A0A096M7E7_POEFO Loading...

Vesicle associated membrane protein 3

AlphaFold DB , UniProt , Accession A0A096M7E7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 102 aa.

						>A0A096M7E7_POEFO|A0A096M7E7
MSAPGPEGSAAASSNKRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAILIAVIVIIIIIIIIWACS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.4	Very low	50.1	Low	238 Å²	238	119.6 Å²	119.6	100%	1.172	81%	0.806	S	S	*	*				0	124.7	0	-98.7	103.4	102.6	0	0	107
2	S	44.1	Very low	50.2	Low	115 Å²	115	115.8 Å²	115.8	80%	0.804	79%	0.789	S	S	*	*			cis	-155	147.9	28.8	-62.5	0	0	0	0	110.1
3	A	53.3	Low	50.5	Low	96 Å²	96	112.5 Å²	112.5	79%	0.793	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-79.9	147.8	178	0	0	0	0	0	111.8
4	P	48.5	Very low	50.6	Low	129 Å²	129	109.9 Å²	109.9	84%	0.838	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-86.9	127.8	162.8	32.9	-25.4	0	0	0	109.5
5	G	53.8	Low	50.9	Low	65 Å²	65	109.6 Å²	109.6	67%	0.67	74%	0.738	S	S	*	*	P	Polyproline II helix	trans	-75.7	156.7	174.7	0	0	0	0	0	112.3	E7	G5-E7 PolarHBondContact O-N 3.31Å
6	P	49.1	Very low	51.2	Low	137 Å²	137	112.3 Å²	112.3	89%	0.89	73%	0.734	S	S	*	*			trans	-88.9	94.7	179.7	33.8	-28.5	0	0	0	110.4
7	E	53.3	Low	51.3	Low	202 Å²	202	116.9 Å²	116.9	94%	0.944	73%	0.733	S	S	*	*			trans	-90.6	101.8	162.8	-61.4	-159	126	0	0	108.9	G5	G5-E7 PolarHBondContact O-N 3.31Å
8	G	49.5	Very low	51.4	Low	65 Å²	65	116.6 Å²	116.6	67%	0.67	72%	0.724	S	S	*	*			trans	-171.1	8.1	179.6	0	0	0	0	0	117.6
9	S	51.5	Low	51.4	Low	112 Å²	112	118.2 Å²	118.2	78%	0.783	72%	0.722	S	S	*	*	S	Bend	trans	-90.5	-5.4	-173.3	-179.9	0	0	0	0	115.2
10	A	50.7	Low	51.4	Low	82 Å²	82	119.2 Å²	119.2	68%	0.678	72%	0.719	S	S	*	*	S	Bend	trans	-92.2	-26.5	-173.4	0	0	0	0	0	114.3
11	A	49.2	Very low	51.4	Low	75 Å²	75	117.5 Å²	117.5	62%	0.62	71%	0.709	S	S	*	*	H	α-helix	trans	-83	-20.9	-174.2	0	0	0	0	0	114.5
12	A	51.3	Low	51.2	Low	73 Å²	73	112.7 Å²	112.7	60%	0.603	68%	0.684	S	S	*	*	H	α-helix	trans	-79.3	-23.9	-178.9	0	0	0	0	0	113.4
13	S	53.8	Low	51.5	Low	74 Å²	74	110.5 Å²	110.5	52%	0.517	67%	0.672	S	S	.	*	H	α-helix	trans	-79.3	-35	-177.9	-166.8	0	0	0	0	112.6	N15 K16	S13-N15 PolarHBondContact O-N 3.35Å; S13-K16 PolarHBondContact O-N 3.49Å
14	S	52.5	Low	51.3	Low	76 Å²	76	112.7 Å²	112.7	53%	0.531	67%	0.666	S	S	.	*	H	α-helix	trans	-68.2	-33.5	177.8	-55.4	0	0	0	0	113	K16 L18	S14-K16 VanDerWaalsContact C-N 3.33Å; S14-K16 PolarHBondContact O-N 3.49Å; S14-L18 PolarHBondContact O-N 3.46Å
15	N	54.2	Low	51.5	Low	105 Å²	105	110.5 Å²	110.5	56%	0.561	65%	0.65	S	S	*	*	H	α-helix	trans	-68.3	-29.7	176.7	-99.9	-67.3	0	0	0	113.2	S13 Q19	S13-N15 PolarHBondContact O-N 3.35Å; N15-Q19 PolarHBondContact O-N 3.24Å
16	K	55.4	Low	51.3	Low	153 Å²	153	113.6 Å²	113.6	67%	0.665	65%	0.651	S	S	*	*	H	α-helix	trans	-75	-30.7	-177.5	-154.7	161.5	-166.6	171.4	0	113	S13 S14 Q20	S13-K16 PolarHBondContact O-N 3.49Å; S14-K16 VanDerWaalsContact C-N 3.33Å; S14-K16 PolarHBondContact O-N 3.49Å; K16-Q20 PolarHBondContact O-N 2.82Å
17	R	53.2	Low	51.4	Low	190 Å²	190	113.7 Å²	113.7	72%	0.717	64%	0.64	S	S	*	*	H	α-helix	trans	-76.8	-34.1	176.7	-67.2	-173.3	172.6	-147.8	-2.1	112.9	T21	R17-T21 PolarHBondContact O-N 3.39Å; R17-T21 PolarHBondContact O-OG1 3.41Å
18	L	53.4	Low	51.4	Low	111 Å²	111	108 Å²	108	58%	0.581	62%	0.618	S	S	*	*	H	α-helix	trans	-71.6	-39.9	176	-74.7	168	0	0	0	112	S14 Q20 T21 Q22	S14-L18 PolarHBondContact O-N 3.46Å; L18-Q20 PolarHBondContact O-N 3.09Å; L18-T21 PolarHBondContact O-N 3.45Å; L18-T21 VanDerWaalsContact O-N 3.09Å; L18-Q22 PolarHBondContact O-N 3.12Å; L18-Q22 VanDerWaalsContact O-N 3.12Å
19	Q	51.8	Low	51.6	Low	147 Å²	147	107.7 Å²	107.7	69%	0.687	60%	0.604	S	S	*	*	H	α-helix	trans	-66.7	-32.5	175.5	-85.9	-177.6	-3.3	0	0	114.1	N15 T21	N15-Q19 PolarHBondContact O-N 3.24Å; Q19-T21 PolarHBondContact O-N 3.4Å
20	Q	50.4	Low	51.7	Low	139 Å²	139	107 Å²	107	65%	0.65	59%	0.592	S	S	*	*	H	α-helix	trans	-72	-17.1	172.5	-77.7	-173.3	-58.3	0	0	113.5	K16 L18	K16-Q20 PolarHBondContact O-N 2.82Å; L18-Q20 PolarHBondContact O-N 3.09Å
21	T	52.4	Low	52	Low	84 Å²	84	107.9 Å²	107.9	52%	0.515	58%	0.584	S	S	.	*	H	α-helix	trans	-90.2	-30.1	178	-49.2	0	0	0	0	111.3	R17 L18 Q19 Q24 V25	R17-T21 PolarHBondContact O-N 3.39Å; R17-T21 PolarHBondContact O-OG1 3.41Å; L18-T21 PolarHBondContact O-N 3.45Å; L18-T21 VanDerWaalsContact O-N 3.09Å; Q19-T21 PolarHBondContact O-N 3.4Å; T21-Q24 PolarHBondContact O-N 3.42Å; T21-V25 WeakPolarHBondContact O-CG2 3.38Å
22	Q	44.4	Very low	52.3	Low	137 Å²	137	110.6 Å²	110.6	64%	0.64	59%	0.585	S	S	*	*	H	α-helix	trans	-69.6	-36.2	177.4	-131.6	77.9	41.5	0	0	112.8	L18 Q24 V25	L18-Q22 PolarHBondContact O-N 3.12Å; L18-Q22 VanDerWaalsContact O-N 3.12Å; Q22-Q24 PolarHBondContact O-N 3.35Å; Q22-V25 PolarHBondContact O-N 3.33Å
23	A	50.9	Low	52.6	Low	68 Å²	68	114.4 Å²	114.4	56%	0.562	58%	0.584	S	S	*	*	H	α-helix	trans	-71.1	-16.5	178	0	0	0	0	0	113.9	V25	A23-V25 VanDerWaalsContact C-N 3.33Å
24	Q	47.9	Very low	52.4	Low	143 Å²	143	115 Å²	115	67%	0.668	58%	0.584	S	S	*	*	H	α-helix	trans	-84.7	-5	177.7	-111.2	176.4	78.1	0	0	113.6	T21 Q22 V28	T21-Q24 PolarHBondContact O-N 3.42Å; Q22-Q24 PolarHBondContact O-N 3.35Å; Q24-V28 WeakPolarHBondContact O-CG2 3.48Å
25	V	51.9	Low	52.4	Low	82 Å²	82	116 Å²	116	50%	0.497	58%	0.584	S	S	.	*	H	α-helix	trans	-104.8	-27.2	-175.1	-170.4	0	0	0	0	112.5	T21 Q22 A23 V29	T21-V25 WeakPolarHBondContact O-CG2 3.38Å; Q22-V25 PolarHBondContact O-N 3.33Å; A23-V25 VanDerWaalsContact C-N 3.33Å; V25-V29 WeakPolarHBondContact O-CG2 3.48Å
26	D	50.3	Low	52.4	Low	131 Å²	131	114.6 Å²	114.6	70%	0.701	58%	0.579	S	S	*	*	H	α-helix	trans	-75	-25.6	175.2	-81.5	-34.5	0	0	0	113
27	E	51.9	Low	52.3	Low	139 Å²	139	112.6 Å²	112.6	65%	0.65	58%	0.575	S	S	*	*	H	α-helix	trans	-77.4	-31.7	-177.5	-165.4	171.7	-172.7	0	0	113.1	I31	E27-I31 HydrophobicContact CG-CD1 4.5Å; E27-I31 WeakPolarHBondContact O-CD1 3.47Å; E27-I31 VanDerWaalsContact O-CG1 3.29Å; E27-I31 WeakPolarHBondContact O-CG1 3.3Å; E27-I31 PolarHBondContact O-N 3.04Å
28	V	53	Low	52.3	Low	81 Å²	81	110 Å²	110	49%	0.491	57%	0.569	S	S	.	*	H	α-helix	trans	-78.4	-19.6	178.2	-92.3	0	0	0	0	113.9	Q24 M32	Q24-V28 WeakPolarHBondContact O-CG2 3.48Å; V28-M32 PolarHBondContact O-N 3.44Å
29	V	53.3	Low	52.1	Low	60 Å²	60	108.9 Å²	108.9	36%	0.364	57%	0.567	S	S	.	*	H	α-helix	trans	-74.2	-37.8	176.5	-179.6	0	0	0	0	110.6	V25 M32 R33	V25-V29 WeakPolarHBondContact O-CG2 3.48Å; V29-M32 PolarHBondContact O-N 3.34Å; V29-R33 WeakPolarHBondContact O-CG 3.43Å; V29-R33 PolarHBondContact O-N 3.4Å; V29-R33 VanDerWaalsContact O-N 3.14Å
30	D	53.8	Low	51.9	Low	98 Å²	98	107.2 Å²	107.2	52%	0.524	56%	0.562	S	S	.	*	H	α-helix	trans	-71.7	-33.6	173.5	-86.5	-4.4	0	0	0	112.2	R33 V34	D30-R33 PolarHBondContact O-N 3.14Å; D30-R33 IonicContact OD1-NH1 2.95Å; D30-R33 PolarHBondContact OD1-NH1 3.32Å; D30-V34 WeakPolarHBondContact O-CG2 3.29Å; D30-V34 PolarHBondContact O-N 2.95Å
31	I	58.1	Low	51.8	Low	100 Å²	100	107.7 Å²	107.7	51%	0.513	56%	0.564	S	S	.	*	H	α-helix	trans	-63.9	-42	172.5	-66	166.5	0	0	0	111.1	E27 V34 N35	E27-I31 HydrophobicContact CG-CD1 4.5Å; E27-I31 WeakPolarHBondContact O-CD1 3.47Å; E27-I31 VanDerWaalsContact O-CG1 3.29Å; E27-I31 WeakPolarHBondContact O-CG1 3.3Å; E27-I31 PolarHBondContact O-N 3.04Å; I31-V34 PolarHBondContact O-N 3.09Å; I31-N35 VanDerWaalsContact O-CB 3.27Å; I31-N35 WeakPolarHBondContact O-CB 3.41Å; I31-N35 PolarHBondContact O-N 3.27Å
32	M	55.2	Low	51.5	Low	132 Å²	132	112.5 Å²	112.5	65%	0.65	57%	0.573	S	S	*	*	H	α-helix	trans	-69.8	-30.7	177.6	-93.6	-124.1	-74.7	0	0	113.9	V28 V29 N35 V36	V28-M32 PolarHBondContact O-N 3.44Å; V29-M32 PolarHBondContact O-N 3.34Å; M32-N35 PolarHBondContact O-N 2.92Å; M32-V36 VanDerWaalsContact O-CG2 3.3Å; M32-V36 WeakPolarHBondContact O-CG2 3.4Å; M32-V36 PolarHBondContact O-N 2.87Å
33	R	55.8	Low	51.8	Low	153 Å²	153	111.6 Å²	111.6	58%	0.577	57%	0.572	S	S	*	*	H	α-helix	trans	-63.1	-47.8	172.4	-74.5	178.5	-179.5	119.9	4	111.1	V29 D30 N35 V36 D37	V29-R33 WeakPolarHBondContact O-CG 3.43Å; V29-R33 PolarHBondContact O-N 3.4Å; V29-R33 VanDerWaalsContact O-N 3.14Å; D30-R33 PolarHBondContact O-N 3.14Å; D30-R33 IonicContact OD1-NH1 2.95Å; D30-R33 PolarHBondContact OD1-NH1 3.32Å; R33-N35 VanDerWaalsContact C-N 3.27Å; R33-N35 PolarHBondContact O-N 3.44Å; R33-V36 PolarHBondContact O-N 3.45Å; R33-D37 PolarHBondContact O-N 3.44Å
34	V	50.3	Low	51.3	Low	86 Å²	86	116 Å²	116	52%	0.521	58%	0.582	S	S	.	*	H	α-helix	trans	-66.6	-30	176.1	-179.5	0	0	0	0	111.8	D30 I31 K38	D30-V34 WeakPolarHBondContact O-CG2 3.29Å; D30-V34 PolarHBondContact O-N 2.95Å; I31-V34 PolarHBondContact O-N 3.09Å; V34-K38 WeakPolarHBondContact O-CB 3.49Å; V34-K38 PolarHBondContact O-N 3.26Å; V34-K38 VanDerWaalsContact O-N 3.14Å
35	N	53	Low	51.2	Low	98 Å²	98	117.2 Å²	117.2	52%	0.524	59%	0.585	S	S	.	*	H	α-helix	trans	-77.7	-29.1	178.6	-151.4	47.7	0	0	0	113.1	I31 M32 R33 K38 V39	I31-N35 VanDerWaalsContact O-CB 3.27Å; I31-N35 WeakPolarHBondContact O-CB 3.41Å; I31-N35 PolarHBondContact O-N 3.27Å; M32-N35 PolarHBondContact O-N 2.92Å; R33-N35 VanDerWaalsContact C-N 3.27Å; R33-N35 PolarHBondContact O-N 3.44Å; N35-K38 PolarHBondContact O-N 3.31Å; N35-V39 WeakPolarHBondContact O-CB 3.27Å; N35-V39 PolarHBondContact O-N 3.35Å
36	V	54.8	Low	50.8	Low	75 Å²	75	118.4 Å²	118.4	46%	0.455	59%	0.588	S	S	.	*	H	α-helix	trans	-69	-42.1	172.7	167.6	0	0	0	0	110.8	M32 R33 K38 V39 L40	M32-V36 VanDerWaalsContact O-CG2 3.3Å; M32-V36 WeakPolarHBondContact O-CG2 3.4Å; M32-V36 PolarHBondContact O-N 2.87Å; R33-V36 PolarHBondContact O-N 3.45Å; V36-K38 VanDerWaalsContact C-N 3.31Å; V36-K38 PolarHBondContact O-N 2.9Å; V36-V39 PolarHBondContact O-N 3.37Å; V36-L40 HydrophobicContact CG1-CD1 4.21Å; V36-L40 PolarHBondContact O-N 3.15Å; V36-L40 VanDerWaalsContact O-N 3.09Å
37	D	51.7	Low	50.6	Low	110 Å²	110	116.1 Å²	116.1	59%	0.588	58%	0.581	S	S	*	*	H	α-helix	trans	-63.9	-38.6	173.9	-67.7	-28.8	0	0	0	111.2	R33 E41	R33-D37 PolarHBondContact O-N 3.44Å; D37-E41 PolarHBondContact O-N 3.23Å
38	K	54.3	Low	50.3	Low	136 Å²	136	115 Å²	115	59%	0.591	58%	0.576	S	S	*	*	H	α-helix	trans	-70.5	-29.4	174.7	-98.6	177.6	176.9	173	0	114.6	V34 N35 V36 R42	V34-K38 WeakPolarHBondContact O-CB 3.49Å; V34-K38 PolarHBondContact O-N 3.26Å; V34-K38 VanDerWaalsContact O-N 3.14Å; N35-K38 PolarHBondContact O-N 3.31Å; V36-K38 VanDerWaalsContact C-N 3.31Å; V36-K38 PolarHBondContact O-N 2.9Å; K38-R42 WeakPolarHBondContact O-CB 3.39Å; K38-R42 PolarHBondContact O-N 3.14Å
39	V	48.5	Very low	50	Low	88 Å²	88	116.9 Å²	116.9	53%	0.533	58%	0.583	S	S	.	*	H	α-helix	trans	-79.6	-29.5	178.7	93.3	0	0	0	0	111.2	N35 V36 R42 D43	N35-V39 WeakPolarHBondContact O-CB 3.27Å; N35-V39 PolarHBondContact O-N 3.35Å; V36-V39 PolarHBondContact O-N 3.37Å; V39-R42 PolarHBondContact O-N 3.33Å; V39-D43 PolarHBondContact O-N 3.28Å; V39-D43 VanDerWaalsContact O-N 3.15Å
40	L	48.8	Very low	49.6	Very low	112 Å²	112	119.1 Å²	119.1	59%	0.586	59%	0.593	S	S	*	*	H	α-helix	trans	-66.8	-38.3	172.1	-92.9	153.8	0	0	0	112.8	V36 R42	V36-L40 HydrophobicContact CG1-CD1 4.21Å; V36-L40 PolarHBondContact O-N 3.15Å; V36-L40 VanDerWaalsContact O-N 3.09Å; L40-R42 VanDerWaalsContact C-N 3.31Å
41	E	47.8	Very low	49.5	Very low	149 Å²	149	120 Å²	120	70%	0.696	60%	0.598	S	S	*	*	H	α-helix	trans	-73.1	-23.2	172.2	-75.4	-172.2	159.8	0	0	113.4	D37	D37-E41 PolarHBondContact O-N 3.23Å
42	R	46.3	Very low	49.1	Very low	184 Å²	184	123.1 Å²	123.1	69%	0.694	60%	0.603	S	S	*	*	H	α-helix	trans	-81.9	-20.6	179.6	-150	179.6	170.5	142.1	1.3	112.9	K38 V39 L40 L46	K38-R42 WeakPolarHBondContact O-CB 3.39Å; K38-R42 PolarHBondContact O-N 3.14Å; V39-R42 PolarHBondContact O-N 3.33Å; L40-R42 VanDerWaalsContact C-N 3.31Å; R42-L46 WeakPolarHBondContact O-CD1 3.47Å
43	D	49.3	Very low	49	Very low	119 Å²	119	119.3 Å²	119.3	64%	0.636	59%	0.593	S	S	*	*	H	α-helix	trans	-76.9	-35	177.2	-146	39.4	0	0	0	111.9	V39 K45 L46	V39-D43 PolarHBondContact O-N 3.28Å; V39-D43 VanDerWaalsContact O-N 3.15Å; D43-K45 PolarHBondContact O-N 3.3Å; D43-L46 PolarHBondContact O-N 3.45Å
44	Q	42.1	Very low	48.7	Very low	161 Å²	161	116.8 Å²	116.8	75%	0.752	59%	0.59	S	S	*	*	H	α-helix	trans	-74.5	-20.8	176.8	-70.2	-169.3	-9	0	0	114.2
45	K	46	Very low	48.9	Very low	168 Å²	168	115.9 Å²	115.9	73%	0.73	59%	0.592	S	S	*	*	H	α-helix	trans	-90	-6.3	175	-79.5	-174.6	176.6	174.6	0	114.4	D43	D43-K45 PolarHBondContact O-N 3.3Å
46	L	42.5	Very low	48.9	Very low	107 Å²	107	117.7 Å²	117.7	56%	0.56	60%	0.601	S	S	*	*	H	α-helix	trans	-86.5	-32.8	174.9	-86.9	159.4	0	0	0	112.3	R42 D43 L49 D50	R42-L46 WeakPolarHBondContact O-CD1 3.47Å; D43-L46 PolarHBondContact O-N 3.45Å; L46-L49 PolarHBondContact O-N 3.42Å; L46-D50 PolarHBondContact O-N 3.46Å
47	S	46.4	Very low	48.7	Very low	82 Å²	82	120.8 Å²	120.8	57%	0.573	61%	0.61	S	S	*	*	H	α-helix	trans	-66.1	-39.6	178.7	-171.2	0	0	0	0	112.9	L49	S47-L49 PolarHBondContact O-N 3.38Å
48	E	46	Very low	48.9	Very low	115 Å²	115	118.4 Å²	118.4	54%	0.537	61%	0.606	S	S	.	*	H	α-helix	trans	-81	-13.8	-178.7	-143.3	-164.8	153.3	0	0	113.9	R52	E48-R52 VanDerWaalsContact O-CG 3.31Å; E48-R52 WeakPolarHBondContact O-CG 3.38Å; E48-R52 IonicContact OE1-CZ 3.61Å; E48-R52 IonicContact OE1-NE 3.71Å; E48-R52 IonicContact OE1-NH2 2.78Å; E48-R52 PolarHBondContact OE1-NH2 3.02Å
49	L	45.7	Very low	49	Very low	121 Å²	121	114 Å²	114	63%	0.634	60%	0.599	S	S	*	*	H	α-helix	trans	-89.3	-30.4	177.1	-143.8	79.5	0	0	0	111.9	L46 S47 A53	L46-L49 PolarHBondContact O-N 3.42Å; S47-L49 PolarHBondContact O-N 3.38Å; L49-A53 VanDerWaalsContact O-CB 3.28Å; L49-A53 WeakPolarHBondContact O-CB 3.48Å; L49-A53 PolarHBondContact O-N 3.28Å
50	D	46.3	Very low	49.3	Very low	108 Å²	108	112.6 Å²	112.6	58%	0.578	60%	0.597	S	S	*	*	H	α-helix	trans	-67.7	-48.1	176.9	-152.8	40.8	0	0	0	110.7	L46 R52 A53 D54	L46-D50 PolarHBondContact O-N 3.46Å; D50-R52 VanDerWaalsContact C-N 3.3Å; D50-R52 PolarHBondContact O-N 3.47Å; D50-A53 PolarHBondContact O-N 3.04Å; D50-A53 VanDerWaalsContact O-N 3.15Å; D50-D54 PolarHBondContact O-N 3.29Å
51	D	51.1	Low	49.4	Very low	117 Å²	117	110.3 Å²	110.3	63%	0.626	59%	0.59	S	S	*	*	H	α-helix	trans	-62.3	-34.4	175.7	-79	-28.4	0	0	0	113	A55	D51-A55 WeakPolarHBondContact O-CB 3.37Å; D51-A55 PolarHBondContact O-N 2.78Å
52	R	49.8	Very low	49.5	Very low	164 Å²	164	109.8 Å²	109.8	62%	0.619	59%	0.588	S	S	*	*	H	α-helix	trans	-77.9	-30.7	176.6	-72.8	-175.5	-169.6	-156.6	8.6	112.3	E48 D50 L56	E48-R52 VanDerWaalsContact O-CG 3.31Å; E48-R52 WeakPolarHBondContact O-CG 3.38Å; E48-R52 IonicContact OE1-CZ 3.61Å; E48-R52 IonicContact OE1-NE 3.71Å; E48-R52 IonicContact OE1-NH2 2.78Å; E48-R52 PolarHBondContact OE1-NH2 3.02Å; D50-R52 VanDerWaalsContact C-N 3.3Å; D50-R52 PolarHBondContact O-N 3.47Å; R52-L56 VanDerWaalsContact O-CB 3.29Å; R52-L56 WeakPolarHBondContact O-CB 3.31Å; R52-L56 PolarHBondContact O-N 2.88Å
53	A	52.3	Low	49.9	Very low	52 Å²	52	108.7 Å²	108.7	43%	0.43	59%	0.588	S	S	.	*	H	α-helix	trans	-69.9	-43.5	176.1	0	0	0	0	0	111.5	L49 D50 L56 Q57	L49-A53 VanDerWaalsContact O-CB 3.28Å; L49-A53 WeakPolarHBondContact O-CB 3.48Å; L49-A53 PolarHBondContact O-N 3.28Å; D50-A53 PolarHBondContact O-N 3.04Å; D50-A53 VanDerWaalsContact O-N 3.15Å; A53-L56 PolarHBondContact O-N 3.15Å; A53-Q57 WeakPolarHBondContact O-CB 3.38Å; A53-Q57 PolarHBondContact O-N 2.92Å
54	D	50.4	Low	49.9	Very low	100 Å²	100	109.7 Å²	109.7	54%	0.535	59%	0.589	S	S	.	*	H	α-helix	trans	-65.7	-41	176.6	-90.2	-14.9	0	0	0	112.3	D50 L56 Q57 A58	D50-D54 PolarHBondContact O-N 3.29Å; D54-L56 VanDerWaalsContact C-N 3.34Å; D54-L56 PolarHBondContact O-N 3.47Å; D54-Q57 PolarHBondContact O-N 3.25Å; D54-A58 WeakPolarHBondContact O-CB 3.28Å; D54-A58 PolarHBondContact O-N 3.42Å
55	A	54.1	Low	50.3	Low	67 Å²	67	104.5 Å²	104.5	55%	0.554	57%	0.569	S	S	*	*	H	α-helix	trans	-64.5	-37.1	174.4	0	0	0	0	0	112.5	D51 G59	D51-A55 WeakPolarHBondContact O-CB 3.37Å; D51-A55 PolarHBondContact O-N 2.78Å; A55-G59 PolarHBondContact O-N 3.17Å; A55-G59 VanDerWaalsContact O-N 3.13Å
56	L	51.9	Low	50.5	Low	136 Å²	136	99.3 Å²	99.3	71%	0.712	55%	0.553	S	S	*	*	H	α-helix	trans	-72.4	-37.1	177.3	-151.1	85.2	0	0	0	111.7	R52 A53 D54 G59 A60	R52-L56 VanDerWaalsContact O-CB 3.29Å; R52-L56 WeakPolarHBondContact O-CB 3.31Å; R52-L56 PolarHBondContact O-N 2.88Å; A53-L56 PolarHBondContact O-N 3.15Å; D54-L56 VanDerWaalsContact C-N 3.34Å; D54-L56 PolarHBondContact O-N 3.47Å; L56-G59 PolarHBondContact O-N 2.67Å; L56-A60 VanDerWaalsContact O-CB 3.24Å; L56-A60 WeakPolarHBondContact O-CB 3.33Å; L56-A60 PolarHBondContact O-N 3.5Å
57	Q	51.7	Low	51.1	Low	140 Å²	140	96.7 Å²	96.7	65%	0.654	55%	0.547	S	S	*	.	H	α-helix	trans	-67.7	-41	177.5	-178.3	164.7	-15.3	0	0	111.9	A53 D54 A60 S61	A53-Q57 WeakPolarHBondContact O-CB 3.38Å; A53-Q57 PolarHBondContact O-N 2.92Å; D54-Q57 PolarHBondContact O-N 3.25Å; Q57-A60 PolarHBondContact O-N 2.97Å; Q57-S61 WeakPolarHBondContact O-CB 3.24Å; Q57-S61 PolarHBondContact O-N 2.82Å
58	A	55.3	Low	51.6	Low	61 Å²	61	95.5 Å²	95.5	50%	0.504	54%	0.543	S	S	.	.	H	α-helix	trans	-64.2	-41	173.3	0	0	0	0	0	112.1	D54 Q62	D54-A58 WeakPolarHBondContact O-CB 3.28Å; D54-A58 PolarHBondContact O-N 3.42Å; A58-Q62 WeakPolarHBondContact O-CG 3.29Å; A58-Q62 PolarHBondContact O-N 2.97Å; A58-Q62 VanDerWaalsContact O-N 3.17Å
59	G	57.6	Low	52	Low	43 Å²	43	97 Å²	97	44%	0.443	55%	0.548	S	S	.	.	H	α-helix	trans	-66.8	-41.5	175.1	0	0	0	0	0	113.7	A55 L56 Q62 F63	A55-G59 PolarHBondContact O-N 3.17Å; A55-G59 VanDerWaalsContact O-N 3.13Å; L56-G59 PolarHBondContact O-N 2.67Å; G59-Q62 PolarHBondContact O-N 3.13Å; G59-F63 WeakPolarHBondContact O-CB 3.4Å; G59-F63 PolarHBondContact O-N 2.97Å
60	A	53	Low	52.4	Low	59 Å²	59	96.1 Å²	96.1	49%	0.488	54%	0.543	S	S	.	.	H	α-helix	trans	-67.4	-40.8	177.8	0	0	0	0	0	112.2	L56 Q57 F63 E64	L56-A60 VanDerWaalsContact O-CB 3.24Å; L56-A60 WeakPolarHBondContact O-CB 3.33Å; L56-A60 PolarHBondContact O-N 3.5Å; Q57-A60 PolarHBondContact O-N 2.97Å; A60-F63 PolarHBondContact O-N 3.47Å; A60-E64 WeakPolarHBondContact O-CB 3.38Å; A60-E64 PolarHBondContact O-N 3.43Å
61	S	51.3	Low	53.1	Low	63 Å²	63	99 Å²	99	44%	0.441	55%	0.55	S	S	.	*	H	α-helix	trans	-63.1	-40.2	174.3	176.9	0	0	0	0	112.2	Q57 F63 T65	Q57-S61 WeakPolarHBondContact O-CB 3.24Å; Q57-S61 PolarHBondContact O-N 2.82Å; S61-F63 VanDerWaalsContact C-N 3.35Å; S61-F63 PolarHBondContact O-N 3.39Å; S61-T65 WeakPolarHBondContact O-CB 3.15Å; S61-T65 PolarHBondContact O-N 3.05Å; S61-T65 PolarHBondContact O-OG1 3.22Å
62	Q	50.6	Low	53.5	Low	138 Å²	138	101.7 Å²	101.7	65%	0.645	55%	0.552	S	S	*	*	H	α-helix	trans	-67.3	-33.2	173.2	-77	-104.9	75.9	0	0	113	A58 G59 S66	A58-Q62 WeakPolarHBondContact O-CG 3.29Å; A58-Q62 PolarHBondContact O-N 2.97Å; A58-Q62 VanDerWaalsContact O-N 3.17Å; G59-Q62 PolarHBondContact O-N 3.13Å; Q62-S66 VanDerWaalsContact O-CB 3.31Å; Q62-S66 WeakPolarHBondContact O-CB 3.45Å; Q62-S66 PolarHBondContact O-N 2.89Å; Q62-S66 PolarHBondContact O-OG 3.39Å
63	F	55.1	Low	54.1	Low	161 Å²	161	101 Å²	101	71%	0.706	55%	0.553	S	S	*	*	H	α-helix	trans	-74.1	-41.2	176	-154.9	-93.3	0	0	0	112.2	G59 A60 S61 S66 A67	G59-F63 WeakPolarHBondContact O-CB 3.4Å; G59-F63 PolarHBondContact O-N 2.97Å; A60-F63 PolarHBondContact O-N 3.47Å; S61-F63 VanDerWaalsContact C-N 3.35Å; S61-F63 PolarHBondContact O-N 3.39Å; F63-S66 PolarHBondContact O-N 3.05Å; F63-A67 WeakPolarHBondContact O-CB 3.24Å; F63-A67 PolarHBondContact O-N 2.86Å
64	E	48.6	Very low	54.9	Low	140 Å²	140	105.7 Å²	105.7	65%	0.654	56%	0.561	S	S	*	*	H	α-helix	trans	-59.4	-47.6	172.8	-175.5	-175.5	-178.8	0	0	110.8	A60 S66 A67 A68	A60-E64 WeakPolarHBondContact O-CB 3.38Å; A60-E64 PolarHBondContact O-N 3.43Å; E64-S66 VanDerWaalsContact C-N 3.29Å; E64-S66 PolarHBondContact O-N 3.41Å; E64-A67 PolarHBondContact O-N 3.37Å; E64-A68 VanDerWaalsContact O-CB 3.24Å; E64-A68 WeakPolarHBondContact O-CB 3.31Å; E64-A68 PolarHBondContact O-N 2.82Å
65	T	50.3	Low	55.9	Low	53 Å²	53	109.4 Å²	109.4	33%	0.325	57%	0.567	S	S	.	*	H	α-helix	trans	-65	-36	179.6	-48.3	0	0	0	0	111.4	S61 K69	S61-T65 WeakPolarHBondContact O-CB 3.15Å; S61-T65 PolarHBondContact O-N 3.05Å; S61-T65 PolarHBondContact O-OG1 3.22Å; T65-K69 HydrophobicContact CG2-CD 4.1Å; T65-K69 VanDerWaalsContact O-CB 3.3Å; T65-K69 WeakPolarHBondContact O-CB 3.3Å; T65-K69 WeakPolarHBondContact O-CD 3.34Å; T65-K69 WeakPolarHBondContact O-CG 3.42Å; T65-K69 PolarHBondContact O-N 2.77Å
66	S	51.6	Low	56.8	Low	58 Å²	58	113.6 Å²	113.6	41%	0.406	57%	0.569	S	S	.	*	H	α-helix	trans	-72.8	-42.5	177.7	-62.3	0	0	0	0	112.4	Q62 F63 E64 K69 L70	Q62-S66 VanDerWaalsContact O-CB 3.31Å; Q62-S66 WeakPolarHBondContact O-CB 3.45Å; Q62-S66 PolarHBondContact O-N 2.89Å; Q62-S66 PolarHBondContact O-OG 3.39Å; F63-S66 PolarHBondContact O-N 3.05Å; E64-S66 VanDerWaalsContact C-N 3.29Å; E64-S66 PolarHBondContact O-N 3.41Å; S66-K69 PolarHBondContact O-N 3.05Å; S66-L70 WeakPolarHBondContact O-CB 3.39Å; S66-L70 WeakPolarHBondContact O-CD1 3.18Å; S66-L70 WeakPolarHBondContact O-CG 3.38Å; S66-L70 PolarHBondContact O-N 3.13Å
67	A	54.6	Low	58.2	Low	52 Å²	52	113.4 Å²	113.4	43%	0.43	56%	0.562	S	S	.	*	H	α-helix	trans	-65.7	-40	175.9	0	0	0	0	0	112.1	F63 E64 L70 K71	F63-A67 WeakPolarHBondContact O-CB 3.24Å; F63-A67 PolarHBondContact O-N 2.86Å; E64-A67 PolarHBondContact O-N 3.37Å; A67-L70 PolarHBondContact O-N 3.42Å; A67-K71 WeakPolarHBondContact O-CB 3.45Å; A67-K71 PolarHBondContact O-N 3.3Å
68	A	55.9	Low	59.5	Low	58 Å²	58	111.5 Å²	111.5	48%	0.479	56%	0.557	S	S	.	*	H	α-helix	trans	-67.5	-40.7	176.4	0	0	0	0	0	112.3	E64 K71 R72	E64-A68 VanDerWaalsContact O-CB 3.24Å; E64-A68 WeakPolarHBondContact O-CB 3.31Å; E64-A68 PolarHBondContact O-N 2.82Å; A68-K71 PolarHBondContact O-N 3.29Å; A68-R72 PolarHBondContact O-N 3.2Å
69	K	54.5	Low	60.9	Low	147 Å²	147	112.1 Å²	112.1	64%	0.639	56%	0.556	S	S	*	*	H	α-helix	trans	-64.9	-38.3	175.1	-76.9	170.2	-179.5	166.4	0	111.9	T65 S66 K73	T65-K69 HydrophobicContact CG2-CD 4.1Å; T65-K69 VanDerWaalsContact O-CB 3.3Å; T65-K69 WeakPolarHBondContact O-CB 3.3Å; T65-K69 WeakPolarHBondContact O-CD 3.34Å; T65-K69 WeakPolarHBondContact O-CG 3.42Å; T65-K69 PolarHBondContact O-N 2.77Å; S66-K69 PolarHBondContact O-N 3.05Å; K69-K73 PolarHBondContact O-N 3.42Å
70	L	55.3	Low	62.3	Low	102 Å²	102	117.3 Å²	117.3	53%	0.534	57%	0.567	S	S	.	*	H	α-helix	trans	-66.9	-44.9	175.6	-70.7	164.1	0	0	0	111.4	S66 A67 R72 K73 Y74	S66-L70 WeakPolarHBondContact O-CB 3.39Å; S66-L70 WeakPolarHBondContact O-CD1 3.18Å; S66-L70 WeakPolarHBondContact O-CG 3.38Å; S66-L70 PolarHBondContact O-N 3.13Å; A67-L70 PolarHBondContact O-N 3.42Å; L70-R72 VanDerWaalsContact C-N 3.33Å; L70-R72 PolarHBondContact O-N 3.04Å; L70-K73 PolarHBondContact O-N 2.99Å; L70-Y74 WeakPolarHBondContact O-CD2 3.47Å; L70-Y74 PolarHBondContact O-N 3.22Å
71	K	59.3	Low	64.1	Low	169 Å²	169	120.5 Å²	120.5	74%	0.735	57%	0.573	S	S	*	*	H	α-helix	trans	-58.7	-42.3	180	-161.5	179.1	-175.4	-177	0	112.2	A67 A68 W75	A67-K71 WeakPolarHBondContact O-CB 3.45Å; A67-K71 PolarHBondContact O-N 3.3Å; A68-K71 PolarHBondContact O-N 3.29Å; K71-W75 WeakPolarHBondContact O-CB 3.33Å; K71-W75 PolarHBondContact O-N 3.33Å
72	R	61.2	Low	66	Low	173 Å²	173	125.4 Å²	125.4	65%	0.653	58%	0.582	S	S	*	*	H	α-helix	trans	-69.5	-37.7	179.7	-161.7	164.6	-178.1	148.2	-1.5	112.5	A68 L70 W75 W76	A68-R72 PolarHBondContact O-N 3.2Å; L70-R72 VanDerWaalsContact C-N 3.33Å; L70-R72 PolarHBondContact O-N 3.04Å; R72-W75 PolarHBondContact O-N 3.19Å; R72-W76 PolarHBondContact O-N 2.97Å; R72-W76 VanDerWaalsContact O-N 3.13Å
73	K	60.9	Low	68.1	Low	148 Å²	148	121.6 Å²	121.6	64%	0.643	58%	0.575	S	S	*	*	H	α-helix	trans	-64.8	-40.8	179.3	-162.5	174.6	-175.3	-179.8	0	112.1	K69 L70 K77	K69-K73 PolarHBondContact O-N 3.42Å; L70-K73 PolarHBondContact O-N 2.99Å; K73-K77 WeakPolarHBondContact O-CG 3.45Å; K73-K77 PolarHBondContact O-N 3.45Å
74	Y	69.1	Low	70	Confident	152 Å²	152	118.5 Å²	118.5	60%	0.596	56%	0.564	S	S	*	*	H	α-helix	trans	-75.7	-35.3	176.8	-79.2	-84.5	0	0	0	113.1	L70 W76 K77 N78	L70-Y74 WeakPolarHBondContact O-CD2 3.47Å; L70-Y74 PolarHBondContact O-N 3.22Å; Y74-W76 VanDerWaalsContact C-N 3.34Å; Y74-W76 PolarHBondContact O-N 3.45Å; Y74-K77 PolarHBondContact O-N 2.96Å; Y74-N78 PolarHBondContact O-N 3.25Å
75	W	72.4	Confident	72.2	Confident	177 Å²	177	116.1 Å²	116.1	67%	0.67	56%	0.555	S	S	*	*	H	α-helix	trans	-60.9	-42.9	176.3	-168	78	0	0	0	112.1	K71 R72 N78 C79	K71-W75 WeakPolarHBondContact O-CB 3.33Å; K71-W75 PolarHBondContact O-N 3.33Å; R72-W75 PolarHBondContact O-N 3.19Å; W75-N78 PolarHBondContact O-N 2.96Å; W75-C79 WeakPolarHBondContact O-CB 3.33Å; W75-C79 PolarHBondContact O-N 3.39Å
76	W	72.8	Confident	74.3	Confident	155 Å²	155	118.4 Å²	118.4	59%	0.587	57%	0.565	S	S	*	*	H	α-helix	trans	-67.6	-39.4	176.9	-79.1	54.3	0	0	0	112.6	R72 Y74 C79 K80	R72-W76 PolarHBondContact O-N 2.97Å; R72-W76 VanDerWaalsContact O-N 3.13Å; Y74-W76 VanDerWaalsContact C-N 3.34Å; Y74-W76 PolarHBondContact O-N 3.45Å; W76-C79 PolarHBondContact O-N 2.94Å; W76-K80 WeakPolarHBondContact O-CB 3.37Å; W76-K80 PolarHBondContact O-N 3.29Å
77	K	80.4	Confident	76.5	Confident	132 Å²	132	118.1 Å²	118.1	57%	0.574	57%	0.566	S	S	*	*	H	α-helix	trans	-62.8	-45.7	175.3	-73.3	-177.7	110.3	-172.6	0	111.4	K73 Y74 K80 M81	K73-K77 WeakPolarHBondContact O-CG 3.45Å; K73-K77 PolarHBondContact O-N 3.45Å; Y74-K77 PolarHBondContact O-N 2.96Å; K77-K80 PolarHBondContact O-N 3.3Å; K77-M81 VanDerWaalsContact O-CG 3.28Å; K77-M81 WeakPolarHBondContact O-CG 3.29Å; K77-M81 PolarHBondContact O-N 3.49Å
78	N	80.8	Confident	78.5	Confident	100 Å²	100	119.2 Å²	119.2	54%	0.535	57%	0.567	S	S	.	*	H	α-helix	trans	-60.9	-50.7	175.7	-93.7	15	0	0	0	110.9	Y74 W75 K80 M81 W82	Y74-N78 PolarHBondContact O-N 3.25Å; W75-N78 PolarHBondContact O-N 2.96Å; N78-K80 VanDerWaalsContact C-N 3.26Å; N78-K80 PolarHBondContact O-N 3.43Å; N78-M81 PolarHBondContact O-N 3.05Å; N78-M81 VanDerWaalsContact O-N 3.09Å; N78-W82 PolarHBondContact O-N 3.29Å
79	C	84.2	Confident	80.5	Confident	74 Å²	74	120.4 Å²	120.4	50%	0.5	56%	0.564	S	S	.	*	H	α-helix	trans	-57.1	-40.7	-179.7	-160.4	0	0	0	0	112.3	W75 W76 A83	W75-C79 WeakPolarHBondContact O-CB 3.33Å; W75-C79 PolarHBondContact O-N 3.39Å; W76-C79 PolarHBondContact O-N 2.94Å; C79-A83 WeakPolarHBondContact O-CB 3.49Å; C79-A83 PolarHBondContact O-N 3.49Å
80	K	87.3	Confident	82.6	Confident	152 Å²	152	116.9 Å²	116.9	66%	0.661	56%	0.555	S	S	*	*	H	α-helix	trans	-67.8	-38.8	177.2	-169.6	157.3	179	156.4	0	112.6	W76 K77 N78 A83 I84	W76-K80 WeakPolarHBondContact O-CB 3.37Å; W76-K80 PolarHBondContact O-N 3.29Å; K77-K80 PolarHBondContact O-N 3.3Å; N78-K80 VanDerWaalsContact C-N 3.26Å; N78-K80 PolarHBondContact O-N 3.43Å; K80-A83 PolarHBondContact O-N 3.33Å; K80-I84 HydrophobicContact CG-CD1 4.28Å; K80-I84 WeakPolarHBondContact O-CD1 3.45Å; K80-I84 VanDerWaalsContact O-CG1 3.29Å; K80-I84 WeakPolarHBondContact O-CG1 3.48Å; K80-I84 PolarHBondContact O-N 3.09Å; K80-I84 VanDerWaalsContact O-N 3.14Å
81	M	89.9	Confident	84.6	Confident	127 Å²	127	116.7 Å²	116.7	63%	0.626	55%	0.554	S	S	*	*	H	α-helix	trans	-64.8	-45.1	174.8	-71.9	-63.3	-65.1	0	0	112	K77 N78 A83 I84 L85	K77-M81 VanDerWaalsContact O-CG 3.28Å; K77-M81 WeakPolarHBondContact O-CG 3.29Å; K77-M81 PolarHBondContact O-N 3.49Å; N78-M81 PolarHBondContact O-N 3.05Å; N78-M81 VanDerWaalsContact O-N 3.09Å; M81-A83 PolarHBondContact O-N 3.14Å; M81-I84 PolarHBondContact O-N 2.97Å; M81-L85 WeakPolarHBondContact O-CB 3.34Å; M81-L85 PolarHBondContact O-N 3.01Å
82	W	91.3	Very high	86.4	Confident	165 Å²	165	112.8 Å²	112.8	63%	0.625	54%	0.54	S	S	*	.	H	α-helix	trans	-61.4	-42.1	176.5	-78.2	102.5	0	0	0	112	N78 I84 L85 I86	N78-W82 PolarHBondContact O-N 3.29Å; W82-I84 PolarHBondContact O-N 3.49Å; W82-L85 PolarHBondContact O-N 3.02Å; W82-I86 WeakPolarHBondContact O-CG1 3.28Å; W82-I86 PolarHBondContact O-N 3.47Å
83	A	93.8	Very high	88.1	Confident	59 Å²	59	108.6 Å²	108.6	49%	0.488	53%	0.529	S	S	.	.	H	α-helix	trans	-61.7	-42.9	176.8	0	0	0	0	0	112.7	C79 K80 M81 I86 A87	C79-A83 WeakPolarHBondContact O-CB 3.49Å; C79-A83 PolarHBondContact O-N 3.49Å; K80-A83 PolarHBondContact O-N 3.33Å; M81-A83 PolarHBondContact O-N 3.14Å; A83-I86 PolarHBondContact O-N 2.93Å; A83-A87 PolarHBondContact O-N 3.01Å
84	I	95	Very high	89.8	Confident	95 Å²	95	105.6 Å²	105.6	49%	0.487	52%	0.52	S	S	.	.	H	α-helix	trans	-64.6	-42.4	176.6	-66.3	164.2	0	0	0	110.6	K80 M81 W82 I86 A87 V88	K80-I84 HydrophobicContact CG-CD1 4.28Å; K80-I84 WeakPolarHBondContact O-CD1 3.45Å; K80-I84 VanDerWaalsContact O-CG1 3.29Å; K80-I84 WeakPolarHBondContact O-CG1 3.48Å; K80-I84 PolarHBondContact O-N 3.09Å; K80-I84 VanDerWaalsContact O-N 3.14Å; M81-I84 PolarHBondContact O-N 2.97Å; W82-I84 PolarHBondContact O-N 3.49Å; I84-I86 PolarHBondContact O-N 3.08Å; I84-A87 PolarHBondContact O-N 3.45Å; I84-V88 HydrophobicContact CG2-CG2 4.49Å; I84-V88 WeakPolarHBondContact O-CG2 3.32Å; I84-V88 PolarHBondContact O-N 3.45Å
85	L	94.9	Very high	91.2	Very high	90 Å²	90	103.4 Å²	103.4	47%	0.471	52%	0.517	S	S	.	.	H	α-helix	trans	-60.4	-47.2	179.2	-156.5	174.1	0	0	0	110.9	M81 W82 A87 V88 I89	M81-L85 WeakPolarHBondContact O-CB 3.34Å; M81-L85 PolarHBondContact O-N 3.01Å; W82-L85 PolarHBondContact O-N 3.02Å; L85-A87 VanDerWaalsContact C-N 3.35Å; L85-A87 PolarHBondContact O-N 3.26Å; L85-V88 PolarHBondContact O-N 3.41Å; L85-I89 HydrophobicContact CD2-CD1 3.29Å; L85-I89 HydrophobicContact CD2-CG1 3.89Å; L85-I89 WeakPolarHBondContact O-CG1 3.3Å; L85-I89 PolarHBondContact O-N 3.29Å
86	I	96	Very high	92.3	Very high	102 Å²	102	99.8 Å²	99.8	52%	0.523	51%	0.51	S	S	.	.	H	α-helix	trans	-60.5	-44.5	176.7	-66.7	165.7	0	0	0	110.9	W82 A83 I84 V88 I89 V90	W82-I86 WeakPolarHBondContact O-CG1 3.28Å; W82-I86 PolarHBondContact O-N 3.47Å; A83-I86 PolarHBondContact O-N 2.93Å; I84-I86 PolarHBondContact O-N 3.08Å; I86-V88 VanDerWaalsContact C-N 3.34Å; I86-V88 PolarHBondContact O-N 3.37Å; I86-I89 PolarHBondContact O-N 2.98Å; I86-V90 HydrophobicContact CG2-CG2 4.4Å; I86-V90 WeakPolarHBondContact O-CG2 3.42Å; I86-V90 PolarHBondContact O-N 3.24Å
87	A	96.7	Very high	93.5	Very high	51 Å²	51	97.3 Å²	97.3	42%	0.421	51%	0.507	S	S	.	.	H	α-helix	trans	-59.9	-43	178.6	0	0	0	0	0	112.3	A83 I84 L85 V90 I91	A83-A87 PolarHBondContact O-N 3.01Å; I84-A87 PolarHBondContact O-N 3.45Å; L85-A87 VanDerWaalsContact C-N 3.35Å; L85-A87 PolarHBondContact O-N 3.26Å; A87-V90 PolarHBondContact O-N 3.41Å; A87-I91 VanDerWaalsContact O-CG1 3.32Å; A87-I91 WeakPolarHBondContact O-CG1 3.36Å; A87-I91 PolarHBondContact O-N 3.04Å; A87-I91 VanDerWaalsContact O-N 3.08Å
88	V	97.4	Very high	94.3	Very high	76 Å²	76	96 Å²	96	46%	0.461	51%	0.505	S	S	.	.	H	α-helix	trans	-63.4	-43.4	176.5	172.8	0	0	0	0	111.3	I84 L85 I86 V90 I91 I92	I84-V88 HydrophobicContact CG2-CG2 4.49Å; I84-V88 WeakPolarHBondContact O-CG2 3.32Å; I84-V88 PolarHBondContact O-N 3.45Å; L85-V88 PolarHBondContact O-N 3.41Å; I86-V88 VanDerWaalsContact C-N 3.34Å; I86-V88 PolarHBondContact O-N 3.37Å; V88-V90 VanDerWaalsContact C-N 3.35Å; V88-V90 PolarHBondContact O-N 3.48Å; V88-I91 PolarHBondContact O-N 3.29Å; V88-I92 HydrophobicContact CG1-CD1 3.89Å; V88-I92 WeakPolarHBondContact O-CG1 3.32Å; V88-I92 PolarHBondContact O-N 2.95Å
89	I	97.5	Very high	95	Very high	82 Å²	82	101.3 Å²	101.3	42%	0.421	52%	0.518	S	S	.	.	H	α-helix	trans	-59.5	-46.4	176.8	-70.2	171.3	0	0	0	110.8	L85 I86 I91 I92 I93	L85-I89 HydrophobicContact CD2-CD1 3.29Å; L85-I89 HydrophobicContact CD2-CG1 3.89Å; L85-I89 WeakPolarHBondContact O-CG1 3.3Å; L85-I89 PolarHBondContact O-N 3.29Å; I86-I89 PolarHBondContact O-N 2.98Å; I89-I91 VanDerWaalsContact C-N 3.32Å; I89-I91 PolarHBondContact O-N 3.01Å; I89-I92 PolarHBondContact O-N 3.28Å; I89-I93 HydrophobicContact CG2-CD1 3.74Å; I89-I93 HydrophobicContact CG2-CG1 4.35Å; I89-I93 WeakPolarHBondContact O-CG1 3.34Å; I89-I93 PolarHBondContact O-N 3.25Å
90	V	97.6	Very high	95.5	Very high	74 Å²	74	101.5 Å²	101.5	45%	0.448	53%	0.525	S	S	.	.	H	α-helix	trans	-60.2	-42.7	179.3	171.6	0	0	0	0	111.2	I86 A87 V88 I92 I93 I94	I86-V90 HydrophobicContact CG2-CG2 4.4Å; I86-V90 WeakPolarHBondContact O-CG2 3.42Å; I86-V90 PolarHBondContact O-N 3.24Å; A87-V90 PolarHBondContact O-N 3.41Å; V88-V90 VanDerWaalsContact C-N 3.35Å; V88-V90 PolarHBondContact O-N 3.48Å; V90-I92 PolarHBondContact O-N 3.45Å; V90-I93 PolarHBondContact O-N 3Å; V90-I94 HydrophobicContact CG1-CD1 3.9Å; V90-I94 VanDerWaalsContact O-CG1 3.3Å; V90-I94 WeakPolarHBondContact O-CG1 3.37Å; V90-I94 PolarHBondContact O-N 3.26Å
91	I	97.6	Very high	95.6	Very high	98 Å²	98	99.7 Å²	99.7	50%	0.503	53%	0.53	S	S	.	.	H	α-helix	trans	-61.5	-45.1	176.8	-67.9	166.2	0	0	0	111	A87 V88 I89 I93 I94 I95	A87-I91 VanDerWaalsContact O-CG1 3.32Å; A87-I91 WeakPolarHBondContact O-CG1 3.36Å; A87-I91 PolarHBondContact O-N 3.04Å; A87-I91 VanDerWaalsContact O-N 3.08Å; V88-I91 PolarHBondContact O-N 3.29Å; I89-I91 VanDerWaalsContact C-N 3.32Å; I89-I91 PolarHBondContact O-N 3.01Å; I91-I93 VanDerWaalsContact C-N 3.33Å; I91-I93 PolarHBondContact O-N 3.44Å; I91-I94 PolarHBondContact O-N 2.95Å; I91-I95 HydrophobicContact CG2-CD1 3.96Å; I91-I95 WeakPolarHBondContact O-CG1 3.39Å; I91-I95 PolarHBondContact O-N 3.49Å
92	I	97.5	Very high	95.4	Very high	87 Å²	87	100.8 Å²	100.8	45%	0.446	55%	0.55	S	S	.	*	H	α-helix	trans	-61.1	-44.2	178.1	-67.6	166.9	0	0	0	110.6	V88 I89 V90 I94 I95 I96	V88-I92 HydrophobicContact CG1-CD1 3.89Å; V88-I92 WeakPolarHBondContact O-CG1 3.32Å; V88-I92 PolarHBondContact O-N 2.95Å; I89-I92 PolarHBondContact O-N 3.28Å; V90-I92 PolarHBondContact O-N 3.45Å; I92-I94 VanDerWaalsContact C-N 3.32Å; I92-I94 PolarHBondContact O-N 3.46Å; I92-I95 PolarHBondContact O-N 3.02Å; I92-I96 HydrophobicContact CG2-CD1 3.87Å; I92-I96 HydrophobicContact CG2-CG1 4.48Å; I92-I96 WeakPolarHBondContact O-CG1 3.32Å; I92-I96 PolarHBondContact O-N 3.46Å
93	I	97.2	Very high	95.6	Very high	84 Å²	84	97.6 Å²	97.6	43%	0.431	55%	0.546	S	S	.	.	H	α-helix	trans	-59.9	-44.2	177.1	-68	169	0	0	0	110.7	I89 V90 I91 I95 I96 I97	I89-I93 HydrophobicContact CG2-CD1 3.74Å; I89-I93 HydrophobicContact CG2-CG1 4.35Å; I89-I93 WeakPolarHBondContact O-CG1 3.34Å; I89-I93 PolarHBondContact O-N 3.25Å; V90-I93 PolarHBondContact O-N 3Å; I91-I93 VanDerWaalsContact C-N 3.33Å; I91-I93 PolarHBondContact O-N 3.44Å; I93-I95 VanDerWaalsContact C-N 3.35Å; I93-I95 PolarHBondContact O-N 3.22Å; I93-I96 PolarHBondContact O-N 3.24Å; I93-I97 HydrophobicContact CG2-CD1 3.8Å; I93-I97 HydrophobicContact CG2-CG1 4.41Å; I93-I97 WeakPolarHBondContact O-CG1 3.35Å; I93-I97 PolarHBondContact O-N 2.98Å
94	I	96.8	Very high	95.6	Very high	86 Å²	86	99.6 Å²	99.6	44%	0.441	55%	0.549	S	S	.	.	H	α-helix	trans	-60.6	-44.6	177.7	-69.3	165.5	0	0	0	110.9	V90 I91 I92 I96 I97 I98	V90-I94 HydrophobicContact CG1-CD1 3.9Å; V90-I94 VanDerWaalsContact O-CG1 3.3Å; V90-I94 WeakPolarHBondContact O-CG1 3.37Å; V90-I94 PolarHBondContact O-N 3.26Å; I91-I94 PolarHBondContact O-N 2.95Å; I92-I94 VanDerWaalsContact C-N 3.32Å; I92-I94 PolarHBondContact O-N 3.46Å; I94-I96 VanDerWaalsContact C-N 3.33Å; I94-I96 PolarHBondContact O-N 3.31Å; I94-I97 PolarHBondContact O-N 2.95Å; I94-I98 HydrophobicContact CG2-CD1 3.74Å; I94-I98 HydrophobicContact CG2-CG1 4.41Å; I94-I98 VanDerWaalsContact O-CG1 3.32Å; I94-I98 WeakPolarHBondContact O-CG1 3.14Å; I94-I98 PolarHBondContact O-N 2.99Å
95	I	97.1	Very high	95.7	Very high	105 Å²	105	99.8 Å²	99.8	54%	0.538	55%	0.553	S	S	.	*	H	α-helix	trans	-60.6	-44.3	177.6	-67.8	167	0	0	0	110.7	I91 I92 I93 I97 I98 W99	I91-I95 HydrophobicContact CG2-CD1 3.96Å; I91-I95 WeakPolarHBondContact O-CG1 3.39Å; I91-I95 PolarHBondContact O-N 3.49Å; I92-I95 PolarHBondContact O-N 3.02Å; I93-I95 VanDerWaalsContact C-N 3.35Å; I93-I95 PolarHBondContact O-N 3.22Å; I95-I97 PolarHBondContact O-N 2.91Å; I95-I98 PolarHBondContact O-N 3.03Å; I95-W99 WeakPolarHBondContact O-CB 3.33Å; I95-W99 PolarHBondContact O-N 3.37Å
96	I	97.1	Very high	95.7	Very high	101 Å²	101	100.4 Å²	100.4	52%	0.518	56%	0.558	S	S	.	*	H	α-helix	trans	-62.3	-43.5	178.3	-68.3	168.5	0	0	0	110.8	I92 I93 I94 W99 A100	I92-I96 HydrophobicContact CG2-CD1 3.87Å; I92-I96 HydrophobicContact CG2-CG1 4.48Å; I92-I96 WeakPolarHBondContact O-CG1 3.32Å; I92-I96 PolarHBondContact O-N 3.46Å; I93-I96 PolarHBondContact O-N 3.24Å; I94-I96 VanDerWaalsContact C-N 3.33Å; I94-I96 PolarHBondContact O-N 3.31Å; I96-W99 PolarHBondContact O-N 2.91Å; I96-A100 VanDerWaalsContact O-CB 3.25Å; I96-A100 WeakPolarHBondContact O-CB 3.25Å; I96-A100 PolarHBondContact O-N 3.35Å
97	I	97.1	Very high	95.7	Very high	103 Å²	103	100.3 Å²	100.3	53%	0.528	56%	0.56	S	S	.	*	H	α-helix	trans	-62.8	-45.8	178.2	-69.2	168.8	0	0	0	110.8	I93 I94 I95 W99 A100 C101	I93-I97 HydrophobicContact CG2-CD1 3.8Å; I93-I97 HydrophobicContact CG2-CG1 4.41Å; I93-I97 WeakPolarHBondContact O-CG1 3.35Å; I93-I97 PolarHBondContact O-N 2.98Å; I94-I97 PolarHBondContact O-N 2.95Å; I95-I97 PolarHBondContact O-N 2.91Å; I97-W99 VanDerWaalsContact C-N 3.34Å; I97-W99 PolarHBondContact O-N 3.37Å; I97-A100 PolarHBondContact O-N 3.48Å; I97-C101 WeakPolarHBondContact O-CB 3.37Å; I97-C101 PolarHBondContact O-N 3.36Å
98	I	96.8	Very high	95.6	Very high	106 Å²	106	103.6 Å²	103.6	54%	0.544	57%	0.569	S	S	.	*	H	α-helix	trans	-62	-44.5	178.2	-67.4	167.2	0	0	0	110.3	I94 I95 C101 S102	I94-I98 HydrophobicContact CG2-CD1 3.74Å; I94-I98 HydrophobicContact CG2-CG1 4.41Å; I94-I98 VanDerWaalsContact O-CG1 3.32Å; I94-I98 WeakPolarHBondContact O-CG1 3.14Å; I94-I98 PolarHBondContact O-N 2.99Å; I95-I98 PolarHBondContact O-N 3.03Å; I98-C101 PolarHBondContact O-N 3.49Å; I98-S102 VanDerWaalsContact O-CB 3.25Å; I98-S102 WeakPolarHBondContact O-CB 3.25Å; I98-S102 PolarHBondContact O-N 2.85Å
99	W	96.8	Very high	95.5	Very high	211 Å²	211	105.6 Å²	105.6	80%	0.799	58%	0.577	S	S	*	*	H	α-helix	trans	-67.3	-36	179.5	-169.1	72.6	0	0	0	112.9	I95 I96 I97	I95-W99 WeakPolarHBondContact O-CB 3.33Å; I95-W99 PolarHBondContact O-N 3.37Å; I96-W99 PolarHBondContact O-N 2.91Å; I97-W99 VanDerWaalsContact C-N 3.34Å; I97-W99 PolarHBondContact O-N 3.37Å
100	A	94.6	Very high	95.4	Very high	78 Å²	78	107.4 Å²	107.4	65%	0.645	59%	0.589	S	S	*	*	H	α-helix	trans	-76.1	-24.9	176.7	0	0	0	0	0	113.3	I96 I97	I96-A100 VanDerWaalsContact O-CB 3.25Å; I96-A100 WeakPolarHBondContact O-CB 3.25Å; I96-A100 PolarHBondContact O-N 3.35Å; I97-A100 PolarHBondContact O-N 3.48Å
101	C	88.6	Confident	95.2	Very high	113 Å²	113	110.2 Å²	110.2	76%	0.764	60%	0.6	S	S	*	*	H	α-helix	trans	-92.3	-12.5	-179.8	-165.7	0	0	0	0	113.2	I97 I98	I97-C101 WeakPolarHBondContact O-CB 3.37Å; I97-C101 PolarHBondContact O-N 3.36Å; I98-C101 PolarHBondContact O-N 3.49Å
102	S	84.9	Confident	95	Very high	150 Å²	150	111.3 Å²	111.3	100%	1.049	61%	0.609	S	S	*	*			trans	-97.3	0	178.6	-166.5	0	0	0	0	112.2	I98	I98-S102 VanDerWaalsContact O-CB 3.25Å; I98-S102 WeakPolarHBondContact O-CB 3.25Å; I98-S102 PolarHBondContact O-N 2.85Å

Retrieved 102 of 102 residues in 45.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).