K14 D15 Y18	T9-L12 PolarHBondContact O-N 2.95Å; L12-K14 PolarHBondContact O-N 3.18Å; L12-D15 WeakPolarHBondContact O-CB 3.3Å; L12-D15 PolarHBondContact O-N 3.17Å; L12-Y18 HydrophobicContact CG-CE2 4.11Å; L12-Y18 WeakPolarHBondContact O-CD2 3.39Å
13	L	62.5	Low	64.4	Low	83 Å²	83	105 Å²	105	44%	0.435	57%	0.569	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73.9	-3.9	178.7	-63.4	177.5	0	0	0	114.2	T9 L22	T9-L13 WeakPolarHBondContact O-CG 3.28Å; T9-L13 PolarHBondContact O-N 2.61Å; L13-L22 HydrophobicContact CB-CD1 4.11Å; L13-L22 HydrophobicContact CD2-CD2 4.22Å; L13-L22 WeakPolarHBondContact O-CD1 3.24Å
14	K	67.4	Low	66	Low	176 Å²	176	107.8 Å²	107.8	77%	0.765	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	-3.4	174.5	-74.8	177.7	-177.3	-175.5	0	113.6	N10 L12	N10-K14 WeakPolarHBondContact O-CG 3.46Å; L12-K14 PolarHBondContact O-N 3.18Å
15	D	72.2	Confident	67.3	Low	90 Å²	90	111.6 Å²	111.6	48%	0.481	58%	0.581	S	S	.	*	S	Bend	trans	-72.8	132.7	175.3	-158.4	-37.5	0	0	0	109.2	L12 C17 Y18	L12-D15 WeakPolarHBondContact O-CB 3.3Å; L12-D15 PolarHBondContact O-N 3.17Å; D15-C17 PolarHBondContact O-N 3.22Å; D15-C17 PolarHBondContact OD1-N 3.31Å; D15-Y18 HydrophobicContact CB-CD2 3.86Å; D15-Y18 HydrophobicContact CB-CE2 4.2Å; D15-Y18 PolarHBondContact O-N 3.23Å
16	E	71.7	Confident	68.8	Low	172 Å²	172	106 Å²	106	80%	0.804	56%	0.557	S	S	*	*	G	3₁₀ helix	trans	-55.6	-24.4	178.7	-90.1	-178.3	154.7	0	0	112	Y18 S19	E16-Y18 PolarHBondContact O-N 2.95Å; E16-S19 PolarHBondContact O-N 2.98Å; E16-S19 PolarHBondContact O-OG 3.04Å
17	C	72.1	Confident	70.3	Confident	83 Å²	83	102.7 Å²	102.7	56%	0.561	54%	0.543	S	S	*	.	G	3₁₀ helix	trans	-62.8	-24.9	175.3	-170.9	0	0	0	0	113.6	D15	D15-C17 PolarHBondContact O-N 3.22Å; D15-C17 PolarHBondContact OD1-N 3.31Å
18	Y	73.1	Confident	71.7	Confident	91 Å²	91	101.9 Å²	101.9	36%	0.357	54%	0.538	S	S	.	.	G	3₁₀ helix	trans	-103.6	-2.8	-178.4	-58.4	-68.8	0	0	0	114	L12 D15 E16 D20 F21 L22	L12-Y18 HydrophobicContact CG-CE2 4.11Å; L12-Y18 WeakPolarHBondContact O-CD2 3.39Å; D15-Y18 HydrophobicContact CB-CD2 3.86Å; D15-Y18 HydrophobicContact CB-CE2 4.2Å; D15-Y18 PolarHBondContact O-N 3.23Å; E16-Y18 PolarHBondContact O-N 2.95Å; Y18-D20 VanDerWaalsContact C-N 3.27Å; Y18-D20 PolarHBondContact O-N 3.25Å; Y18-F21 HydrophobicContact CD1-CD2 4.44Å; Y18-F21 PolarHBondContact O-N 3.48Å; Y18-F21 VanDerWaalsContact O-N 3.09Å; Y18-L22 WeakPolarHBondContact O-CG 3.21Å; Y18-L22 PolarHBondContact O-N 2.93Å
19	S	75.4	Confident	73	Confident	61 Å²	61	105.7 Å²	105.7	43%	0.427	55%	0.545	S	S	.	.	G	3₁₀ helix	trans	-60.5	-37.7	-176.1	58.3	0	0	0	0	112.6	E16 F21 L22	E16-S19 PolarHBondContact O-N 2.98Å; E16-S19 PolarHBondContact O-OG 3.04Å; S19-F21 PolarHBondContact O-N 3.49Å; S19-L22 PolarHBondContact O-N 3.41Å; S19-L22 VanDerWaalsContact O-N 3.16Å
20	D	75.4	Confident	74.2	Confident	89 Å²	89	106 Å²	106	48%	0.476	55%	0.546	S	S	.	.	G	3₁₀ helix	trans	-65.4	-29.9	179.6	-65.2	-3.9	0	0	0	112	Y18 L22 F26 Y31	Y18-D20 VanDerWaalsContact C-N 3.27Å; Y18-D20 PolarHBondContact O-N 3.25Å; D20-L22 VanDerWaalsContact C-N 3.34Å; D20-F26 WeakPolarHBondContact O-CD2 3.19Å; D20-Y31 HydrophobicContact CB-CD2 4.49Å; D20-Y31 HydrophobicContact CB-CE2 4.09Å
21	F	78.1	Confident	75.3	Confident	92 Å²	92	105.5 Å²	105.5	40%	0.404	54%	0.538	S	S	.	.	G	3₁₀ helix	trans	-83.8	-10.9	179.2	-61.1	-87.1	0	0	0	113.3	Y18 S19 F26 Y31	Y18-F21 HydrophobicContact CD1-CD2 4.44Å; Y18-F21 PolarHBondContact O-N 3.48Å; Y18-F21 VanDerWaalsContact O-N 3.09Å; S19-F21 PolarHBondContact O-N 3.49Å; F21-F26 AromaticContact CD1-CE1 3.84Å; F21-F26 HydrophobicContact CD1-CE1 3.84Å; F21-F26 AromaticContact CD1-CE2 3.75Å; F21-F26 HydrophobicContact CD1-CE2 3.75Å; F21-F26 AromaticContact CD1-CZ 3.27Å; F21-F26 HydrophobicContact CD1-CZ 3.27Å; F21-F26 HydrophobicContact CE1-CE1 4.45Å; F21-F26 HydrophobicContact CE1-CE2 4.13Å; F21-F26 AromaticContact CE1-CZ 3.61Å; F21-F26 HydrophobicContact CE1-CZ 3.61Å; F21-F26 HydrophobicContact CG-CE2 4.34Å; F21-F26 HydrophobicContact CG-CZ 4.24Å; F21-Y31 HydrophobicContact CE1-CD1 4.22Å; F21-Y31 AromaticContact CE1-CE1 3.88Å; F21-Y31 HydrophobicContact CE1-CE1 3.88Å; F21-Y31 HydrophobicContact CE2-CE1 4.36Å; F21-Y31 HydrophobicContact CE2-CE2 4.48Å; F21-Y31 AromaticContact CE2-CZ 3.9Å; F21-Y31 HydrophobicContact CZ-CD1 4.25Å; F21-Y31 AromaticContact CZ-CE1 3.46Å; F21-Y31 HydrophobicContact CZ-CE1 3.46Å; F21-Y31 VanDerWaalsContact CZ-CE1 3.46Å; F21-Y31 HydrophobicContact CZ-CE2 4.27Å; F21-Y31 AromaticContact CZ-CZ 3.46Å; F21-Y31 VanDerWaalsContact CZ-CZ 3.46Å; F21-Y31 WeakPolarHBondContact CZ-OH 3.34Å
22	L	78.1	Confident	76.2	Confident	95 Å²	95	105.1 Å²	105.1	50%	0.497	53%	0.533	S	S	.	.	G	3₁₀ helix	trans	-98.5	-1.4	-179.4	-68.2	168.7	0	0	0	112.6	L13 Y18 S19 D20	L13-L22 HydrophobicContact CB-CD1 4.11Å; L13-L22 HydrophobicContact CD2-CD2 4.22Å; L13-L22 WeakPolarHBondContact O-CD1 3.24Å; Y18-L22 WeakPolarHBondContact O-CG 3.21Å; Y18-L22 PolarHBondContact O-N 2.93Å; S19-L22 PolarHBondContact O-N 3.41Å; S19-L22 VanDerWaalsContact O-N 3.16Å; D20-L22 VanDerWaalsContact C-N 3.34Å
23	D	80.3	Confident	77.2	Confident	109 Å²	109	103 Å²	103	58%	0.583	53%	0.53	S	S	*	.	S	Bend	trans	-72.5	139.7	176.9	-150.4	-25.4	0	0	0	111.1	D25 F26	D23-D25 PolarHBondContact O-N 2.84Å; D23-F26 VanDerWaalsContact O-CB 3.3Å; D23-F26 WeakPolarHBondContact O-CB 3.43Å; D23-F26 PolarHBondContact O-N 2.88Å
24	E	73.6	Confident	78.2	Confident	195 Å²	195	104.2 Å²	104.2	91%	0.911	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.4	-25	-175.2	-71.6	-162.6	164.1	0	0	112.4
25	D	77.4	Confident	79.1	Confident	153 Å²	153	97.9 Å²	97.9	82%	0.818	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.1	17.5	178	-72.1	-38.6	0	0	0	113.2	D23 D27	D23-D25 PolarHBondContact O-N 2.84Å; D25-D27 PolarHBondContact O-N 3.4Å
26	F	80.3	Confident	79.7	Confident	66 Å²	66	98.9 Å²	98.9	29%	0.289	52%	0.519	S	S	.	.			trans	-58.4	112.5	-176.3	176.2	-108	0	0	0	112.8	D20 F21 D23 V28 Y31	D20-F26 WeakPolarHBondContact O-CD2 3.19Å; F21-F26 AromaticContact CD1-CE1 3.84Å; F21-F26 HydrophobicContact CD1-CE1 3.84Å; F21-F26 AromaticContact CD1-CE2 3.75Å; F21-F26 HydrophobicContact CD1-CE2 3.75Å; F21-F26 AromaticContact CD1-CZ 3.27Å; F21-F26 HydrophobicContact CD1-CZ 3.27Å; F21-F26 HydrophobicContact CE1-CE1 4.45Å; F21-F26 HydrophobicContact CE1-CE2 4.13Å; F21-F26 AromaticContact CE1-CZ 3.61Å; F21-F26 HydrophobicContact CE1-CZ 3.61Å; F21-F26 HydrophobicContact CG-CE2 4.34Å; F21-F26 HydrophobicContact CG-CZ 4.24Å; D23-F26 VanDerWaalsContact O-CB 3.3Å; D23-F26 WeakPolarHBondContact O-CB 3.43Å; D23-F26 PolarHBondContact O-N 2.88Å; F26-V28 HydrophobicContact CD1-CG2 4.21Å; F26-V28 HydrophobicContact CE1-CB 4.49Å; F26-V28 HydrophobicContact CE1-CG2 3.54Å; F26-V28 HydrophobicContact CZ-CG2 4.24Å; F26-Y31 HydrophobicContact CE2-CD1 4.44Å; F26-Y31 AromaticContact CE2-CD2 3.97Å; F26-Y31 HydrophobicContact CE2-CD2 3.97Å; F26-Y31 AromaticContact CE2-CG 3.8Å; F26-Y31 HydrophobicContact CE2-CG 3.8Å; F26-Y31 HydrophobicContact CZ-CD1 4.46Å; F26-Y31 HydrophobicContact CZ-CG 4.22Å
27	D	81.5	Confident	80.6	Confident	71 Å²	71	96.5 Å²	96.5	38%	0.38	51%	0.507	S	S	.	.			trans	-103.9	108.7	174	177	24	0	0	0	111.6	D25 K29 T30 Y31	D25-D27 PolarHBondContact O-N 3.4Å; D27-K29 PolarHBondContact O-N 3.27Å; D27-K29 VanDerWaalsContact O-N 3.15Å; D27-K29 WeakPolarHBondContact OD1-CB 3.46Å; D27-K29 PolarHBondContact OD1-N 3.36Å; D27-T30 PolarHBondContact O-N 3.16Å; D27-T30 VanDerWaalsContact O-N 3.17Å; D27-T30 WeakPolarHBondContact OD2-CB 3.37Å; D27-T30 PolarHBondContact OD2-N 2.65Å; D27-T30 PolarHBondContact OD2-OG1 3.34Å; D27-Y31 PolarHBondContact O-N 2.95Å
28	V	82.6	Confident	81.4	Confident	88 Å²	88	97.7 Å²	97.7	53%	0.533	50%	0.504	S	S	.	.	H	α-helix	trans	-52.5	-36.6	175.4	177.6	0	0	0	0	111.9	F26 T32	F26-V28 HydrophobicContact CD1-CG2 4.21Å; F26-V28 HydrophobicContact CE1-CB 4.49Å; F26-V28 HydrophobicContact CE1-CG2 3.54Å; F26-V28 HydrophobicContact CZ-CG2 4.24Å; V28-T32 HydrophobicContact CG1-CG2 4.16Å; V28-T32 VanDerWaalsContact O-CB 3.3Å; V28-T32 WeakPolarHBondContact O-CB 3.41Å; V28-T32 WeakPolarHBondContact O-CG2 3.46Å; V28-T32 PolarHBondContact O-N 3.46Å; V28-T32 PolarHBondContact O-OG1 3.02Å
29	K	83.4	Confident	82.1	Confident	164 Å²	164	96.2 Å²	96.2	71%	0.713	51%	0.511	S	S	*	.	H	α-helix	trans	-71	-42.7	-176.9	-59.1	-175.7	-167.5	-178.7	0	111.2	D27 T32 A33	D27-K29 PolarHBondContact O-N 3.27Å; D27-K29 VanDerWaalsContact O-N 3.15Å; D27-K29 WeakPolarHBondContact OD1-CB 3.46Å; D27-K29 PolarHBondContact OD1-N 3.36Å; K29-T32 PolarHBondContact O-OG1 3.45Å; K29-T32 VanDerWaalsContact O-OG1 3.08Å; K29-A33 VanDerWaalsContact O-CB 3.28Å; K29-A33 WeakPolarHBondContact O-CB 3.01Å; K29-A33 PolarHBondContact O-N 3.29Å
30	T	83.3	Confident	82.9	Confident	82 Å²	82	96.6 Å²	96.6	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-68.4	-44.4	177.2	-59.3	0	0	0	0	111.2	D27 A33 Q34	D27-T30 PolarHBondContact O-N 3.16Å; D27-T30 VanDerWaalsContact O-N 3.17Å; D27-T30 WeakPolarHBondContact OD2-CB 3.37Å; D27-T30 PolarHBondContact OD2-N 2.65Å; D27-T30 PolarHBondContact OD2-OG1 3.34Å; T30-A33 PolarHBondContact O-N 2.98Å; T30-Q34 WeakPolarHBondContact O-CB 3.3Å; T30-Q34 PolarHBondContact O-N 2.98Å
31	Y	85.3	Confident	83.6	Confident	79 Å²	79	96 Å²	96	31%	0.31	51%	0.506	S	S	.	.	H	α-helix	trans	-62.1	-45.9	176.9	-175.5	-91.6	0	0	0	112.3	D20 F21 F26 D27 Q34 A35	D20-Y31 HydrophobicContact CB-CD2 4.49Å; D20-Y31 HydrophobicContact CB-CE2 4.09Å; F21-Y31 HydrophobicContact CE1-CD1 4.22Å; F21-Y31 AromaticContact CE1-CE1 3.88Å; F21-Y31 HydrophobicContact CE1-CE1 3.88Å; F21-Y31 HydrophobicContact CE2-CE1 4.36Å; F21-Y31 HydrophobicContact CE2-CE2 4.48Å; F21-Y31 AromaticContact CE2-CZ 3.9Å; F21-Y31 HydrophobicContact CZ-CD1 4.25Å; F21-Y31 AromaticContact CZ-CE1 3.46Å; F21-Y31 HydrophobicContact CZ-CE1 3.46Å; F21-Y31 VanDerWaalsContact CZ-CE1 3.46Å; F21-Y31 HydrophobicContact CZ-CE2 4.27Å; F21-Y31 AromaticContact CZ-CZ 3.46Å; F21-Y31 VanDerWaalsContact CZ-CZ 3.46Å; F21-Y31 WeakPolarHBondContact CZ-OH 3.34Å; F26-Y31 HydrophobicContact CE2-CD1 4.44Å; F26-Y31 AromaticContact CE2-CD2 3.97Å; F26-Y31 HydrophobicContact CE2-CD2 3.97Å; F26-Y31 AromaticContact CE2-CG 3.8Å; F26-Y31 HydrophobicContact CE2-CG 3.8Å; F26-Y31 HydrophobicContact CZ-CD1 4.46Å; F26-Y31 HydrophobicContact CZ-CG 4.22Å; D27-Y31 PolarHBondContact O-N 2.95Å; Y31-Q34 PolarHBondContact O-N 3.37Å; Y31-A35 WeakPolarHBondContact O-CB 3.36Å; Y31-A35 PolarHBondContact O-N 2.94Å
32	T	83	Confident	84.3	Confident	67 Å²	67	94.4 Å²	94.4	41%	0.411	51%	0.51	S	S	.	.	H	α-helix	trans	-65.2	-40	177.3	51	0	0	0	0	112.3	V28 K29 Q34 A35 I36	V28-T32 HydrophobicContact CG1-CG2 4.16Å; V28-T32 VanDerWaalsContact O-CB 3.3Å; V28-T32 WeakPolarHBondContact O-CB 3.41Å; V28-T32 WeakPolarHBondContact O-CG2 3.46Å; V28-T32 PolarHBondContact O-N 3.46Å; V28-T32 PolarHBondContact O-OG1 3.02Å; K29-T32 PolarHBondContact O-OG1 3.45Å; K29-T32 VanDerWaalsContact O-OG1 3.08Å; T32-Q34 VanDerWaalsContact C-N 3.33Å; T32-Q34 PolarHBondContact O-N 3.23Å; T32-A35 PolarHBondContact O-N 3.39Å; T32-I36 WeakPolarHBondContact O-CB 3.38Å; T32-I36 WeakPolarHBondContact O-CD1 3.5Å; T32-I36 WeakPolarHBondContact O-CG1 3.47Å; T32-I36 PolarHBondContact O-N 3.1Å
33	A	83.8	Confident	85.1	Confident	58 Å²	58	94.8 Å²	94.8	48%	0.479	51%	0.509	S	S	.	.	H	α-helix	trans	-60.9	-41.7	173.8	0	0	0	0	0	112	K29 T30 I36 H37	K29-A33 VanDerWaalsContact O-CB 3.28Å; K29-A33 WeakPolarHBondContact O-CB 3.01Å; K29-A33 PolarHBondContact O-N 3.29Å; T30-A33 PolarHBondContact O-N 2.98Å; A33-I36 PolarHBondContact O-N 3.09Å; A33-H37 WeakPolarHBondContact O-CB 3.35Å; A33-H37 PolarHBondContact O-N 3.37Å
34	Q	85	Confident	85.8	Confident	107 Å²	107	94.7 Å²	94.7	50%	0.5	51%	0.506	S	S	.	.	H	α-helix	trans	-70	-40.2	177.9	-170.3	166	-2.6	0	0	112.5	T30 Y31 T32 H37 H38	T30-Q34 WeakPolarHBondContact O-CB 3.3Å; T30-Q34 PolarHBondContact O-N 2.98Å; Y31-Q34 PolarHBondContact O-N 3.37Å; T32-Q34 VanDerWaalsContact C-N 3.33Å; T32-Q34 PolarHBondContact O-N 3.23Å; Q34-H37 PolarHBondContact O-N 3.36Å; Q34-H38 PolarHBondContact O-N 2.97Å; Q34-H38 PolarHBondContact O-ND1 2.91Å
35	A	85	Confident	86.8	Confident	44 Å²	44	91 Å²	91	36%	0.364	49%	0.492	S	S	.	.	H	α-helix	trans	-62.6	-41.9	173.9	0	0	0	0	0	111.9	Y31 T32 H37 H38 A39	Y31-A35 WeakPolarHBondContact O-CB 3.36Å; Y31-A35 PolarHBondContact O-N 2.94Å; T32-A35 PolarHBondContact O-N 3.39Å; A35-H37 VanDerWaalsContact C-N 3.35Å; A35-H38 PolarHBondContact O-N 2.97Å; A35-A39 WeakPolarHBondContact O-CB 3.42Å; A35-A39 PolarHBondContact O-N 3.19Å
36	I	86.3	Confident	87.6	Confident	111 Å²	111	86.6 Å²	86.6	57%	0.569	48%	0.476	S	S	*	.	H	α-helix	trans	-61.8	-44.3	173.3	-68.6	164.3	0	0	0	110.2	T32 A33 H38 A39 V40	T32-I36 WeakPolarHBondContact O-CB 3.38Å; T32-I36 WeakPolarHBondContact O-CD1 3.5Å; T32-I36 WeakPolarHBondContact O-CG1 3.47Å; T32-I36 PolarHBondContact O-N 3.1Å; A33-I36 PolarHBondContact O-N 3.09Å; I36-H38 PolarHBondContact O-N 3.33Å; I36-A39 WeakPolarHBondContact O-CB 3.13Å; I36-A39 PolarHBondContact O-N 3.3Å; I36-V40 HydrophobicContact CG2-CG2 4.5Å; I36-V40 VanDerWaalsContact O-CG2 3.24Å; I36-V40 WeakPolarHBondContact O-CG2 3.43Å; I36-V40 PolarHBondContact O-N 2.94Å
37	H	89.9	Confident	88.4	Confident	121 Å²	121	88.1 Å²	88.1	56%	0.56	48%	0.483	S	S	*	.	H	α-helix	trans	-62.7	-42.4	178.2	-166.9	-85.5	0	0	0	112.3	A33 Q34 A35 V40 I41	A33-H37 WeakPolarHBondContact O-CB 3.35Å; A33-H37 PolarHBondContact O-N 3.37Å; Q34-H37 PolarHBondContact O-N 3.36Å; A35-H37 VanDerWaalsContact C-N 3.35Å; H37-V40 PolarHBondContact O-N 3.34Å; H37-I41 VanDerWaalsContact ND1-CD1 3.34Å; H37-I41 WeakPolarHBondContact ND1-CD1 3.41Å; H37-I41 WeakPolarHBondContact O-CG1 3.44Å; H37-I41 PolarHBondContact O-N 3.25Å
38	H	88.4	Confident	89.1	Confident	109 Å²	109	90.2 Å²	90.2	51%	0.505	49%	0.494	S	S	.	.	H	α-helix	trans	-63.7	-39.9	173.8	-74.8	142.8	0	0	0	112.8	Q34 A35 I36 V40 I41 A42	Q34-H38 PolarHBondContact O-N 2.97Å; Q34-H38 PolarHBondContact O-ND1 2.91Å; A35-H38 PolarHBondContact O-N 2.97Å; I36-H38 PolarHBondContact O-N 3.33Å; H38-V40 VanDerWaalsContact C-N 3.3Å; H38-V40 PolarHBondContact O-N 2.91Å; H38-I41 PolarHBondContact O-N 2.93Å; H38-A42 WeakPolarHBondContact O-CB 3.47Å; H38-A42 PolarHBondContact O-N 2.94Å
39	A	89.1	Confident	89.8	Confident	60 Å²	60	88.5 Å²	88.5	50%	0.496	49%	0.489	S	S	.	.	H	α-helix	trans	-61.2	-41	174.8	0	0	0	0	0	111.5	A35 I36 A42 E43	A35-A39 WeakPolarHBondContact O-CB 3.42Å; A35-A39 PolarHBondContact O-N 3.19Å; I36-A39 WeakPolarHBondContact O-CB 3.13Å; I36-A39 PolarHBondContact O-N 3.3Å; A39-A42 PolarHBondContact O-N 3.32Å; A39-E43 PolarHBondContact O-N 3.42Å
40	V	91.9	Very high	90.4	Very high	68 Å²	68	86.2 Å²	86.2	41%	0.412	48%	0.48	S	S	.	.	H	α-helix	trans	-64.1	-42.3	175	174.8	0	0	0	0	111.1	I36 H37 H38 E43 Q44	I36-V40 HydrophobicContact CG2-CG2 4.5Å; I36-V40 VanDerWaalsContact O-CG2 3.24Å; I36-V40 WeakPolarHBondContact O-CG2 3.43Å; I36-V40 PolarHBondContact O-N 2.94Å; H37-V40 PolarHBondContact O-N 3.34Å; H38-V40 VanDerWaalsContact C-N 3.3Å; H38-V40 PolarHBondContact O-N 2.91Å; V40-E43 PolarHBondContact O-N 2.97Å; V40-Q44 WeakPolarHBondContact O-CG 3.48Å; V40-Q44 PolarHBondContact O-N 2.94Å
41	I	90.6	Very high	91.1	Very high	76 Å²	76	83.9 Å²	83.9	39%	0.39	47%	0.472	S	S	.	.	H	α-helix	trans	-62	-45.6	176	-68.1	164.4	0	0	0	110.9	H37 H38 E43 Q44 L45	H37-I41 VanDerWaalsContact ND1-CD1 3.34Å; H37-I41 WeakPolarHBondContact ND1-CD1 3.41Å; H37-I41 WeakPolarHBondContact O-CG1 3.44Å; H37-I41 PolarHBondContact O-N 3.25Å; H38-I41 PolarHBondContact O-N 2.93Å; I41-E43 VanDerWaalsContact C-N 3.3Å; I41-E43 PolarHBondContact O-N 3.34Å; I41-Q44 PolarHBondContact O-N 3.23Å; I41-L45 HydrophobicContact CG2-CD1 4.36Å; I41-L45 PolarHBondContact O-N 3.32Å
42	A	92.5	Very high	91.6	Very high	60 Å²	60	85.1 Å²	85.1	50%	0.496	48%	0.483	S	S	.	.	H	α-helix	trans	-61.1	-40.1	178.3	0	0	0	0	0	111.6	H38 A39 L45 A46	H38-A42 WeakPolarHBondContact O-CB 3.47Å; H38-A42 PolarHBondContact O-N 2.94Å; A39-A42 PolarHBondContact O-N 3.32Å; A42-L45 PolarHBondContact O-N 3.05Å; A42-A46 WeakPolarHBondContact O-CB 3.49Å; A42-A46 PolarHBondContact O-N 3.36Å
43	E	93.6	Very high	92.3	Very high	102 Å²	102	85.2 Å²	85.2	48%	0.477	49%	0.487	S	S	.	.	H	α-helix	trans	-62.7	-42.3	174.6	-167.2	-168.2	152	0	0	112	A39 V40 I41 A46 K47	A39-E43 PolarHBondContact O-N 3.42Å; V40-E43 PolarHBondContact O-N 2.97Å; I41-E43 VanDerWaalsContact C-N 3.3Å; I41-E43 PolarHBondContact O-N 3.34Å; E43-A46 PolarHBondContact O-N 3.26Å; E43-K47 WeakPolarHBondContact O-CG 3.39Å; E43-K47 PolarHBondContact O-N 3.45Å; E43-K47 WeakPolarHBondContact OE1-CE 3.2Å; E43-K47 IonicContact OE1-NZ 2.65Å; E43-K47 PolarHBondContact OE1-NZ 3.11Å
44	Q	94.6	Very high	92.9	Very high	108 Å²	108	88 Å²	88	51%	0.505	49%	0.49	S	S	.	.	H	α-helix	trans	-66.7	-38.4	176.4	-66.8	-61	-15.2	0	0	112.2	V40 I41 A46 K47 L48	V40-Q44 WeakPolarHBondContact O-CG 3.48Å; V40-Q44 PolarHBondContact O-N 2.94Å; I41-Q44 PolarHBondContact O-N 3.23Å; Q44-A46 VanDerWaalsContact C-N 3.33Å; Q44-K47 PolarHBondContact O-N 3.36Å; Q44-L48 PolarHBondContact O-N 3.19Å
45	L	94.9	Very high	93.5	Very high	118 Å²	118	88.5 Å²	88.5	62%	0.618	50%	0.496	S	S	*	.	H	α-helix	trans	-62	-42.8	173.3	-120.6	91.3	0	0	0	111.5	I41 A42 L48 A49	I41-L45 HydrophobicContact CG2-CD1 4.36Å; I41-L45 PolarHBondContact O-N 3.32Å; A42-L45 PolarHBondContact O-N 3.05Å; L45-L48 PolarHBondContact O-N 2.9Å; L45-A49 WeakPolarHBondContact O-CB 3.37Å; L45-A49 PolarHBondContact O-N 3.29Å
46	A	95.3	Very high	94	Very high	60 Å²	60	91.6 Å²	91.6	50%	0.496	51%	0.506	S	S	.	.	H	α-helix	trans	-62.8	-43	177.3	0	0	0	0	0	111.6	A42 E43 Q44 L48 A49 Q50	A42-A46 WeakPolarHBondContact O-CB 3.49Å; A42-A46 PolarHBondContact O-N 3.36Å; E43-A46 PolarHBondContact O-N 3.26Å; Q44-A46 VanDerWaalsContact C-N 3.33Å; A46-L48 PolarHBondContact O-N 2.87Å; A46-A49 PolarHBondContact O-N 3.41Å; A46-Q50 WeakPolarHBondContact O-CB 3.45Å; A46-Q50 PolarHBondContact O-N 2.93Å
47	K	96.1	Very high	94.4	Very high	98 Å²	98	93.9 Å²	93.9	43%	0.426	51%	0.512	S	S	.	.	H	α-helix	trans	-61.4	-41.9	174.2	-77	169.5	171.2	164.2	0	112.2	E43 Q44 Q50 G51	E43-K47 WeakPolarHBondContact O-CG 3.39Å; E43-K47 PolarHBondContact O-N 3.45Å; E43-K47 WeakPolarHBondContact OE1-CE 3.2Å; E43-K47 IonicContact OE1-NZ 2.65Å; E43-K47 PolarHBondContact OE1-NZ 3.11Å; Q44-K47 PolarHBondContact O-N 3.36Å; K47-Q50 PolarHBondContact O-N 2.9Å; K47-G51 PolarHBondContact O-N 2.91Å
48	L	96.9	Very high	94.6	Very high	115 Å²	115	92.9 Å²	92.9	60%	0.602	51%	0.507	S	S	*	.	H	α-helix	trans	-65	-46.3	176.7	-177.4	62.5	0	0	0	111.7	Q44 L45 A46 Q50 G51 I52	Q44-L48 PolarHBondContact O-N 3.19Å; L45-L48 PolarHBondContact O-N 2.9Å; A46-L48 PolarHBondContact O-N 2.87Å; L48-Q50 VanDerWaalsContact C-N 3.28Å; L48-Q50 PolarHBondContact O-N 3.38Å; L48-G51 PolarHBondContact O-N 2.88Å; L48-G51 VanDerWaalsContact O-N 3.11Å; L48-I52 HydrophobicContact CG-CD1 4.18Å; L48-I52 WeakPolarHBondContact O-CG1 3.39Å; L48-I52 PolarHBondContact O-N 3.5Å
49	A	96.5	Very high	94.8	Very high	52 Å²	52	92.4 Å²	92.4	43%	0.43	51%	0.508	S	S	.	.	H	α-helix	trans	-60.7	-38.4	176.6	0	0	0	0	0	112.1	L45 A46 I52 S53	L45-A49 WeakPolarHBondContact O-CB 3.37Å; L45-A49 PolarHBondContact O-N 3.29Å; A46-A49 PolarHBondContact O-N 3.41Å; A49-I52 PolarHBondContact O-N 2.9Å; A49-S53 PolarHBondContact O-N 2.96Å; A49-S53 PolarHBondContact O-OG 3.45Å
50	Q	97.1	Very high	94.9	Very high	115 Å²	115	95.5 Å²	95.5	54%	0.537	51%	0.512	S	S	.	.	H	α-helix	trans	-63.6	-44.5	172.4	-174.5	179.6	13.4	0	0	111.6	A46 K47 L48 S53 Q54	A46-Q50 WeakPolarHBondContact O-CB 3.45Å; A46-Q50 PolarHBondContact O-N 2.93Å; K47-Q50 PolarHBondContact O-N 2.9Å; L48-Q50 VanDerWaalsContact C-N 3.28Å; L48-Q50 PolarHBondContact O-N 3.38Å; Q50-S53 PolarHBondContact O-N 3.39Å; Q50-Q54 WeakPolarHBondContact O-CG 3.42Å; Q50-Q54 PolarHBondContact O-N 2.92Å
51	G	97.2	Very high	94.7	Very high	33 Å²	33	95.5 Å²	95.5	34%	0.34	52%	0.515	S	S	.	.	H	α-helix	trans	-60.4	-43	175.9	0	0	0	0	0	112.7	K47 L48 S53 Q54 L55	K47-G51 PolarHBondContact O-N 2.91Å; L48-G51 PolarHBondContact O-N 2.88Å; L48-G51 VanDerWaalsContact O-N 3.11Å; G51-S53 PolarHBondContact O-N 3.27Å; G51-Q54 PolarHBondContact O-N 3.4Å; G51-L55 WeakPolarHBondContact O-CB 3.22Å; G51-L55 PolarHBondContact O-N 3.5Å
52	I	96.7	Very high	94.6	Very high	105 Å²	105	97.1 Å²	97.1	54%	0.538	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-45.8	174.8	-67.6	167	0	0	0	110.4	L48 A49 Q54 L55 D56	L48-I52 HydrophobicContact CG-CD1 4.18Å; L48-I52 WeakPolarHBondContact O-CG1 3.39Å; L48-I52 PolarHBondContact O-N 3.5Å; A49-I52 PolarHBondContact O-N 2.9Å; I52-Q54 VanDerWaalsContact C-N 3.31Å; I52-Q54 PolarHBondContact O-N 3.29Å; I52-L55 PolarHBondContact O-N 3.01Å; I52-D56 WeakPolarHBondContact O-CB 3.46Å; I52-D56 PolarHBondContact O-N 3.01Å
53	S	97	Very high	94.2	Very high	69 Å²	69	97.9 Å²	97.9	48%	0.483	52%	0.52	S	S	.	.	H	α-helix	trans	-65.6	-33.4	179.1	-61.8	0	0	0	0	112.8	A49 Q50 G51 K57	A49-S53 PolarHBondContact O-N 2.96Å; A49-S53 PolarHBondContact O-OG 3.45Å; Q50-S53 PolarHBondContact O-N 3.39Å; G51-S53 PolarHBondContact O-N 3.27Å; S53-K57 WeakPolarHBondContact O-CG 3.4Å; S53-K57 PolarHBondContact O-N 3.31Å
54	Q	96.9	Very high	93.8	Very high	116 Å²	116	96.8 Å²	96.8	54%	0.542	52%	0.52	S	S	.	.	H	α-helix	trans	-69.8	-43.9	173.8	-75.7	177.9	7.5	0	0	111.4	Q50 G51 I52 D56 K57 E58	Q50-Q54 WeakPolarHBondContact O-CG 3.42Å; Q50-Q54 PolarHBondContact O-N 2.92Å; G51-Q54 PolarHBondContact O-N 3.4Å; I52-Q54 VanDerWaalsContact C-N 3.31Å; I52-Q54 PolarHBondContact O-N 3.29Å; Q54-D56 VanDerWaalsContact C-N 3.31Å; Q54-D56 PolarHBondContact O-N 3.19Å; Q54-K57 PolarHBondContact O-N 3.26Å; Q54-E58 WeakPolarHBondContact O-CB 3.42Å; Q54-E58 PolarHBondContact O-N 2.89Å
55	L	96.4	Very high	93.3	Very high	119 Å²	119	94.9 Å²	94.9	62%	0.623	52%	0.522	S	S	*	.	H	α-helix	trans	-61.2	-41.9	176.6	-174.9	65.5	0	0	0	111.3	G51 I52 E58 L59	G51-L55 WeakPolarHBondContact O-CB 3.22Å; G51-L55 PolarHBondContact O-N 3.5Å; I52-L55 PolarHBondContact O-N 3.01Å; L55-E58 PolarHBondContact O-N 3.47Å; L55-L59 VanDerWaalsContact O-CB 3.22Å; L55-L59 WeakPolarHBondContact O-CB 3.44Å; L55-L59 PolarHBondContact O-N 3.32Å
56	D	95.6	Very high	92.7	Very high	109 Å²	109	97.7 Å²	97.7	58%	0.583	53%	0.525	S	S	*	.	H	α-helix	trans	-61.9	-44.2	177.4	-170.5	61	0	0	0	112	I52 Q54 L59 H60	I52-D56 WeakPolarHBondContact O-CB 3.46Å; I52-D56 PolarHBondContact O-N 3.01Å; Q54-D56 VanDerWaalsContact C-N 3.31Å; Q54-D56 PolarHBondContact O-N 3.19Å; D56-L59 PolarHBondContact O-N 2.89Å; D56-H60 WeakPolarHBondContact O-CB 3.41Å; D56-H60 PolarHBondContact O-N 3.44Å
57	K	95.1	Very high	92.1	Very high	158 Å²	158	100 Å²	100	69%	0.687	52%	0.524	S	S	*	.	H	α-helix	trans	-62.4	-44.6	174.6	-77.7	-179.7	179.9	-178.8	0	112.8	S53 Q54 H60 S61	S53-K57 WeakPolarHBondContact O-CG 3.4Å; S53-K57 PolarHBondContact O-N 3.31Å; Q54-K57 PolarHBondContact O-N 3.26Å; K57-H60 PolarHBondContact O-N 3.21Å; K57-S61 WeakPolarHBondContact O-CB 3.26Å; K57-S61 PolarHBondContact O-N 3.47Å
58	E	93.9	Very high	91.4	Very high	100 Å²	100	102.8 Å²	102.8	47%	0.467	54%	0.539	S	S	.	.	H	α-helix	trans	-65.9	-44.2	179.9	-176.6	57.5	-146.9	0	0	110.8	Q54 L55 H60 S61 Q62	Q54-E58 WeakPolarHBondContact O-CB 3.42Å; Q54-E58 PolarHBondContact O-N 2.89Å; L55-E58 PolarHBondContact O-N 3.47Å; E58-H60 VanDerWaalsContact C-N 3.35Å; E58-H60 PolarHBondContact O-N 2.89Å; E58-S61 PolarHBondContact O-N 3.42Å; E58-Q62 WeakPolarHBondContact O-CG 3.32Å; E58-Q62 PolarHBondContact O-N 2.84Å; E58-Q62 PolarHBondContact OE1-NE2 2.87Å
59	L	92	Very high	90.8	Very high	100 Å²	100	102.1 Å²	102.1	52%	0.524	54%	0.536	S	S	.	.	H	α-helix	trans	-60.4	-46.3	175.5	-167.3	156.6	0	0	0	110.5	L55 D56 S61 Q62 V63	L55-L59 VanDerWaalsContact O-CB 3.22Å; L55-L59 WeakPolarHBondContact O-CB 3.44Å; L55-L59 PolarHBondContact O-N 3.32Å; D56-L59 PolarHBondContact O-N 2.89Å; L59-S61 VanDerWaalsContact C-N 3.34Å; L59-S61 PolarHBondContact O-N 2.87Å; L59-Q62 PolarHBondContact O-N 3.46Å; L59-V63 HydrophobicContact CD2-CG2 3.83Å; L59-V63 WeakPolarHBondContact O-CB 3.38Å; L59-V63 VanDerWaalsContact O-CG2 3.26Å; L59-V63 WeakPolarHBondContact O-CG2 3.43Å; L59-V63 PolarHBondContact O-N 3.49Å
60	H	91	Very high	90.2	Very high	124 Å²	124	104.6 Å²	104.6	57%	0.574	54%	0.542	S	S	*	.	H	α-helix	trans	-59.7	-44.2	175.5	-171.4	75.8	0	0	0	111.9	D56 K57 E58 Q62 V63 V64	D56-H60 WeakPolarHBondContact O-CB 3.41Å; D56-H60 PolarHBondContact O-N 3.44Å; K57-H60 PolarHBondContact O-N 3.21Å; E58-H60 VanDerWaalsContact C-N 3.35Å; E58-H60 PolarHBondContact O-N 2.89Å; H60-Q62 PolarHBondContact O-N 3.35Å; H60-V63 PolarHBondContact O-N 3.45Å; H60-V64 WeakPolarHBondContact O-CB 3.42Å; H60-V64 VanDerWaalsContact O-CG2 3.26Å; H60-V64 WeakPolarHBondContact O-CG2 3.38Å; H60-V64 PolarHBondContact O-N 3.16Å
61	S	89.7	Confident	89.7	Confident	69 Å²	69	103.8 Å²	103.8	48%	0.483	54%	0.54	S	S	.	.	H	α-helix	trans	-61.5	-44.6	177.6	-173	0	0	0	0	112	K57 E58 L59 V64 A65	K57-S61 WeakPolarHBondContact O-CB 3.26Å; K57-S61 PolarHBondContact O-N 3.47Å; E58-S61 PolarHBondContact O-N 3.42Å; L59-S61 VanDerWaalsContact C-N 3.34Å; L59-S61 PolarHBondContact O-N 2.87Å; S61-V64 PolarHBondContact O-N 2.89Å; S61-A65 WeakPolarHBondContact O-CB 3.26Å; S61-A65 PolarHBondContact O-N 2.9Å
62	Q	87.5	Confident	89.1	Confident	109 Å²	109	105.3 Å²	105.3	51%	0.509	55%	0.55	S	S	.	*	H	α-helix	trans	-66	-40.1	177.4	-71.3	-178.4	25.7	0	0	112.5	E58 L59 H60 R66	E58-Q62 WeakPolarHBondContact O-CG 3.32Å; E58-Q62 PolarHBondContact O-N 2.84Å; E58-Q62 PolarHBondContact OE1-NE2 2.87Å; L59-Q62 PolarHBondContact O-N 3.46Å; H60-Q62 PolarHBondContact O-N 3.35Å; Q62-R66 PolarHBondContact O-N 3.47Å; Q62-R66 VanDerWaalsContact O-N 3.16Å
63	V	85	Confident	88.7	Confident	77 Å²	77	106.3 Å²	106.3	47%	0.467	55%	0.552	S	S	.	*	H	α-helix	trans	-63.9	-47.9	176.4	168.9	0	0	0	0	110.4	L59 H60 R66 H67	L59-V63 HydrophobicContact CD2-CG2 3.83Å; L59-V63 WeakPolarHBondContact O-CB 3.38Å; L59-V63 VanDerWaalsContact O-CG2 3.26Å; L59-V63 WeakPolarHBondContact O-CG2 3.43Å; L59-V63 PolarHBondContact O-N 3.49Å; H60-V63 PolarHBondContact O-N 3.45Å; V63-R66 PolarHBondContact O-N 2.83Å; V63-H67 WeakPolarHBondContact O-CB 3.21Å; V63-H67 PolarHBondContact O-N 3.36Å
64	V	85.3	Confident	88.3	Confident	79 Å²	79	105.5 Å²	105.5	48%	0.479	55%	0.55	S	S	.	*	H	α-helix	trans	-63.6	-44.9	178.7	171.2	0	0	0	0	111.1	H60 S61 R66 H67	H60-V64 WeakPolarHBondContact O-CB 3.42Å; H60-V64 VanDerWaalsContact O-CG2 3.26Å; H60-V64 WeakPolarHBondContact O-CG2 3.38Å; H60-V64 PolarHBondContact O-N 3.16Å; S61-V64 PolarHBondContact O-N 2.89Å; V64-R66 PolarHBondContact O-N 2.99Å; V64-H67 PolarHBondContact O-N 3.35Å; V64-H67 VanDerWaalsContact O-N 3.11Å
65	A	82.5	Confident	87.9	Confident	67 Å²	67	104.1 Å²	104.1	55%	0.554	55%	0.55	S	S	*	.	H	α-helix	trans	-59.9	-34.5	179.7	0	0	0	0	0	112.8	S61	S61-A65 WeakPolarHBondContact O-CB 3.26Å; S61-A65 PolarHBondContact O-N 2.9Å
66	R	82.9	Confident	87.7	Confident	178 Å²	178	100.4 Å²	100.4	67%	0.672	54%	0.54	S	S	*	.	H	α-helix	trans	-91.3	-9.8	177.7	-69.2	-168.3	176.1	-150	0.6	114.1	Q62 V63 V64 D69 L70	Q62-R66 PolarHBondContact O-N 3.47Å; Q62-R66 VanDerWaalsContact O-N 3.16Å; V63-R66 PolarHBondContact O-N 2.83Å; V64-R66 PolarHBondContact O-N 2.99Å; R66-D69 PolarHBondContact O-N 3.01Å; R66-L70 HydrophobicContact CB-CD1 4.4Å; R66-L70 WeakPolarHBondContact O-CD1 3.36Å; R66-L70 PolarHBondContact O-N 2.87Å
67	H	83.4	Confident	87.6	Confident	107 Å²	107	100.5 Å²	100.5	50%	0.495	54%	0.539	S	S	.	.	H	α-helix	trans	-69.9	-41.8	-173.6	-146	63.3	0	0	0	112	V63 V64 L70 L71	V63-H67 WeakPolarHBondContact O-CB 3.21Å; V63-H67 PolarHBondContact O-N 3.36Å; V64-H67 PolarHBondContact O-N 3.35Å; V64-H67 VanDerWaalsContact O-N 3.11Å; H67-L70 PolarHBondContact O-N 2.95Å; H67-L71 WeakPolarHBondContact O-CB 3.26Å; H67-L71 WeakPolarHBondContact O-CG 3.25Å; H67-L71 PolarHBondContact O-N 3.37Å
68	E	79.9	Confident	87.5	Confident	158 Å²	158	99.5 Å²	99.5	74%	0.738	54%	0.537	S	S	*	.	H	α-helix	trans	-63.8	-42	176.4	-69.3	-164	163.8	0	0	111.6	L71 A72	E68-L71 PolarHBondContact O-N 3.11Å; E68-A72 VanDerWaalsContact O-CB 3.26Å; E68-A72 WeakPolarHBondContact O-CB 3.35Å; E68-A72 PolarHBondContact O-N 3.26Å
69	D	85	Confident	87.5	Confident	100 Å²	100	98.7 Å²	98.7	54%	0.535	54%	0.542	S	S	.	.	H	α-helix	trans	-63.6	-43.9	177.1	-73.4	-17.8	0	0	0	112	R66 A72 Q73	R66-D69 PolarHBondContact O-N 3.01Å; D69-A72 PolarHBondContact O-N 3.42Å; D69-Q73 WeakPolarHBondContact O-CB 3.41Å; D69-Q73 VanDerWaalsContact O-CG 3.25Å; D69-Q73 WeakPolarHBondContact O-CG 3.36Å; D69-Q73 PolarHBondContact O-N 3.47Å
70	L	84.2	Confident	87.6	Confident	105 Å²	105	98.8 Å²	98.8	55%	0.55	54%	0.543	S	S	.	.	H	α-helix	trans	-65.5	-40.5	177.1	-100.3	74.8	0	0	0	111.9	R66 H67 Q73 A74	R66-L70 HydrophobicContact CB-CD1 4.4Å; R66-L70 WeakPolarHBondContact O-CD1 3.36Å; R66-L70 PolarHBondContact O-N 2.87Å; H67-L70 PolarHBondContact O-N 2.95Å; L70-Q73 PolarHBondContact O-N 2.87Å; L70-A74 WeakPolarHBondContact O-CB 3.37Å; L70-A74 PolarHBondContact O-N 2.88Å
71	L	86.1	Confident	87.9	Confident	97 Å²	97	99.1 Å²	99.1	51%	0.508	55%	0.545	S	S	.	.	H	α-helix	trans	-65.8	-45.5	176	-76.8	170.1	0	0	0	111.1	H67 E68 Q73 A74 T75	H67-L71 WeakPolarHBondContact O-CB 3.26Å; H67-L71 WeakPolarHBondContact O-CG 3.25Å; H67-L71 PolarHBondContact O-N 3.37Å; E68-L71 PolarHBondContact O-N 3.11Å; L71-Q73 VanDerWaalsContact C-N 3.31Å; L71-Q73 PolarHBondContact O-N 3.21Å; L71-A74 PolarHBondContact O-N 3.45Å; L71-T75 PolarHBondContact O-N 3.18Å; L71-T75 PolarHBondContact O-OG1 3.24Å; L71-T75 VanDerWaalsContact O-OG1 3.07Å
72	A	85.9	Confident	88.2	Confident	66 Å²	66	97.9 Å²	97.9	55%	0.545	54%	0.543	S	S	.	.	H	α-helix	trans	-60.6	-40.6	175.7	0	0	0	0	0	111.7	E68 D69 G76	E68-A72 VanDerWaalsContact O-CB 3.26Å; E68-A72 WeakPolarHBondContact O-CB 3.35Å; E68-A72 PolarHBondContact O-N 3.26Å; D69-A72 PolarHBondContact O-N 3.42Å; A72-G76 PolarHBondContact O-N 3.41Å
73	Q	88.3	Confident	88.6	Confident	125 Å²	125	95.4 Å²	95.4	58%	0.584	54%	0.535	S	S	*	.	H	α-helix	trans	-64.1	-44.8	173.2	-76.7	176	22.2	0	0	112	D69 L70 L71 G76 I77	D69-Q73 WeakPolarHBondContact O-CB 3.41Å; D69-Q73 VanDerWaalsContact O-CG 3.25Å; D69-Q73 WeakPolarHBondContact O-CG 3.36Å; D69-Q73 PolarHBondContact O-N 3.47Å; L70-Q73 PolarHBondContact O-N 2.87Å; L71-Q73 VanDerWaalsContact C-N 3.31Å; L71-Q73 PolarHBondContact O-N 3.21Å; Q73-G76 PolarHBondContact O-N 3.44Å; Q73-I77 VanDerWaalsContact O-CG1 3.28Å; Q73-I77 WeakPolarHBondContact O-CG1 3.28Å; Q73-I77 PolarHBondContact O-N 3.18Å
74	A	87.9	Confident	89.2	Confident	53 Å²	53	96.6 Å²	96.6	44%	0.438	54%	0.538	S	S	.	.	H	α-helix	trans	-61.6	-46.5	178.5	0	0	0	0	0	111.8	L70 L71 G76 I77 E78	L70-A74 WeakPolarHBondContact O-CB 3.37Å; L70-A74 PolarHBondContact O-N 2.88Å; L71-A74 PolarHBondContact O-N 3.45Å; A74-G76 VanDerWaalsContact C-N 3.31Å; A74-G76 PolarHBondContact O-N 3.07Å; A74-I77 PolarHBondContact O-N 2.88Å; A74-E78 PolarHBondContact O-N 2.89Å
75	T	89.1	Confident	89.8	Confident	87 Å²	87	99 Å²	99	53%	0.534	54%	0.544	S	S	.	.	H	α-helix	trans	-64.2	-36.8	174.4	-52.5	0	0	0	0	111.8	L71 E78 S79	L71-T75 PolarHBondContact O-N 3.18Å; L71-T75 PolarHBondContact O-OG1 3.24Å; L71-T75 VanDerWaalsContact O-OG1 3.07Å; T75-E78 PolarHBondContact O-N 2.87Å; T75-S79 PolarHBondContact O-N 3.48Å
76	G	91.8	Very high	90.5	Very high	40 Å²	40	99.9 Å²	99.9	41%	0.412	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-40.8	173.8	0	0	0	0	0	112.7	A72 Q73 A74 S79 L80	A72-G76 PolarHBondContact O-N 3.41Å; Q73-G76 PolarHBondContact O-N 3.44Å; A74-G76 VanDerWaalsContact C-N 3.31Å; A74-G76 PolarHBondContact O-N 3.07Å; G76-S79 PolarHBondContact O-N 3.17Å; G76-L80 WeakPolarHBondContact O-CB 3.42Å; G76-L80 PolarHBondContact O-N 3.42Å
77	I	93.1	Very high	91.2	Very high	112 Å²	112	96.4 Å²	96.4	57%	0.574	53%	0.531	S	S	*	.	H	α-helix	trans	-65.5	-45.1	176.2	-69.6	164.8	0	0	0	110.8	Q73 A74 S79 L80 E81	Q73-I77 VanDerWaalsContact O-CG1 3.28Å; Q73-I77 WeakPolarHBondContact O-CG1 3.28Å; Q73-I77 PolarHBondContact O-N 3.18Å; A74-I77 PolarHBondContact O-N 2.88Å; I77-S79 VanDerWaalsContact C-N 3.33Å; I77-S79 PolarHBondContact O-N 3.48Å; I77-L80 PolarHBondContact O-N 3.04Å; I77-E81 PolarHBondContact O-N 3.42Å
78	E	93.3	Very high	91.9	Very high	137 Å²	137	96.3 Å²	96.3	64%	0.64	53%	0.531	S	S	*	.	H	α-helix	trans	-60.6	-42.7	177.2	-174.3	-179.8	-171.6	0	0	111.7	A74 T75 L80 E81 G82	A74-E78 PolarHBondContact O-N 2.89Å; T75-E78 PolarHBondContact O-N 2.87Å; E78-L80 PolarHBondContact O-N 2.87Å; E78-E81 PolarHBondContact O-N 3.46Å; E78-G82 PolarHBondContact O-N 3Å; E78-G82 VanDerWaalsContact O-N 3.12Å
79	S	93.6	Very high	92.7	Very high	82 Å²	82	93.1 Å²	93.1	57%	0.573	52%	0.522	S	S	*	.	H	α-helix	trans	-61.5	-43.6	174.3	-176.5	0	0	0	0	112.1	T75 G76 I77 E81 G82 V83	T75-S79 PolarHBondContact O-N 3.48Å; G76-S79 PolarHBondContact O-N 3.17Å; I77-S79 VanDerWaalsContact C-N 3.33Å; I77-S79 PolarHBondContact O-N 3.48Å; S79-E81 VanDerWaalsContact C-N 3.34Å; S79-E81 PolarHBondContact O-N 3.44Å; S79-G82 PolarHBondContact O-N 3Å; S79-V83 PolarHBondContact O-N 3.47Å; S79-V83 VanDerWaalsContact O-N 3.12Å
80	L	95.2	Very high	93.3	Very high	103 Å²	103	96.2 Å²	96.2	54%	0.539	53%	0.526	S	S	.	.	H	α-helix	trans	-64.3	-39.2	178	-176.4	63.4	0	0	0	111.9	G76 I77 E78 G82 V83 L84	G76-L80 WeakPolarHBondContact O-CB 3.42Å; G76-L80 PolarHBondContact O-N 3.42Å; I77-L80 PolarHBondContact O-N 3.04Å; E78-L80 PolarHBondContact O-N 2.87Å; L80-G82 VanDerWaalsContact C-N 3.32Å; L80-G82 PolarHBondContact O-N 3.24Å; L80-V83 PolarHBondContact O-N 3.49Å; L80-L84 HydrophobicContact CG-CD1 4.27Å; L80-L84 WeakPolarHBondContact O-CG 3.44Å; L80-L84 PolarHBondContact O-N 2.88Å
81	E	96.1	Very high	94	Very high	131 Å²	131	95.1 Å²	95.1	61%	0.612	52%	0.52	S	S	*	.	H	α-helix	trans	-58.8	-43.7	174.2	-173.1	174.6	-175.8	0	0	111.2	I77 E78 S79 V83 L84 Q85	I77-E81 PolarHBondContact O-N 3.42Å; E78-E81 PolarHBondContact O-N 3.46Å; S79-E81 VanDerWaalsContact C-N 3.34Å; S79-E81 PolarHBondContact O-N 3.44Å; E81-V83 PolarHBondContact O-N 3.25Å; E81-L84 PolarHBondContact O-N 2.85Å; E81-Q85 WeakPolarHBondContact O-CB 3.49Å; E81-Q85 PolarHBondContact O-N 3.12Å
82	G	95.8	Very high	94.6	Very high	43 Å²	43	93 Å²	93	44%	0.443	51%	0.513	S	S	.	.	H	α-helix	trans	-59.4	-42.3	173.6	0	0	0	0	0	113.4	E78 S79 L80 Q85 M86	E78-G82 PolarHBondContact O-N 3Å; E78-G82 VanDerWaalsContact O-N 3.12Å; S79-G82 PolarHBondContact O-N 3Å; L80-G82 VanDerWaalsContact C-N 3.32Å; L80-G82 PolarHBondContact O-N 3.24Å; G82-Q85 PolarHBondContact O-N 3.12Å; G82-M86 PolarHBondContact O-N 3.05Å
83	V	96.3	Very high	95.2	Very high	57 Å²	57	92.8 Å²	92.8	35%	0.345	51%	0.511	S	S	.	.	H	α-helix	trans	-64.9	-44.1	175.8	175	0	0	0	0	111.2	S79 L80 E81 Q85 M86 M87	S79-V83 PolarHBondContact O-N 3.47Å; S79-V83 VanDerWaalsContact O-N 3.12Å; L80-V83 PolarHBondContact O-N 3.49Å; E81-V83 PolarHBondContact O-N 3.25Å; V83-Q85 VanDerWaalsContact C-N 3.35Å; V83-Q85 PolarHBondContact O-N 3.5Å; V83-M86 WeakPolarHBondContact O-CB 3.43Å; V83-M86 PolarHBondContact O-N 3.12Å; V83-M87 HydrophobicContact CG1-CE 4.13Å; V83-M87 WeakPolarHBondContact O-CG 3.31Å; V83-M87 PolarHBondContact O-N 3.34Å
84	L	97.2	Very high	95.6	Very high	102 Å²	102	92.4 Å²	92.4	53%	0.534	51%	0.513	S	S	.	.	H	α-helix	trans	-62.3	-42.2	177.6	-75.6	171.3	0	0	0	111.6	L80 E81 M86 M87 Q88	L80-L84 HydrophobicContact CG-CD1 4.27Å; L80-L84 WeakPolarHBondContact O-CG 3.44Å; L80-L84 PolarHBondContact O-N 2.88Å; E81-L84 PolarHBondContact O-N 2.85Å; L84-M86 VanDerWaalsContact C-N 3.31Å; L84-M86 PolarHBondContact O-N 3.46Å; L84-M87 PolarHBondContact O-N 3.35Å; L84-Q88 WeakPolarHBondContact O-CB 3.45Å; L84-Q88 PolarHBondContact O-N 2.88Å
85	Q	97.6	Very high	96.1	Very high	129 Å²	129	95.5 Å²	95.5	60%	0.603	52%	0.518	S	S	*	.	H	α-helix	trans	-62.2	-40.4	176	-165.3	69.6	-1.9	0	0	111.8	E81 G82 V83 Q88 T89	E81-Q85 WeakPolarHBondContact O-CB 3.49Å; E81-Q85 PolarHBondContact O-N 3.12Å; G82-Q85 PolarHBondContact O-N 3.12Å; V83-Q85 VanDerWaalsContact C-N 3.35Å; V83-Q85 PolarHBondContact O-N 3.5Å; Q85-Q88 PolarHBondContact O-N 3.26Å; Q85-T89 PolarHBondContact O-N 3.43Å; Q85-T89 PolarHBondContact O-OG1 3.12Å
86	M	97.1	Very high	96.6	Very high	86 Å²	86	93.6 Å²	93.6	42%	0.424	51%	0.511	S	S	.	.	H	α-helix	trans	-65.4	-42.8	174.6	-178.7	176.4	58.4	0	0	111.7	G82 V83 L84 T89 R90	G82-M86 PolarHBondContact O-N 3.05Å; V83-M86 WeakPolarHBondContact O-CB 3.43Å; V83-M86 PolarHBondContact O-N 3.12Å; L84-M86 VanDerWaalsContact C-N 3.31Å; L84-M86 PolarHBondContact O-N 3.46Å; M86-T89 PolarHBondContact O-N 2.86Å; M86-R90 WeakPolarHBondContact O-CG 3.42Å; M86-R90 PolarHBondContact O-N 3.43Å; M86-R90 PolarHBondContact SD-NH2 3.14Å
87	M	97.8	Very high	96.9	Very high	104 Å²	104	93.7 Å²	93.7	51%	0.512	51%	0.508	S	S	.	.	H	α-helix	trans	-61.2	-46.3	175.4	-75.2	-171.5	173.4	0	0	111.3	V83 L84 T89 R90 I91	V83-M87 HydrophobicContact CG1-CE 4.13Å; V83-M87 WeakPolarHBondContact O-CG 3.31Å; V83-M87 PolarHBondContact O-N 3.34Å; L84-M87 PolarHBondContact O-N 3.35Å; M87-T89 VanDerWaalsContact C-N 3.3Å; M87-T89 PolarHBondContact O-N 2.86Å; M87-R90 PolarHBondContact O-N 3.21Å; M87-R90 VanDerWaalsContact O-N 3.12Å; M87-I91 VanDerWaalsContact O-CG1 3.31Å; M87-I91 WeakPolarHBondContact O-CG1 3.4Å; M87-I91 PolarHBondContact O-N 3.42Å
88	Q	97.9	Very high	97.1	Very high	106 Å²	106	91.8 Å²	91.8	50%	0.495	50%	0.502	S	S	.	.	H	α-helix	trans	-57.2	-44.7	177.4	-175.2	60.7	21.5	0	0	111.5	L84 Q85 R90 I91 S92	L84-Q88 WeakPolarHBondContact O-CB 3.45Å; L84-Q88 PolarHBondContact O-N 2.88Å; Q85-Q88 PolarHBondContact O-N 3.26Å; Q88-R90 PolarHBondContact O-N 2.9Å; Q88-I91 PolarHBondContact O-N 2.92Å; Q88-S92 PolarHBondContact O-N 3.37Å; Q88-S92 PolarHBondContact O-OG 3.24Å; Q88-S92 VanDerWaalsContact O-OG 3.1Å
89	T	98	Very high	97.3	Very high	90 Å²	90	90 Å²	90	55%	0.552	49%	0.493	S	S	*	.	H	α-helix	trans	-61.2	-44.1	177	-55.9	0	0	0	0	111.6	Q85 M86 M87 S92 A93	Q85-T89 PolarHBondContact O-N 3.43Å; Q85-T89 PolarHBondContact O-OG1 3.12Å; M86-T89 PolarHBondContact O-N 2.86Å; M87-T89 VanDerWaalsContact C-N 3.3Å; M87-T89 PolarHBondContact O-N 2.86Å; T89-S92 PolarHBondContact O-N 3.33Å; T89-A93 PolarHBondContact O-N 3.45Å
90	R	97.8	Very high	97.6	Very high	165 Å²	165	94.3 Å²	94.3	62%	0.623	50%	0.497	S	S	*	.	H	α-helix	trans	-66.2	-40.6	178.6	-70.4	175.1	-175.1	-159.4	3.5	112.3	M86 M87 Q88 A93 L94	M86-R90 WeakPolarHBondContact O-CG 3.42Å; M86-R90 PolarHBondContact O-N 3.43Å; M86-R90 PolarHBondContact SD-NH2 3.14Å; M87-R90 PolarHBondContact O-N 3.21Å; M87-R90 VanDerWaalsContact O-N 3.12Å; Q88-R90 PolarHBondContact O-N 2.9Å; R90-A93 PolarHBondContact O-N 2.98Å; R90-L94 WeakPolarHBondContact O-CB 3.49Å; R90-L94 PolarHBondContact O-N 3.05Å
91	I	98.3	Very high	97.6	Very high	83 Å²	83	94.2 Å²	94.2	43%	0.426	50%	0.495	S	S	.	.	H	α-helix	trans	-62.2	-47.7	176.3	-69.6	165.4	0	0	0	110	M87 Q88 A93 L94 Q95	M87-I91 VanDerWaalsContact O-CG1 3.31Å; M87-I91 WeakPolarHBondContact O-CG1 3.4Å; M87-I91 PolarHBondContact O-N 3.42Å; Q88-I91 PolarHBondContact O-N 2.92Å; I91-A93 VanDerWaalsContact C-N 3.3Å; I91-A93 PolarHBondContact O-N 3.37Å; I91-L94 PolarHBondContact O-N 2.9Å; I91-L94 VanDerWaalsContact O-N 3.14Å; I91-Q95 HydrophobicContact CG2-CG 4.4Å; I91-Q95 WeakPolarHBondContact O-CG 3.33Å; I91-Q95 PolarHBondContact O-N 3Å
92	S	98.2	Very high	97.7	Very high	52 Å²	52	94.5 Å²	94.5	36%	0.364	49%	0.49	S	S	.	.	H	α-helix	trans	-58.7	-41.9	176.3	-64.4	0	0	0	0	112.1	Q88 T89 Q95 A96	Q88-S92 PolarHBondContact O-N 3.37Å; Q88-S92 PolarHBondContact O-OG 3.24Å; Q88-S92 VanDerWaalsContact O-OG 3.1Å; T89-S92 PolarHBondContact O-N 3.33Å; S92-Q95 PolarHBondContact O-N 2.83Å; S92-A96 WeakPolarHBondContact O-CB 3.45Å; S92-A96 PolarHBondContact O-N 3.01Å
93	A	98	Very high	97.8	Very high	62 Å²	62	96 Å²	96	51%	0.512	49%	0.491	S	S	.	.	H	α-helix	trans	-64	-41.1	175.8	0	0	0	0	0	112.2	T89 R90 I91 A96 A97	T89-A93 PolarHBondContact O-N 3.45Å; R90-A93 PolarHBondContact O-N 2.98Å; I91-A93 VanDerWaalsContact C-N 3.3Å; I91-A93 PolarHBondContact O-N 3.37Å; A93-A96 PolarHBondContact O-N 3.46Å; A93-A97 PolarHBondContact O-N 3.37Å
94	L	98.4	Very high	97.9	Very high	116 Å²	116	101 Å²	101	61%	0.607	51%	0.508	S	S	*	.	H	α-helix	trans	-65.1	-44.1	176.6	-173.8	67.3	0	0	0	111.5	R90 I91 A96 A97 V98	R90-L94 WeakPolarHBondContact O-CB 3.49Å; R90-L94 PolarHBondContact O-N 3.05Å; I91-L94 PolarHBondContact O-N 2.9Å; I91-L94 VanDerWaalsContact O-N 3.14Å; L94-A96 VanDerWaalsContact C-N 3.32Å; L94-A96 PolarHBondContact O-N 3.38Å; L94-A97 WeakPolarHBondContact O-CB 3.37Å; L94-A97 PolarHBondContact O-N 3.04Å; L94-A97 VanDerWaalsContact O-N 3.12Å; L94-V98 WeakPolarHBondContact O-CG2 3.19Å; L94-V98 PolarHBondContact O-N 3.1Å
95	Q	98.3	Very high	97.9	Very high	119 Å²	119	101.3 Å²	101.3	56%	0.556	51%	0.509	S	S	*	.	H	α-helix	trans	-58	-45.4	175	-73.9	174.8	-19.9	0	0	111.2	I91 S92 A97 V98 E99	I91-Q95 HydrophobicContact CG2-CG 4.4Å; I91-Q95 WeakPolarHBondContact O-CG 3.33Å; I91-Q95 PolarHBondContact O-N 3Å; S92-Q95 PolarHBondContact O-N 2.83Å; Q95-A97 VanDerWaalsContact C-N 3.31Å; Q95-A97 PolarHBondContact O-N 3.46Å; Q95-V98 PolarHBondContact O-N 3.46Å; Q95-E99 PolarHBondContact O-N 3.08Å
96	A	98.3	Very high	97.9	Very high	47 Å²	47	98.3 Å²	98.3	39%	0.388	50%	0.5	S	S	.	.	H	α-helix	trans	-62.5	-37.5	175.8	0	0	0	0	0	112.5	S92 A93 L94 R100	S92-A96 WeakPolarHBondContact O-CB 3.45Å; S92-A96 PolarHBondContact O-N 3.01Å; A93-A96 PolarHBondContact O-N 3.46Å; L94-A96 VanDerWaalsContact C-N 3.32Å; L94-A96 PolarHBondContact O-N 3.38Å; A96-R100 VanDerWaalsContact O-CG 3.27Å; A96-R100 WeakPolarHBondContact O-CG 3.49Å; A96-R100 PolarHBondContact O-N 3.3Å
97	A	97.9	Very high	97.9	Very high	42 Å²	42	97.3 Å²	97.3	35%	0.347	50%	0.496	S	S	.	.	H	α-helix	trans	-66.3	-41.5	175.6	0	0	0	0	0	112	A93 L94 Q95 R100 M101	A93-A97 PolarHBondContact O-N 3.37Å; L94-A97 WeakPolarHBondContact O-CB 3.37Å; L94-A97 PolarHBondContact O-N 3.04Å; L94-A97 VanDerWaalsContact O-N 3.12Å; Q95-A97 VanDerWaalsContact C-N 3.31Å; Q95-A97 PolarHBondContact O-N 3.46Å; A97-R100 WeakPolarHBondContact O-CB 3.4Å; A97-R100 PolarHBondContact O-N 2.96Å; A97-M101 PolarHBondContact O-N 3.4Å
98	V	98.3	Very high	97.9	Very high	72 Å²	72	94.8 Å²	94.8	44%	0.436	49%	0.487	S	S	.	.	H	α-helix	trans	-62.3	-44.5	175.8	171.3	0	0	0	0	111.2	L94 Q95 R100 M101 R102	L94-V98 WeakPolarHBondContact O-CG2 3.19Å; L94-V98 PolarHBondContact O-N 3.1Å; Q95-V98 PolarHBondContact O-N 3.46Å; V98-R100 VanDerWaalsContact C-N 3.32Å; V98-R100 PolarHBondContact O-N 2.97Å; V98-M101 HydrophobicContact CG2-CE 4.06Å; V98-M101 WeakPolarHBondContact O-CB 3.43Å; V98-M101 PolarHBondContact O-N 3.39Å; V98-M101 VanDerWaalsContact O-N 3.08Å; V98-R102 PolarHBondContact O-N 3Å
99	E	98.3	Very high	98	Very high	98 Å²	98	96.9 Å²	96.9	46%	0.458	49%	0.492	S	S	.	.	H	α-helix	trans	-66.5	-34.2	176.8	-76.9	-53.6	149.9	0	0	113.1	Q95 M101 R102 T103	Q95-E99 PolarHBondContact O-N 3.08Å; E99-M101 VanDerWaalsContact C-N 3.32Å; E99-M101 PolarHBondContact O-N 3.32Å; E99-R102 PolarHBondContact O-N 3.39Å; E99-R102 VanDerWaalsContact OE2-CD 3.28Å; E99-R102 WeakPolarHBondContact OE2-CD 3.37Å; E99-T103 WeakPolarHBondContact O-CG2 3.47Å; E99-T103 PolarHBondContact O-N 2.9Å; E99-T103 PolarHBondContact O-OG1 3.25Å
100	R	97.9	Very high	98	Very high	173 Å²	173	96.9 Å²	96.9	65%	0.653	49%	0.488	S	S	*	.	H	α-helix	trans	-63	-38.4	169.9	-73.2	172.5	-175	-159.3	2.8	112	A96 A97 V98 T103 K104	A96-R100 VanDerWaalsContact O-CG 3.27Å; A96-R100 WeakPolarHBondContact O-CG 3.49Å; A96-R100 PolarHBondContact O-N 3.3Å; A97-R100 WeakPolarHBondContact O-CB 3.4Å; A97-R100 PolarHBondContact O-N 2.96Å; V98-R100 VanDerWaalsContact C-N 3.32Å; V98-R100 PolarHBondContact O-N 2.97Å; R100-T103 WeakPolarHBondContact CA-OG1 3.47Å; R100-T103 PolarHBondContact O-OG1 3.42Å; R100-K104 VanDerWaalsContact O-CB 3.28Å; R100-K104 WeakPolarHBondContact O-CB 3.28Å; R100-K104 WeakPolarHBondContact O-CG 3.27Å; R100-K104 PolarHBondContact O-N 3.04Å
101	M	97.1	Very high	98	Very high	101 Å²	101	96 Å²	96	50%	0.498	49%	0.489	S	S	.	.	H	α-helix	trans	-66.8	-42.9	175.3	-75	-173.4	-74.7	0	0	111.3	A97 V98 E99 T103 K104 I105	A97-M101 PolarHBondContact O-N 3.4Å; V98-M101 HydrophobicContact CG2-CE 4.06Å; V98-M101 WeakPolarHBondContact O-CB 3.43Å; V98-M101 PolarHBondContact O-N 3.39Å; V98-M101 VanDerWaalsContact O-N 3.08Å; E99-M101 VanDerWaalsContact C-N 3.32Å; E99-M101 PolarHBondContact O-N 3.32Å; M101-T103 PolarHBondContact O-N 2.97Å; M101-K104 PolarHBondContact O-N 3.36Å; M101-I105 HydrophobicContact CB-CD1 4.24Å; M101-I105 HydrophobicContact CG-CD1 4.3Å; M101-I105 WeakPolarHBondContact O-CA 3.48Å; M101-I105 WeakPolarHBondContact O-CB 3.44Å; M101-I105 WeakPolarHBondContact O-CG1 3.49Å; M101-I105 PolarHBondContact O-N 2.95Å
102	R	97.7	Very high	98	Very high	137 Å²	137	96.9 Å²	96.9	52%	0.517	49%	0.493	S	S	.	.	I	π-helix	trans	-55.2	-53.8	175.1	-174.2	-174.7	-172.8	143.1	3.3	111.6	V98 E99 K104 V106 D107	V98-R102 PolarHBondContact O-N 3Å; E99-R102 PolarHBondContact O-N 3.39Å; E99-R102 VanDerWaalsContact OE2-CD 3.28Å; E99-R102 WeakPolarHBondContact OE2-CD 3.37Å; R102-K104 VanDerWaalsContact C-N 3.33Å; R102-K104 PolarHBondContact O-N 3.05Å; R102-V106 HydrophobicContact CG-CB 4.21Å; R102-V106 HydrophobicContact CG-CG2 4.49Å; R102-V106 WeakPolarHBondContact O-CA 3.42Å; R102-V106 WeakPolarHBondContact O-CB 3.37Å; R102-V106 PolarHBondContact O-N 2.94Å; R102-D107 PolarHBondContact O-N 3.34Å
103	T	98.2	Very high	98	Very high	75 Å²	75	97.2 Å²	97.2	46%	0.46	49%	0.493	S	S	.	.	I	π-helix	trans	-66.2	-32.5	-177.4	51.5	0	0	0	0	113.6	E99 R100 M101 P108	E99-T103 WeakPolarHBondContact O-CG2 3.47Å; E99-T103 PolarHBondContact O-N 2.9Å; E99-T103 PolarHBondContact O-OG1 3.25Å; R100-T103 WeakPolarHBondContact CA-OG1 3.47Å; R100-T103 PolarHBondContact O-OG1 3.42Å; M101-T103 PolarHBondContact O-N 2.97Å; T103-P108 WeakPolarHBondContact O-CD 3.48Å
104	K	97.5	Very high	98	Very high	163 Å²	163	95.8 Å²	95.8	71%	0.709	48%	0.484	S	S	*	.	I	π-helix	trans	-91.9	-18.8	-178.8	-68.8	-172.9	175.7	-170.3	0	114.9	R100 M101 R102 P108	R100-K104 VanDerWaalsContact O-CB 3.28Å; R100-K104 WeakPolarHBondContact O-CB 3.28Å; R100-K104 WeakPolarHBondContact O-CG 3.27Å; R100-K104 PolarHBondContact O-N 3.04Å; M101-K104 PolarHBondContact O-N 3.36Å; R102-K104 VanDerWaalsContact C-N 3.33Å; R102-K104 PolarHBondContact O-N 3.05Å; K104-P108 WeakPolarHBondContact O-CG 3.41Å
105	I	97.2	Very high	98	Very high	107 Å²	107	99.1 Å²	99.1	55%	0.549	49%	0.489	S	S	.	.	I	π-helix	trans	-121.3	-58	-173	-54	176	0	0	0	110.6	M101 P108 Y109	M101-I105 HydrophobicContact CB-CD1 4.24Å; M101-I105 HydrophobicContact CG-CD1 4.3Å; M101-I105 WeakPolarHBondContact O-CA 3.48Å; M101-I105 WeakPolarHBondContact O-CB 3.44Å; M101-I105 WeakPolarHBondContact O-CG1 3.49Å; M101-I105 PolarHBondContact O-N 2.95Å; I105-P108 WeakPolarHBondContact O-CD 3.45Å; I105-Y109 WeakPolarHBondContact O-CB 3.44Å; I105-Y109 PolarHBondContact O-N 2.92Å
106	V	97.4	Very high	98	Very high	67 Å²	67	98.5 Å²	98.5	41%	0.406	49%	0.488	S	S	.	.	I	π-helix	trans	-67.7	-45.9	-174	-179.7	0	0	0	0	110.9	R102 Y109 N110	R102-V106 HydrophobicContact CG-CB 4.21Å; R102-V106 HydrophobicContact CG-CG2 4.49Å; R102-V106 WeakPolarHBondContact O-CA 3.42Å; R102-V106 WeakPolarHBondContact O-CB 3.37Å; R102-V106 PolarHBondContact O-N 2.94Å; V106-Y109 WeakPolarHBondContact O-CB 3.49Å; V106-Y109 PolarHBondContact O-N 2.98Å; V106-N110 PolarHBondContact O-N 2.87Å; V106-N110 PolarHBondContact O-ND2 3.26Å
107	D	97.8	Very high	98	Very high	64 Å²	64	99.2 Å²	99.2	34%	0.342	49%	0.488	S	S	.	.	H	α-helix	trans	-66.4	-45.9	-178	-62.5	-17.4	0	0	0	112.6	R102 Y109 N110 K111	R102-D107 PolarHBondContact O-N 3.34Å; D107-Y109 VanDerWaalsContact C-N 3.35Å; D107-Y109 PolarHBondContact O-N 2.84Å; D107-N110 PolarHBondContact O-N 3.47Å; D107-K111 WeakPolarHBondContact O-CG 3.28Å; D107-K111 PolarHBondContact O-N 3.06Å
108	P	98.1	Very high	98	Very high	51 Å²	51	103.1 Å²	103.1	33%	0.331	50%	0.499	S	S	.	.	H	α-helix	trans	-62.5	-39.5	173.6	-26.6	38.5	0	0	0	113	T103 K104 I105 N110 K111 I112	T103-P108 WeakPolarHBondContact O-CD 3.48Å; K104-P108 WeakPolarHBondContact O-CG 3.41Å; I105-P108 WeakPolarHBondContact O-CD 3.45Å; P108-N110 PolarHBondContact O-N 2.95Å; P108-K111 WeakPolarHBondContact O-CB 3.22Å; P108-K111 PolarHBondContact O-N 3.45Å; P108-I112 VanDerWaalsContact O-CG1 3.3Å; P108-I112 WeakPolarHBondContact O-CG1 3.3Å; P108-I112 PolarHBondContact O-N 3.32Å
109	Y	98.4	Very high	98	Very high	150 Å²	150	105 Å²	105	59%	0.588	51%	0.506	S	S	*	.	H	α-helix	trans	-56.7	-50.3	174.9	173.6	-94.1	0	0	0	111.1	I105 V106 D107 K111 I112 V113	I105-Y109 WeakPolarHBondContact O-CB 3.44Å; I105-Y109 PolarHBondContact O-N 2.92Å; V106-Y109 WeakPolarHBondContact O-CB 3.49Å; V106-Y109 PolarHBondContact O-N 2.98Å; D107-Y109 VanDerWaalsContact C-N 3.35Å; D107-Y109 PolarHBondContact O-N 2.84Å; Y109-K111 VanDerWaalsContact C-N 3.3Å; Y109-K111 PolarHBondContact O-N 3.39Å; Y109-I112 WeakPolarHBondContact O-CB 3.43Å; Y109-I112 PolarHBondContact O-N 3.09Å; Y109-I112 VanDerWaalsContact O-N 3.09Å; Y109-V113 HydrophobicContact CD1-CG2 4.24Å; Y109-V113 HydrophobicContact CE1-CG2 3.77Å; Y109-V113 HydrophobicContact CE2-CG2 4.17Å; Y109-V113 WeakPolarHBondContact O-CG2 3.44Å; Y109-V113 PolarHBondContact O-N 3.37Å
110	N	97.9	Very high	97.9	Very high	90 Å²	90	102.8 Å²	102.8	48%	0.481	50%	0.504	S	S	.	.	H	α-helix	trans	-61	-38.9	178.2	-72.3	-26.6	0	0	0	112.2	V106 D107 P108 V113 G114	V106-N110 PolarHBondContact O-N 2.87Å; V106-N110 PolarHBondContact O-ND2 3.26Å; D107-N110 PolarHBondContact O-N 3.47Å; P108-N110 PolarHBondContact O-N 2.95Å; N110-V113 PolarHBondContact O-N 3.34Å; N110-G114 PolarHBondContact O-N 3.49Å
111	K	98	Very high	97.9	Very high	148 Å²	148	102.9 Å²	102.9	64%	0.643	51%	0.505	S	S	*	.	H	α-helix	trans	-62.5	-41.4	174	-73.6	174.8	-177.6	175.2	0	112.2	D107 P108 Y109 G114 R115	D107-K111 WeakPolarHBondContact O-CG 3.28Å; D107-K111 PolarHBondContact O-N 3.06Å; P108-K111 WeakPolarHBondContact O-CB 3.22Å; P108-K111 PolarHBondContact O-N 3.45Å; Y109-K111 VanDerWaalsContact C-N 3.3Å; Y109-K111 PolarHBondContact O-N 3.39Å; K111-G114 PolarHBondContact O-N 3.03Å; K111-R115 WeakPolarHBondContact O-CG 3.33Å; K111-R115 PolarHBondContact O-N 3.22Å
112	I	98.3	Very high	97.9	Very high	100 Å²	100	103.2 Å²	103.2	51%	0.513	51%	0.508	S	S	.	.	H	α-helix	trans	-64.8	-48.4	178	-69.6	164.2	0	0	0	110.2	P108 Y109 G114 R115 I116	P108-I112 VanDerWaalsContact O-CG1 3.3Å; P108-I112 WeakPolarHBondContact O-CG1 3.3Å; P108-I112 PolarHBondContact O-N 3.32Å; Y109-I112 WeakPolarHBondContact O-CB 3.43Å; Y109-I112 PolarHBondContact O-N 3.09Å; Y109-I112 VanDerWaalsContact O-N 3.09Å; I112-G114 VanDerWaalsContact C-N 3.26Å; I112-G114 PolarHBondContact O-N 2.91Å; I112-R115 PolarHBondContact O-N 3.47Å; I112-I116 HydrophobicContact CG2-CD1 3.73Å; I112-I116 HydrophobicContact CG2-CG1 4.26Å; I112-I116 WeakPolarHBondContact O-CG1 3.47Å; I112-I116 PolarHBondContact O-N 3.03Å
113	V	98.5	Very high	97.8	Very high	59 Å²	59	103.2 Å²	103.2	36%	0.358	51%	0.514	S	S	.	.	H	α-helix	trans	-57.2	-42.1	176.7	173.6	0	0	0	0	111.2	Y109 N110 R115 I116 T117	Y109-V113 HydrophobicContact CD1-CG2 4.24Å; Y109-V113 HydrophobicContact CE1-CG2 3.77Å; Y109-V113 HydrophobicContact CE2-CG2 4.17Å; Y109-V113 WeakPolarHBondContact O-CG2 3.44Å; Y109-V113 PolarHBondContact O-N 3.37Å; N110-V113 PolarHBondContact O-N 3.34Å; V113-R115 PolarHBondContact O-N 3.04Å; V113-I116 PolarHBondContact O-N 3.4Å; V113-T117 PolarHBondContact O-N 3.12Å; V113-T117 PolarHBondContact O-OG1 3.24Å
114	G	98.3	Very high	97.8	Very high	32 Å²	32	103.9 Å²	103.9	33%	0.33	52%	0.518	S	S	.	.	H	α-helix	trans	-59.4	-45.8	173.8	0	0	0	0	0	112.9	N110 K111 I112 T117 Q118	N110-G114 PolarHBondContact O-N 3.49Å; K111-G114 PolarHBondContact O-N 3.03Å; I112-G114 VanDerWaalsContact C-N 3.26Å; I112-G114 PolarHBondContact O-N 2.91Å; G114-T117 WeakPolarHBondContact O-CB 3.43Å; G114-T117 PolarHBondContact O-N 3.47Å; G114-Q118 WeakPolarHBondContact O-CG 3.4Å; G114-Q118 PolarHBondContact O-N 3.02Å
115	R	98	Very high	97.8	Very high	187 Å²	187	99 Å²	99	71%	0.706	50%	0.504	S	S	*	.	H	α-helix	trans	-66.3	-39.6	177.3	-72	-180	-177.9	-136.2	1	112.9	K111 I112 V113 T117 Q118 L119	K111-R115 WeakPolarHBondContact O-CG 3.33Å; K111-R115 PolarHBondContact O-N 3.22Å; I112-R115 PolarHBondContact O-N 3.47Å; V113-R115 PolarHBondContact O-N 3.04Å; R115-T117 VanDerWaalsContact C-N 3.29Å; R115-T117 PolarHBondContact O-N 3.49Å; R115-Q118 PolarHBondContact O-N 3.45Å; R115-L119 WeakPolarHBondContact O-CB 3.37Å; R115-L119 PolarHBondContact O-N 3.32Å
116	I	98.3	Very high	97.8	Very high	105 Å²	105	98.2 Å²	98.2	54%	0.538	50%	0.5	S	S	.	.	H	α-helix	trans	-60.3	-43.6	174.4	-68.8	168.7	0	0	0	110	I112 V113 Q118 L119 A120	I112-I116 HydrophobicContact CG2-CD1 3.73Å; I112-I116 HydrophobicContact CG2-CG1 4.26Å; I112-I116 WeakPolarHBondContact O-CG1 3.47Å; I112-I116 PolarHBondContact O-N 3.03Å; V113-I116 PolarHBondContact O-N 3.4Å; I116-Q118 VanDerWaalsContact C-N 3.34Å; I116-Q118 PolarHBondContact O-N 3.22Å; I116-L119 PolarHBondContact O-N 3.17Å; I116-A120 PolarHBondContact O-N 3.34Å
117	T	98.1	Very high	97.7	Very high	63 Å²	63	99.9 Å²	99.9	39%	0.387	51%	0.507	S	S	.	.	H	α-helix	trans	-62.4	-41.4	177.1	-55.3	0	0	0	0	111.7	V113 G114 R115 A120 R121	V113-T117 PolarHBondContact O-N 3.12Å; V113-T117 PolarHBondContact O-OG1 3.24Å; G114-T117 WeakPolarHBondContact O-CB 3.43Å; G114-T117 PolarHBondContact O-N 3.47Å; R115-T117 VanDerWaalsContact C-N 3.29Å; R115-T117 PolarHBondContact O-N 3.49Å; T117-A120 PolarHBondContact O-N 2.99Å; T117-R121 WeakPolarHBondContact O-CG 3.41Å; T117-R121 PolarHBondContact O-N 2.99Å; T117-R121 VanDerWaalsContact O-N 3.17Å
118	Q	98	Very high	97.7	Very high	123 Å²	123	101.2 Å²	101.2	58%	0.575	51%	0.513	S	S	*	.	H	α-helix	trans	-63.8	-44.1	174.9	-72.1	174.8	-5.9	0	0	112	G114 R115 I116 A120 R121 L122	G114-Q118 WeakPolarHBondContact O-CG 3.4Å; G114-Q118 PolarHBondContact O-N 3.02Å; R115-Q118 PolarHBondContact O-N 3.45Å; I116-Q118 VanDerWaalsContact C-N 3.34Å; I116-Q118 PolarHBondContact O-N 3.22Å; Q118-A120 VanDerWaalsContact C-N 3.34Å; Q118-A120 PolarHBondContact O-N 3.5Å; Q118-R121 WeakPolarHBondContact O-CB 3.41Å; Q118-R121 PolarHBondContact O-N 3.03Å; Q118-L122 PolarHBondContact O-N 3.26Å
119	L	98.3	Very high	97.6	Very high	112 Å²	112	103.4 Å²	103.4	59%	0.586	52%	0.521	S	S	*	.	H	α-helix	trans	-61.5	-42.8	177.9	-173.3	65.5	0	0	0	111.5	R115 I116 R121 L122 Q123	R115-L119 WeakPolarHBondContact O-CB 3.37Å; R115-L119 PolarHBondContact O-N 3.32Å; I116-L119 PolarHBondContact O-N 3.17Å; L119-R121 VanDerWaalsContact C-N 3.31Å; L119-R121 PolarHBondContact O-N 3.25Å; L119-L122 PolarHBondContact O-N 2.98Å; L119-Q123 PolarHBondContact O-N 3.02Å
120	A	97.6	Very high	97.6	Very high	51 Å²	51	103.4 Å²	103.4	42%	0.421	52%	0.521	S	S	.	.	H	α-helix	trans	-59.4	-42.2	175.8	0	0	0	0	0	111.9	I116 T117 Q118 Q123 V124	I116-A120 PolarHBondContact O-N 3.34Å; T117-A120 PolarHBondContact O-N 2.99Å; Q118-A120 VanDerWaalsContact C-N 3.34Å; Q118-A120 PolarHBondContact O-N 3.5Å; A120-Q123 PolarHBondContact O-N 3.01Å; A120-V124 WeakPolarHBondContact O-CG2 3.12Å; A120-V124 PolarHBondContact O-N 3.41Å; A120-V124 VanDerWaalsContact O-N 3.12Å
121	R	96.8	Very high	97.5	Very high	175 Å²	175	103.4 Å²	103.4	66%	0.66	52%	0.524	S	S	*	.	H	α-helix	trans	-63.4	-43.1	175.2	-69.2	173.8	-176.9	-178.2	1	112.1	T117 Q118 L119 Q123 V124 S125	T117-R121 WeakPolarHBondContact O-CG 3.41Å; T117-R121 PolarHBondContact O-N 2.99Å; T117-R121 VanDerWaalsContact O-N 3.17Å; Q118-R121 WeakPolarHBondContact O-CB 3.41Å; Q118-R121 PolarHBondContact O-N 3.03Å; L119-R121 VanDerWaalsContact C-N 3.31Å; L119-R121 PolarHBondContact O-N 3.25Å; R121-Q123 VanDerWaalsContact C-N 3.31Å; R121-Q123 PolarHBondContact O-N 3.26Å; R121-V124 PolarHBondContact O-N 3.49Å; R121-S125 PolarHBondContact O-N 3.05Å; R121-S125 PolarHBondContact O-OG 3.4Å
122	L	97.5	Very high	97.4	Very high	108 Å²	108	101 Å²	101	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-62.4	-39.7	176.4	-73.5	171.7	0	0	0	111.9	Q118 L119 V124 S125 L126	Q118-L122 PolarHBondContact O-N 3.26Å; L119-L122 PolarHBondContact O-N 2.98Å; L122-V124 VanDerWaalsContact C-N 3.32Å; L122-V124 PolarHBondContact O-N 3.18Å; L122-S125 PolarHBondContact O-N 3.41Å; L122-L126 WeakPolarHBondContact O-CB 3.46Å; L122-L126 PolarHBondContact O-N 3.3Å
123	Q	96.6	Very high	97.3	Very high	138 Å²	138	100 Å²	100	65%	0.645	52%	0.516	S	S	*	.	H	α-helix	trans	-63.3	-38.9	177.3	-174	167.7	-15.1	0	0	112	L119 A120 R121 L126 N127	L119-Q123 PolarHBondContact O-N 3.02Å; A120-Q123 PolarHBondContact O-N 3.01Å; R121-Q123 VanDerWaalsContact C-N 3.31Å; R121-Q123 PolarHBondContact O-N 3.26Å; Q123-L126 PolarHBondContact O-N 3.46Å; Q123-N127 WeakPolarHBondContact O-CB 3.49Å; Q123-N127 PolarHBondContact O-N 3.42Å
124	V	97.3	Very high	97.1	Very high	89 Å²	89	102 Å²	102	54%	0.539	53%	0.525	S	S	.	.	H	α-helix	trans	-63.1	-47.6	172.8	173.5	0	0	0	0	111	A120 R121 L122 L126 N127 I128	A120-V124 WeakPolarHBondContact O-CG2 3.12Å; A120-V124 PolarHBondContact O-N 3.41Å; A120-V124 VanDerWaalsContact O-N 3.12Å; R121-V124 PolarHBondContact O-N 3.49Å; L122-V124 VanDerWaalsContact C-N 3.32Å; L122-V124 PolarHBondContact O-N 3.18Å; V124-L126 VanDerWaalsContact C-N 3.34Å; V124-L126 PolarHBondContact O-N 2.98Å; V124-N127 WeakPolarHBondContact O-CB 3.5Å; V124-N127 PolarHBondContact O-N 3.47Å; V124-I128 HydrophobicContact CG1-CD1 4.03Å; V124-I128 WeakPolarHBondContact O-CG1 3.45Å; V124-I128 PolarHBondContact O-N 3.26Å
125	S	97.1	Very high	97	Very high	61 Å²	61	108.3 Å²	108.3	43%	0.427	54%	0.539	S	S	.	.	H	α-helix	trans	-59.4	-44.1	177.6	-59.4	0	0	0	0	112.4	R121 L122 N127 I128 I129	R121-S125 PolarHBondContact O-N 3.05Å; R121-S125 PolarHBondContact O-OG 3.4Å; L122-S125 PolarHBondContact O-N 3.41Å; S125-N127 VanDerWaalsContact C-N 3.35Å; S125-N127 PolarHBondContact O-N 3.28Å; S125-I128 PolarHBondContact O-N 2.91Å; S125-I129 WeakPolarHBondContact O-CG1 3.4Å; S125-I129 PolarHBondContact O-N 2.99Å
126	L	96.9	Very high	96.8	Very high	89 Å²	89	103.2 Å²	103.2	47%	0.466	53%	0.529	S	S	.	.	H	α-helix	trans	-58.8	-46.3	174.8	-98.4	158.8	0	0	0	111.4	L122 Q123 V124 I128 I129 Y130	L122-L126 WeakPolarHBondContact O-CB 3.46Å; L122-L126 PolarHBondContact O-N 3.3Å; Q123-L126 PolarHBondContact O-N 3.46Å; V124-L126 VanDerWaalsContact C-N 3.34Å; V124-L126 PolarHBondContact O-N 2.98Å; L126-I128 VanDerWaalsContact C-N 3.32Å; L126-I128 PolarHBondContact O-N 3.46Å; L126-I129 PolarHBondContact O-N 2.91Å; L126-Y130 HydrophobicContact CD2-CD2 4.32Å; L126-Y130 HydrophobicContact CD2-CE2 3.71Å; L126-Y130 WeakPolarHBondContact O-CD2 3.5Å; L126-Y130 PolarHBondContact O-N 3.2Å
127	N	97.1	Very high	96.6	Very high	103 Å²	103	104.6 Å²	104.6	55%	0.551	54%	0.537	S	S	*	.	H	α-helix	trans	-58.4	-44.4	178.1	-172.9	-93.5	0	0	0	111.8	Q123 V124 S125 I129 Y130 V131	Q123-N127 WeakPolarHBondContact O-CB 3.49Å; Q123-N127 PolarHBondContact O-N 3.42Å; V124-N127 WeakPolarHBondContact O-CB 3.5Å; V124-N127 PolarHBondContact O-N 3.47Å; S125-N127 VanDerWaalsContact C-N 3.35Å; S125-N127 PolarHBondContact O-N 3.28Å; N127-I129 PolarHBondContact O-N 3.5Å; N127-Y130 PolarHBondContact O-N 2.89Å; N127-V131 WeakPolarHBondContact O-CG2 3.43Å; N127-V131 PolarHBondContact O-N 3.24Å
128	I	96.6	Very high	96.2	Very high	91 Å²	91	110 Å²	110	47%	0.467	56%	0.558	S	S	.	*	H	α-helix	trans	-59.9	-46	176.2	-65.7	165.6	0	0	0	110.9	V124 S125 L126 Y130 V131 I132	V124-I128 HydrophobicContact CG1-CD1 4.03Å; V124-I128 WeakPolarHBondContact O-CG1 3.45Å; V124-I128 PolarHBondContact O-N 3.26Å; S125-I128 PolarHBondContact O-N 2.91Å; L126-I128 VanDerWaalsContact C-N 3.32Å; L126-I128 PolarHBondContact O-N 3.46Å; I128-Y130 PolarHBondContact O-N 3.2Å; I128-V131 PolarHBondContact O-N 3.01Å; I128-I132 HydrophobicContact CG2-CD1 3.85Å; I128-I132 WeakPolarHBondContact O-CG1 3.34Å; I128-I132 PolarHBondContact O-N 3.46Å
129	I	96.8	Very high	95.5	Very high	98 Å²	98	108.4 Å²	108.4	50%	0.503	56%	0.559	S	S	.	*	H	α-helix	trans	-60.2	-46.1	177.7	-66.3	164	0	0	0	110.6	S125 L126 N127 V131 I132 V133	S125-I129 WeakPolarHBondContact O-CG1 3.4Å; S125-I129 PolarHBondContact O-N 2.99Å; L126-I129 PolarHBondContact O-N 2.91Å; N127-I129 PolarHBondContact O-N 3.5Å; I129-V131 VanDerWaalsContact C-N 3.32Å; I129-V131 PolarHBondContact O-N 3.43Å; I129-I132 PolarHBondContact O-N 2.82Å; I129-V133 HydrophobicContact CG2-CG2 4.28Å; I129-V133 WeakPolarHBondContact O-CG2 3.47Å; I129-V133 PolarHBondContact O-N 3.08Å
130	Y	96.8	Very high	94.3	Very high	150 Å²	150	110.9 Å²	110.9	59%	0.588	58%	0.584	S	S	*	*	H	α-helix	trans	-59.4	-41.5	177.4	-82.9	-66.3	0	0	0	112.5	L126 N127 I128 N134	L126-Y130 HydrophobicContact CD2-CD2 4.32Å; L126-Y130 HydrophobicContact CD2-CE2 3.71Å; L126-Y130 WeakPolarHBondContact O-CD2 3.5Å; L126-Y130 PolarHBondContact O-N 3.2Å; N127-Y130 PolarHBondContact O-N 2.89Å; I128-Y130 PolarHBondContact O-N 3.2Å; Y130-N134 PolarHBondContact O-N 2.89Å; Y130-N134 VanDerWaalsContact O-N 3.08Å; Y130-N134 PolarHBondContact O-ND2 3.14Å
131	V	96.4	Very high	94.1	Very high	89 Å²	89	113.9 Å²	113.9	54%	0.539	59%	0.592	S	S	.	*	H	α-helix	trans	-62.7	-46.3	176.6	170.6	0	0	0	0	110.9	N127 I128 I129 N134 Y135	N127-V131 WeakPolarHBondContact O-CG2 3.43Å; N127-V131 PolarHBondContact O-N 3.24Å; I128-V131 PolarHBondContact O-N 3.01Å; I129-V131 VanDerWaalsContact C-N 3.32Å; I129-V131 PolarHBondContact O-N 3.43Å; V131-N134 PolarHBondContact O-N 2.96Å; V131-Y135 WeakPolarHBondContact O-CB 3.36Å; V131-Y135 PolarHBondContact O-N 3.04Å
132	I	96.1	Very high	94	Very high	98 Å²	98	110.7 Å²	110.7	50%	0.503	59%	0.589	S	S	.	*	H	α-helix	trans	-62.2	-47.7	179.4	-67.2	167.3	0	0	0	110.9	I128 I129 N134 Y135 V136	I128-I132 HydrophobicContact CG2-CD1 3.85Å; I128-I132 WeakPolarHBondContact O-CG1 3.34Å; I128-I132 PolarHBondContact O-N 3.46Å; I129-I132 PolarHBondContact O-N 2.82Å; I132-N134 VanDerWaalsContact C-N 3.34Å; I132-N134 PolarHBondContact O-N 3.25Å; I132-Y135 PolarHBondContact O-N 3.28Å; I132-V136 HydrophobicContact CG2-CG2 4.3Å; I132-V136 WeakPolarHBondContact O-CG2 3.35Å; I132-V136 PolarHBondContact O-N 3.12Å
133	V	96.2	Very high	93.8	Very high	78 Å²	78	110.8 Å²	110.8	47%	0.473	59%	0.59	S	S	.	*	H	α-helix	trans	-59.7	-45.6	-179.7	170.5	0	0	0	0	110.9	I129 Y135 V136 L137	I129-V133 HydrophobicContact CG2-CG2 4.28Å; I129-V133 WeakPolarHBondContact O-CG2 3.47Å; I129-V133 PolarHBondContact O-N 3.08Å; V133-Y135 PolarHBondContact O-N 3.22Å; V133-V136 PolarHBondContact O-N 3.48Å; V133-L137 WeakPolarHBondContact O-CB 3.5Å; V133-L137 PolarHBondContact O-N 2.96Å
134	N	94.8	Very high	93.6	Very high	103 Å²	103	109.2 Å²	109.2	55%	0.551	59%	0.587	S	S	*	*	H	α-helix	trans	-63.1	-41.8	176.9	-82.1	-80.1	0	0	0	112	Y130 V131 I132 L137 Q138	Y130-N134 PolarHBondContact O-N 2.89Å; Y130-N134 VanDerWaalsContact O-N 3.08Å; Y130-N134 PolarHBondContact O-ND2 3.14Å; V131-N134 PolarHBondContact O-N 2.96Å; I132-N134 VanDerWaalsContact C-N 3.34Å; I132-N134 PolarHBondContact O-N 3.25Å; N134-L137 PolarHBondContact O-N 3.18Å; N134-Q138 WeakPolarHBondContact O-CB 3.36Å; N134-Q138 PolarHBondContact O-N 2.91Å; N134-Q138 VanDerWaalsContact O-N 3.12Å
135	Y	95.6	Very high	93.4	Very high	163 Å²	163	110.5 Å²	110.5	64%	0.639	59%	0.59	S	S	*	*	H	α-helix	trans	-61	-47.2	176.9	-176.4	-91.4	0	0	0	111.8	V131 I132 V133 L137 Q138 C139	V131-Y135 WeakPolarHBondContact O-CB 3.36Å; V131-Y135 PolarHBondContact O-N 3.04Å; I132-Y135 PolarHBondContact O-N 3.28Å; V133-Y135 PolarHBondContact O-N 3.22Å; Y135-L137 PolarHBondContact O-N 3.4Å; Y135-Q138 PolarHBondContact O-N 3.5Å; Y135-C139 PolarHBondContact O-N 3.43Å; Y135-C139 VanDerWaalsContact O-N 3.14Å
136	V	94.8	Very high	93.1	Very high	80 Å²	80	113.8 Å²	113.8	49%	0.485	60%	0.6	S	S	.	*	H	α-helix	trans	-61.8	-43.6	177.8	172.9	0	0	0	0	111.1	I132 V133 Q138 C139 C140	I132-V136 HydrophobicContact CG2-CG2 4.3Å; I132-V136 WeakPolarHBondContact O-CG2 3.35Å; I132-V136 PolarHBondContact O-N 3.12Å; V133-V136 PolarHBondContact O-N 3.48Å; V136-Q138 PolarHBondContact O-N 3.21Å; V136-C139 PolarHBondContact O-N 2.92Å; V136-C140 PolarHBondContact O-N 3.39Å
137	L	93.5	Very high	92.9	Very high	134 Å²	134	115.6 Å²	115.6	70%	0.702	61%	0.61	S	S	*	*	H	α-helix	trans	-63	-28.8	178.9	-133.3	93.1	0	0	0	113	V133 N134 Y135	V133-L137 WeakPolarHBondContact O-CB 3.5Å; V133-L137 PolarHBondContact O-N 2.96Å; N134-L137 PolarHBondContact O-N 3.18Å; Y135-L137 PolarHBondContact O-N 3.4Å
138	Q	89.9	Confident	92.5	Very high	178 Å²	178	116.5 Å²	116.5	83%	0.832	62%	0.615	S	S	*	*	H	α-helix	trans	-87.1	-18.8	-179.7	-168.8	150.1	-38.9	0	0	113.4	N134 Y135 V136	N134-Q138 WeakPolarHBondContact O-CB 3.36Å; N134-Q138 PolarHBondContact O-N 2.91Å; N134-Q138 VanDerWaalsContact O-N 3.12Å; Y135-Q138 PolarHBondContact O-N 3.5Å; V136-Q138 PolarHBondContact O-N 3.21Å
139	C	82.3	Confident	92.2	Very high	89 Å²	89	118.7 Å²	118.7	60%	0.601	63%	0.627	S	S	*	*	H	α-helix	trans	-90.4	-20	175.4	-72.8	0	0	0	0	114.1	Y135 V136	Y135-C139 PolarHBondContact O-N 3.43Å; Y135-C139 VanDerWaalsContact O-N 3.14Å; V136-C139 PolarHBondContact O-N 2.92Å
140	C	73.3	Confident	91.8	Very high	164 Å²	164	120.5 Å²	120.5	100%	1.108	64%	0.638	S	S	*	*			trans	-87	0	173.1	-95	0	0	0	0	111.7	V136	V136-C140 PolarHBondContact O-N 3.39Å

Retrieved 140 of 140 residues in 30.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).