A0A096MFL1_POEFO Loading...

Alpha-carbonic anhydrase domain-containing protein

AlphaFold DB , UniProt , Accession A0A096MFL1, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 138 aa.

						>A0A096MFL1_POEFO|A0A096MFL1
MRILSFIASALLLLTSLSFLHGAEWTYSGSTGQDYWSNKYPYCGGSFQSPIHITSDLLRFSPTLRPIEVRNYKLSSTEQLTLRNDGHSLKLSLPPTMYVAGLPNQFTAAQLHFHWGSSNWPTGSEHLVDSKQFAAEVN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35	Very low	42.2	Very low	224 Å²	224	143.5 Å²	143.5	100%	1.103	78%	0.783	S	S	*	*				0	110.4	0	-164	167	75	0	0	107.3
2	R	36.2	Very low	42.7	Very low	224 Å²	224	143.9 Å²	143.9	85%	0.845	78%	0.782	S	S	*	*			trans	70.5	142.6	171.9	-54.3	179.9	176.6	-153.8	-1.9	116.1
3	I	41.8	Very low	43.2	Very low	131 Å²	131	143.1 Å²	143.1	67%	0.672	78%	0.776	S	S	*	*			cis	-172.8	136.8	-13.9	-107.6	156.7	0	0	0	103.9
4	L	37.8	Very low	43.7	Very low	134 Å²	134	142.8 Å²	142.8	70%	0.702	77%	0.772	S	S	*	*			trans	35.5	136.7	148.1	-54.8	155.1	0	0	0	119.2	F6	L4-F6 HydrophobicContact CD2-CE2 3.87Å
5	S	44	Very low	44.3	Very low	102 Å²	102	140.3 Å²	140.3	71%	0.713	76%	0.764	S	S	*	*				-175.5	139	59	34.8	0	0	0	0	113.5
6	F	41.2	Very low	44.7	Very low	174 Å²	174	137.6 Å²	137.6	76%	0.763	76%	0.759	S	S	*	*			trans	31.1	129.3	135.1	-60.3	-87.6	0	0	0	118.5	L4	L4-F6 HydrophobicContact CD2-CE2 3.87Å
7	I	43.7	Very low	44.9	Very low	148 Å²	148	137.6 Å²	137.6	76%	0.759	76%	0.757	S	S	*	*				-148.6	106.5	71.3	-42.3	-174.2	0	0	0	110.6	S9	I7-S9 PolarHBondContact O-N 2.95Å; I7-S9 VanDerWaalsContact O-N 3.11Å
8	A	41.4	Very low	45	Very low	95 Å²	95	135.6 Å²	135.6	79%	0.785	75%	0.754	S	S	*	*			trans	-75.9	94.1	164.3	0	0	0	0	0	108.2	A10	A8-A10 PolarHBondContact O-N 3.28Å
9	S	47.6	Very low	45	Very low	114 Å²	114	136.3 Å²	136.3	80%	0.797	75%	0.748	S	S	*	*			trans	-77.4	68	167.3	-61.6	0	0	0	0	108.9	I7 L11	I7-S9 PolarHBondContact O-N 2.95Å; I7-S9 VanDerWaalsContact O-N 3.11Å; S9-L11 PolarHBondContact O-N 3.17Å
10	A	47.9	Very low	44.9	Very low	84 Å²	84	138.4 Å²	138.4	69%	0.694	76%	0.758	S	S	*	*			trans	-90.2	94.8	166.1	0	0	0	0	0	107	A8 L12	A8-A10 PolarHBondContact O-N 3.28Å; A10-L12 PolarHBondContact O-N 3.34Å; A10-L12 VanDerWaalsContact O-N 3.1Å
11	L	47.8	Very low	45	Very low	148 Å²	148	139.1 Å²	139.1	78%	0.775	76%	0.756	S	S	*	*			trans	-38.3	109.2	175.4	-160.6	70.7	0	0	0	111.2	S9 L13	S9-L11 PolarHBondContact O-N 3.17Å; L11-L13 VanDerWaalsContact C-N 3.26Å; L11-L13 HydrophobicContact CD2-CD1 3.75Å; L11-L13 HydrophobicContact CG-CD1 4.18Å; L11-L13 PolarHBondContact O-N 3.3Å
12	L	47.7	Very low	45.9	Very low	149 Å²	149	131.3 Å²	131.3	78%	0.78	73%	0.732	S	S	*	*			trans	-67.7	85.2	172.3	-139.8	82.8	0	0	0	107.4	A10 L14	A10-L12 PolarHBondContact O-N 3.34Å; A10-L12 VanDerWaalsContact O-N 3.1Å; L12-L14 HydrophobicContact CB-CD1 4.44Å; L12-L14 HydrophobicContact CD2-CD1 3.33Å; L12-L14 HydrophobicContact CG-CD1 3.66Å; L12-L14 PolarHBondContact O-N 2.69Å
13	L	49.2	Very low	46.9	Very low	133 Å²	133	122.7 Å²	122.7	70%	0.696	71%	0.709	S	S	*	*			trans	-74.7	73.5	168.2	-126.6	89.6	0	0	0	107.7	L11 T15	L11-L13 VanDerWaalsContact C-N 3.26Å; L11-L13 HydrophobicContact CD2-CD1 3.75Å; L11-L13 HydrophobicContact CG-CD1 4.18Å; L11-L13 PolarHBondContact O-N 3.3Å; L13-T15 HydrophobicContact CD2-CG2 4.2Å; L13-T15 PolarHBondContact O-N 3.34Å
14	L	50.4	Low	48.8	Very low	139 Å²	139	123.1 Å²	123.1	73%	0.728	71%	0.708	S	S	*	*			trans	-67	90.8	153.8	-94.5	87.3	0	0	0	105.4	L12 S16	L12-L14 HydrophobicContact CB-CD1 4.44Å; L12-L14 HydrophobicContact CD2-CD1 3.33Å; L12-L14 HydrophobicContact CG-CD1 3.66Å; L12-L14 PolarHBondContact O-N 2.69Å; L14-S16 VanDerWaalsContact C-N 3.26Å; L14-S16 PolarHBondContact O-N 3.23Å
15	T	52.6	Low	51.5	Low	105 Å²	105	120 Å²	120	64%	0.644	69%	0.687	S	S	*	*			trans	-60	103.3	155.7	44.1	0	0	0	0	105.5	L13 L17	L13-T15 HydrophobicContact CD2-CG2 4.2Å; L13-T15 PolarHBondContact O-N 3.34Å; T15-L17 PolarHBondContact O-N 3.24Å
16	S	51.3	Low	53.9	Low	98 Å²	98	117.5 Å²	117.5	69%	0.685	67%	0.667	S	S	*	*			trans	-54.1	98.3	161.7	45.8	0	0	0	0	106.4	L14 S18	L14-S16 VanDerWaalsContact C-N 3.26Å; L14-S16 PolarHBondContact O-N 3.23Å; S16-S18 PolarHBondContact O-N 3.42Å
17	L	47.1	Very low	56.5	Low	138 Å²	138	113.1 Å²	113.1	72%	0.723	65%	0.647	S	S	*	*			trans	-56.6	87.7	154.7	-87.5	146.9	0	0	0	104.6	T15 F19	T15-L17 PolarHBondContact O-N 3.24Å; L17-F19 HydrophobicContact CB-CE2 4.27Å; L17-F19 WeakPolarHBondContact O-CD2 3.23Å; L17-F19 PolarHBondContact O-N 3.5Å
18	S	47	Very low	58.9	Low	100 Å²	100	110.7 Å²	110.7	70%	0.699	64%	0.642	S	S	*	*			trans	-66.9	86.3	162.9	-60.1	0	0	0	0	103.5	S16 L20	S16-S18 PolarHBondContact O-N 3.42Å; S18-L20 PolarHBondContact O-N 3.46Å
19	F	45.7	Very low	61.5	Low	149 Å²	149	108.6 Å²	108.6	65%	0.654	63%	0.63	S	S	*	*			trans	-49.3	117.1	157	-69.3	-82.2	0	0	0	103.9	L17 H21	L17-F19 HydrophobicContact CB-CE2 4.27Å; L17-F19 WeakPolarHBondContact O-CD2 3.23Å; L17-F19 PolarHBondContact O-N 3.5Å; F19-H21 PolarHBondContact O-N 3.02Å; F19-H21 PolarHBondContact O-ND1 3.2Å
20	L	43.2	Very low	63.7	Low	179 Å²	179	108.6 Å²	108.6	94%	0.937	63%	0.63	S	S	*	*			trans	-55	88.4	164.4	-83.2	152.3	0	0	0	105	S18 G22	S18-L20 PolarHBondContact O-N 3.46Å; L20-G22 PolarHBondContact O-N 3.14Å
21	H	47.3	Very low	66	Low	154 Å²	154	107.2 Å²	107.2	71%	0.713	61%	0.613	S	S	*	*			trans	-72.7	76.4	172.6	-79	81.1	0	0	0	105	F19 A23	F19-H21 PolarHBondContact O-N 3.02Å; F19-H21 PolarHBondContact O-ND1 3.2Å; H21-A23 PolarHBondContact O-N 2.99Å
22	G	52.4	Low	68.3	Low	59 Å²	59	100.3 Å²	100.3	61%	0.608	58%	0.577	S	S	*	*			trans	-49.7	128.2	153.8	0	0	0	0	0	105.8	L20 E24	L20-G22 PolarHBondContact O-N 3.14Å; G22-E24 PolarHBondContact O-N 2.83Å
23	A	58.4	Low	70.7	Confident	44 Å²	44	98.3 Å²	98.3	36%	0.364	56%	0.564	S	S	.	*			trans	-30.2	102.5	171.7	0	0	0	0	0	110.9	H21 W25 Y40	H21-A23 PolarHBondContact O-N 2.99Å; A23-W25 PolarHBondContact O-N 3.25Å; A23-Y40 WeakPolarHBondContact CA-OH 3.33Å; A23-Y40 HydrophobicContact CB-CE1 4.02Å; A23-Y40 WeakPolarHBondContact CB-OH 3.16Å
24	E	80.4	Confident	72.9	Confident	140 Å²	140	98.2 Å²	98.2	65%	0.654	56%	0.564	S	S	*	*			trans	-79.2	67.4	-173.8	-162.6	-179	-170.6	0	0	109.2	G22 T31	G22-E24 PolarHBondContact O-N 2.83Å; E24-T31 VanDerWaalsContact O-CB 3.29Å; E24-T31 WeakPolarHBondContact O-CB 3.47Å; E24-T31 WeakPolarHBondContact O-CG2 3.48Å
25	W	94.7	Very high	75.2	Confident	68 Å²	68	97.6 Å²	97.6	26%	0.258	55%	0.553	S	S	.	*			trans	-94.3	148.5	170.7	67.9	-94.7	0	0	0	109.1	A23 Y27 W36 Y40 H87	A23-W25 PolarHBondContact O-N 3.25Å; W25-Y27 HydrophobicContact CH2-CE2 4.2Å; W25-Y27 HydrophobicContact CZ3-CD1 4.44Å; W25-Y27 HydrophobicContact CZ3-CD2 4.2Å; W25-Y27 HydrophobicContact CZ3-CE1 4.17Å; W25-Y27 AromaticContact CZ3-CE2 3.92Å; W25-Y27 HydrophobicContact CZ3-CE2 3.92Å; W25-Y27 HydrophobicContact CZ3-CG 4.45Å; W25-Y27 AromaticContact CZ3-CZ 3.91Å; W25-W36 HydrophobicContact CD2-CZ2 4.17Å; W25-W36 AromaticContact CE3-CE2 3.71Å; W25-W36 HydrophobicContact CE3-CH2 4.01Å; W25-W36 AromaticContact CE3-CZ2 3.23Å; W25-W36 HydrophobicContact CE3-CZ2 3.23Å; W25-W36 AromaticContact CE3-NE1 3.99Å; W25-W36 AromaticContact CZ3-CH2 3.88Å; W25-W36 HydrophobicContact CZ3-CH2 3.88Å; W25-W36 AromaticContact CZ3-CZ2 3.48Å; W25-W36 HydrophobicContact CZ3-CZ2 3.48Å; W25-W36 VanDerWaalsContact CZ3-CZ2 3.48Å; W25-Y40 HydrophobicContact CB-CE2 4.11Å; W25-H87 AromaticContact CD2-CD2 3.97Å; W25-H87 AromaticContact CD2-NE2 3.71Å; W25-H87 AromaticContact CE2-CD2 3.82Å; W25-H87 AromaticContact CE2-CE1 3.92Å; W25-H87 AromaticContact CE2-NE2 3.65Å; W25-H87 AromaticContact CE3-CD2 3.72Å; W25-H87 AromaticContact CE3-NE2 3.84Å; W25-H87 HydrophobicContact CH2-CB 3.68Å; W25-H87 AromaticContact CH2-CD2 3.26Å; W25-H87 WeakPolarHBondContact CH2-CD2 3.29Å; W25-H87 AromaticContact CH2-CG 3.5Å; W25-H87 VanDerWaalsContact CH2-CG 3.5Å; W25-H87 AromaticContact CH2-NE2 3.96Å; W25-H87 HydrophobicContact CZ2-CB 3.98Å; W25-H87 AromaticContact CZ2-CD2 3.49Å; W25-H87 VanDerWaalsContact CZ2-CD2 3.49Å; W25-H87 WeakPolarHBondContact CZ2-CD2 3.5Å; W25-H87 AromaticContact CZ2-CG 3.52Å; W25-H87 AromaticContact CZ2-ND1 3.87Å; W25-H87 AromaticContact CZ2-NE2 3.79Å; W25-H87 HydrophobicContact CZ3-CB 4.48Å; W25-H87 AromaticContact CZ3-CD2 3.37Å; W25-H87 WeakPolarHBondContact CZ3-CD2 3.34Å; W25-H87 AromaticContact CZ3-NE2 3.97Å; W25-H87 PolarHBondContact O-NE2 2.99Å
26	T	96	Very high	77.3	Confident	49 Å²	49	95.4 Å²	95.4	30%	0.301	53%	0.533	S	S	.	.			trans	-130.7	168.6	174.2	58.1	0	0	0	0	109	S28 T31 G32 Q33 W36	T26-S28 VanDerWaalsContact C-N 3.35Å; T26-S28 PolarHBondContact OG1-O 3.2Å; T26-T31 PolarHBondContact N-O 2.82Å; T26-T31 VanDerWaalsContact OG1-C 3.3Å; T26-T31 PolarHBondContact OG1-O 3.41Å; T26-T31 PolarHBondContact OG1-OG1 3.2Å; T26-T31 VanDerWaalsContact OG1-OG1 3.11Å; T26-G32 CarbonylContact O-C 3.58Å; T26-G32 VanDerWaalsContact O-CA 3.27Å; T26-G32 WeakPolarHBondContact O-CA 3.37Å; T26-G32 PolarHBondContact OG1-N 2.67Å; T26-Q33 PolarHBondContact O-N 3.17Å; T26-W36 WeakPolarHBondContact O-CZ2 3.42Å; T26-W36 PolarHBondContact O-NE1 3Å
27	Y	95.2	Very high	79.5	Confident	83 Å²	83	93 Å²	93	33%	0.325	52%	0.517	S	S	.	.	S	Bend	trans	-74	-27.4	171.9	-71.7	-79.1	0	0	0	112.3	W25 Q33 W36 H87 H114	W25-Y27 HydrophobicContact CH2-CE2 4.2Å; W25-Y27 HydrophobicContact CZ3-CD1 4.44Å; W25-Y27 HydrophobicContact CZ3-CD2 4.2Å; W25-Y27 HydrophobicContact CZ3-CE1 4.17Å; W25-Y27 AromaticContact CZ3-CE2 3.92Å; W25-Y27 HydrophobicContact CZ3-CE2 3.92Å; W25-Y27 HydrophobicContact CZ3-CG 4.45Å; W25-Y27 AromaticContact CZ3-CZ 3.91Å; Y27-Q33 PolarHBondContact O-N 2.88Å; Y27-W36 HydrophobicContact CD1-CH2 4.39Å; Y27-W36 HydrophobicContact CD1-CZ2 4.41Å; Y27-W36 HydrophobicContact CE1-CH2 4.39Å; Y27-H87 HydrophobicContact CE2-CB 4.35Å; Y27-H114 PolarHBondContact OH-CE1 3.29Å; Y27-H114 VanDerWaalsContact OH-CE1 3.29Å; Y27-H114 PolarHBondContact OH-ND1 2.86Å
28	S	94.3	Very high	81.8	Confident	96 Å²	96	92.6 Å²	92.6	67%	0.671	52%	0.515	S	S	*	.	S	Bend	trans	-140.6	162	-175.9	63.2	0	0	0	0	113.2	T26	T26-S28 VanDerWaalsContact C-N 3.35Å; T26-S28 PolarHBondContact OG1-O 3.2Å
29	G	95.4	Very high	84.1	Confident	51 Å²	51	94.5 Å²	94.5	53%	0.526	51%	0.511	S	S	.	.	S	Bend	trans	92.5	-159.1	177.4	0	0	0	0	0	112.9	T31 G32 Y35	G29-T31 PolarHBondContact O-N 2.79Å; G29-G32 PolarHBondContact O-N 2.88Å; G29-Y35 WeakPolarHBondContact O-CD2 3.26Å
30	S	94.4	Very high	86.5	Confident	114 Å²	114	90.6 Å²	90.6	80%	0.797	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.7	-18.9	-174.6	51.9	0	0	0	0	114.5
31	T	95.3	Very high	89.1	Confident	56 Å²	56	86.7 Å²	86.7	34%	0.344	48%	0.478	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.8	19.1	172.1	54.5	0	0	0	0	112.2	E24 T26 G29 W36	E24-T31 VanDerWaalsContact O-CB 3.29Å; E24-T31 WeakPolarHBondContact O-CB 3.47Å; E24-T31 WeakPolarHBondContact O-CG2 3.48Å; T26-T31 PolarHBondContact N-O 2.82Å; T26-T31 VanDerWaalsContact OG1-C 3.3Å; T26-T31 PolarHBondContact OG1-O 3.41Å; T26-T31 PolarHBondContact OG1-OG1 3.2Å; T26-T31 VanDerWaalsContact OG1-OG1 3.11Å; G29-T31 PolarHBondContact O-N 2.79Å; T31-W36 PolarHBondContact O-NE1 2.92Å
32	G	96.9	Very high	91.4	Very high	2 Å²	2	89.2 Å²	89.2	2%	0.021	48%	0.482	C	S	.	.	S	Bend	trans	-69.1	169.6	-178.9	0	0	0	0	0	114.3	T26 G29 D34 Y35 W36	T26-G32 CarbonylContact O-C 3.58Å; T26-G32 VanDerWaalsContact O-CA 3.27Å; T26-G32 WeakPolarHBondContact O-CA 3.37Å; T26-G32 PolarHBondContact OG1-N 2.67Å; G29-G32 PolarHBondContact O-N 2.88Å; G32-D34 VanDerWaalsContact C-N 3.25Å; G32-D34 PolarHBondContact O-N 2.81Å; G32-Y35 PolarHBondContact O-N 3.42Å; G32-W36 PolarHBondContact O-N 2.81Å
33	Q	96.8	Very high	93.6	Very high	108 Å²	108	88.8 Å²	88.8	51%	0.505	47%	0.47	S	S	.	.	G	3₁₀ helix	trans	-56.6	-34.9	-174.1	67.5	-178.2	61.5	0	0	114.7	T26 Y27 Y35 W36	T26-Q33 PolarHBondContact O-N 3.17Å; Y27-Q33 PolarHBondContact O-N 2.88Å; Q33-Y35 PolarHBondContact O-N 2.91Å; Q33-W36 VanDerWaalsContact CA-CE2 3.44Å; Q33-W36 HydrophobicContact CB-CD2 4.02Å; Q33-W36 HydrophobicContact CB-CE3 4.22Å; Q33-W36 HydrophobicContact CB-CH2 4Å; Q33-W36 HydrophobicContact CB-CZ2 3.75Å; Q33-W36 HydrophobicContact CB-CZ3 4.22Å; Q33-W36 PolarHBondContact O-N 3Å
34	D	97.4	Very high	95.4	Very high	130 Å²	130	89.3 Å²	89.3	70%	0.695	48%	0.479	S	S	*	.	G	3₁₀ helix	trans	-61.5	-19	177.4	-59.7	-29.6	0	0	0	112.8	G32	G32-D34 VanDerWaalsContact C-N 3.25Å; G32-D34 PolarHBondContact O-N 2.81Å
35	Y	97.1	Very high	96.2	Very high	126 Å²	126	84.5 Å²	84.5	49%	0.494	47%	0.467	S	S	.	.	G	3₁₀ helix	trans	-114.7	1.2	-177.5	-54.3	-72.4	0	0	0	113.6	G29 G32 Q33 S37 N38	G29-Y35 WeakPolarHBondContact O-CD2 3.26Å; G32-Y35 PolarHBondContact O-N 3.42Å; Q33-Y35 PolarHBondContact O-N 2.91Å; Y35-S37 PolarHBondContact O-N 3.33Å; Y35-N38 VanDerWaalsContact O-CB 3.31Å; Y35-N38 WeakPolarHBondContact O-CB 3.21Å; Y35-N38 PolarHBondContact O-N 3.15Å; Y35-N38 VanDerWaalsContact O-N 3.1Å
36	W	97.1	Very high	96.4	Very high	59 Å²	59	86.9 Å²	86.9	22%	0.223	49%	0.494	C	S	.	.	G	3₁₀ helix	trans	-57.9	-37.4	-177.8	-74	-2.5	0	0	0	112.2	W25 T26 Y27 T31 G32 Q33 N38 K39 Y40 C43	W25-W36 HydrophobicContact CD2-CZ2 4.17Å; W25-W36 AromaticContact CE3-CE2 3.71Å; W25-W36 HydrophobicContact CE3-CH2 4.01Å; W25-W36 AromaticContact CE3-CZ2 3.23Å; W25-W36 HydrophobicContact CE3-CZ2 3.23Å; W25-W36 AromaticContact CE3-NE1 3.99Å; W25-W36 AromaticContact CZ3-CH2 3.88Å; W25-W36 HydrophobicContact CZ3-CH2 3.88Å; W25-W36 AromaticContact CZ3-CZ2 3.48Å; W25-W36 HydrophobicContact CZ3-CZ2 3.48Å; W25-W36 VanDerWaalsContact CZ3-CZ2 3.48Å; T26-W36 WeakPolarHBondContact O-CZ2 3.42Å; T26-W36 PolarHBondContact O-NE1 3Å; Y27-W36 HydrophobicContact CD1-CH2 4.39Å; Y27-W36 HydrophobicContact CD1-CZ2 4.41Å; Y27-W36 HydrophobicContact CE1-CH2 4.39Å; T31-W36 PolarHBondContact O-NE1 2.92Å; G32-W36 PolarHBondContact O-N 2.81Å; Q33-W36 VanDerWaalsContact CA-CE2 3.44Å; Q33-W36 HydrophobicContact CB-CD2 4.02Å; Q33-W36 HydrophobicContact CB-CE3 4.22Å; Q33-W36 HydrophobicContact CB-CH2 4Å; Q33-W36 HydrophobicContact CB-CZ2 3.75Å; Q33-W36 HydrophobicContact CB-CZ3 4.22Å; Q33-W36 PolarHBondContact O-N 3Å; W36-N38 PolarHBondContact O-N 3.08Å; W36-N38 VanDerWaalsContact O-N 3.11Å; W36-K39 PolarHBondContact O-N 3.13Å; W36-Y40 HydrophobicContact CB-CD2 4.21Å; W36-Y40 WeakPolarHBondContact O-CA 3.31Å; W36-Y40 WeakPolarHBondContact O-CD2 3.48Å; W36-Y40 PolarHBondContact O-N 2.82Å; W36-C43 HydrophobicContact CB-CB 3.9Å
37	S	97.5	Very high	96.5	Very high	49 Å²	49	94 Å²	94	34%	0.343	52%	0.521	S	S	.	.	G	3₁₀ helix	trans	-58.7	-24.2	179.5	59.9	0	0	0	0	114.1	Y35 K39 Y40	Y35-S37 PolarHBondContact O-N 3.33Å; S37-K39 VanDerWaalsContact C-N 3.27Å; S37-K39 PolarHBondContact O-N 3.47Å; S37-Y40 WeakPolarHBondContact CA-O 3.35Å
38	N	95.8	Very high	96.6	Very high	129 Å²	129	94.1 Å²	94.1	69%	0.69	53%	0.525	S	S	*	.	G	3₁₀ helix	trans	-64.2	-33	177	-65.9	-22.6	0	0	0	112.5	Y35 W36	Y35-N38 VanDerWaalsContact O-CB 3.31Å; Y35-N38 WeakPolarHBondContact O-CB 3.21Å; Y35-N38 PolarHBondContact O-N 3.15Å; Y35-N38 VanDerWaalsContact O-N 3.1Å; W36-N38 PolarHBondContact O-N 3.08Å; W36-N38 VanDerWaalsContact O-N 3.11Å
39	K	95.6	Very high	96.8	Very high	140 Å²	140	94.1 Å²	94.1	61%	0.609	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-112.1	-27.3	-178.2	-170	173	179.5	-176.8	0	112.8	W36 S37 P41	W36-K39 PolarHBondContact O-N 3.13Å; S37-K39 VanDerWaalsContact C-N 3.27Å; S37-K39 PolarHBondContact O-N 3.47Å; K39-P41 WeakPolarHBondContact O-CD 3.49Å
40	Y	96.2	Very high	96.9	Very high	66 Å²	66	94.6 Å²	94.6	26%	0.259	52%	0.518	S	S	.	.			trans	-122.2	81.8	179.8	-46	-72.2	0	0	0	108.5	A23 W25 W36 S37 Y42 C43	A23-Y40 WeakPolarHBondContact CA-OH 3.33Å; A23-Y40 HydrophobicContact CB-CE1 4.02Å; A23-Y40 WeakPolarHBondContact CB-OH 3.16Å; W25-Y40 HydrophobicContact CB-CE2 4.11Å; W36-Y40 HydrophobicContact CB-CD2 4.21Å; W36-Y40 WeakPolarHBondContact O-CA 3.31Å; W36-Y40 WeakPolarHBondContact O-CD2 3.48Å; W36-Y40 PolarHBondContact O-N 2.82Å; S37-Y40 WeakPolarHBondContact CA-O 3.35Å; Y40-Y42 PolarHBondContact O-N 3.38Å; Y40-C43 VanDerWaalsContact O-CB 3.28Å; Y40-C43 WeakPolarHBondContact O-CB 3.42Å; Y40-C43 PolarHBondContact O-N 3.34Å
41	P	96.4	Very high	97.1	Very high	97 Å²	97	93.6 Å²	93.6	63%	0.63	50%	0.503	S	S	*	.	G	3₁₀ helix	trans	-54.8	-30.1	-169.9	-29.5	36.2	0	0	0	114.8	K39 C43 G44	K39-P41 WeakPolarHBondContact O-CD 3.49Å; P41-C43 PolarHBondContact O-N 3.2Å; P41-G44 PolarHBondContact O-N 3.48Å
42	Y	96.8	Very high	97.3	Very high	208 Å²	208	94.9 Å²	94.9	82%	0.816	51%	0.505	S	S	*	.	G	3₁₀ helix	trans	-62.1	-25.9	176.4	-65	-64.2	0	0	0	113.6	Y40 G44 G45 Q48	Y40-Y42 PolarHBondContact O-N 3.38Å; Y42-G44 PolarHBondContact O-N 2.83Å; Y42-G45 PolarHBondContact O-N 3.08Å; Y42-Q48 VanDerWaalsContact O-CD 3.25Å; Y42-Q48 PolarHBondContact O-NE2 2.85Å; Y42-Q48 VanDerWaalsContact O-NE2 3.11Å; Y42-Q48 PolarHBondContact O-OE1 3.14Å
43	C	97.6	Very high	97.3	Very high	50 Å²	50	97.5 Å²	97.5	34%	0.338	52%	0.518	S	S	.	.	G	3₁₀ helix	trans	-64.1	-20.1	173.3	-63.3	0	0	0	0	112.9	W36 Y40 P41 Q48	W36-C43 HydrophobicContact CB-CB 3.9Å; Y40-C43 VanDerWaalsContact O-CB 3.28Å; Y40-C43 WeakPolarHBondContact O-CB 3.42Å; Y40-C43 PolarHBondContact O-N 3.34Å; P41-C43 PolarHBondContact O-N 3.2Å; C43-Q48 VanDerWaalsContact CA-OE1 3.32Å
44	G	97.2	Very high	97.4	Very high	55 Å²	55	94.4 Å²	94.4	57%	0.567	51%	0.506	S	S	*	.	G	3₁₀ helix	trans	-95	10.8	173.8	0	0	0	0	0	114.1	P41 Y42	P41-G44 PolarHBondContact O-N 3.48Å; Y42-G44 PolarHBondContact O-N 2.83Å
45	G	97.4	Very high	97.4	Very high	38 Å²	38	90.6 Å²	90.6	39%	0.392	49%	0.49	S	S	.	.	S	Bend	trans	-73.3	169.9	179.9	0	0	0	0	0	113.6	Y42 Q48	Y42-G45 PolarHBondContact O-N 3.08Å; G45-Q48 WeakPolarHBondContact O-CG 3.43Å
46	S	98	Very high	97.4	Very high	118 Å²	118	92 Å²	92	83%	0.825	51%	0.506	S	S	*	.	S	Bend	trans	-83.4	-14.6	-178.9	-49.8	0	0	0	0	114.7
47	F	97.4	Very high	97.5	Very high	198 Å²	198	95.9 Å²	95.9	87%	0.868	53%	0.53	S	S	*	.	S	Bend	trans	-116.2	73.5	-177.5	-60.2	-81.6	0	0	0	109
48	Q	98.3	Very high	97.5	Very high	87 Å²	87	98.9 Å²	98.9	41%	0.407	54%	0.542	S	S	.	.			trans	-109.9	154.5	-179.8	-62.9	-61.5	-81.9	0	0	110.9	Y42 C43 G45	Y42-Q48 VanDerWaalsContact O-CD 3.25Å; Y42-Q48 PolarHBondContact O-NE2 2.85Å; Y42-Q48 VanDerWaalsContact O-NE2 3.11Å; Y42-Q48 PolarHBondContact O-OE1 3.14Å; C43-Q48 VanDerWaalsContact CA-OE1 3.32Å; G45-Q48 WeakPolarHBondContact O-CG 3.43Å
49	S	98.1	Very high	97.6	Very high	96 Å²	96	103.8 Å²	103.8	67%	0.671	55%	0.551	S	S	*	*	S	Bend	trans	-112.6	160.5	166.3	-72.3	0	0	0	0	108.7
50	P	98.1	Very high	97.6	Very high	60 Å²	60	105.9 Å²	105.9	39%	0.39	56%	0.56	S	S	.	*			cis	-71.3	172.4	-5.4	34.3	-40.4	0	0	0	113	E125	P50-E125 HydrophobicContact CB-CB 3.73Å; P50-E125 VanDerWaalsContact CB-O 3.26Å; P50-E125 WeakPolarHBondContact CB-O 3.05Å; P50-E125 HydrophobicContact CG-CB 3.83Å; P50-E125 VanDerWaalsContact CG-O 3.3Å; P50-E125 WeakPolarHBondContact CG-O 3.4Å
51	I	98.4	Very high	97.7	Very high	93 Å²	93	104.7 Å²	104.7	48%	0.477	56%	0.561	S	S	.	*			trans	-130	159.2	173.4	63.5	172.1	0	0	0	111.7	I53 H126 L127	I51-I53 HydrophobicContact CD1-CG1 4.32Å; I51-I53 HydrophobicContact CG1-CG1 4.12Å; I51-H126 PolarHBondContact N-CD2 3.49Å; I51-H126 PolarHBondContact O-CD2 3.11Å; I51-L127 PolarHBondContact O-N 3Å
52	H	98.3	Very high	97.6	Very high	84 Å²	84	105.1 Å²	105.1	39%	0.389	57%	0.565	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.1	112.9	164	174.8	-164.9	0	0	0	109.2	T54 L127 S130	H52-T54 PolarHBondContact NE2-OG1 3.06Å; H52-L127 HydrophobicContact CB-CB 4.31Å; H52-S130 PolarHBondContact CE1-OG 2.94Å; H52-S130 PolarHBondContact NE2-N 2.78Å
53	I	98.6	Very high	97.6	Very high	56 Å²	56	100.7 Å²	100.7	29%	0.287	56%	0.559	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.3	111.5	174.5	-55.5	173.5	0	0	0	108.4	I51 L58 L127 V128 D129	I51-I53 HydrophobicContact CD1-CG1 4.32Å; I51-I53 HydrophobicContact CG1-CG1 4.12Å; I53-L58 HydrophobicContact CG2-CD1 4.41Å; I53-L58 HydrophobicContact CG2-CD2 3.93Å; I53-L127 WeakPolarHBondContact CB-O 3.18Å; I53-L127 PolarHBondContact N-O 2.93Å; I53-V128 WeakPolarHBondContact O-CA 3.4Å; I53-D129 PolarHBondContact O-N 3.07Å
54	T	98.4	Very high	97.5	Very high	43 Å²	43	104.9 Å²	104.9	26%	0.264	58%	0.578	S	S	.	*			trans	-100.7	115.7	174.7	-53.4	0	0	0	0	109.3	H52 D56 L57	H52-T54 PolarHBondContact NE2-OG1 3.06Å; T54-D56 HydrophobicContact CG2-CB 4.45Å; T54-D56 PolarHBondContact O-N 3.46Å; T54-L57 HydrophobicContact CG2-CD1 4.4Å; T54-L57 HydrophobicContact CG2-CG 4.19Å; T54-L57 PolarHBondContact O-N 2.8Å
55	S	97.6	Very high	97.4	Very high	50 Å²	50	110.1 Å²	110.1	35%	0.35	58%	0.58	S	S	.	*	G	3₁₀ helix	trans	-55.9	-37.4	-174	-67.1	0	0	0	0	112.8	L57 L58 D129	S55-L57 PolarHBondContact O-N 3.29Å; S55-L58 WeakPolarHBondContact O-CB 3.4Å; S55-L58 WeakPolarHBondContact O-CG 3.34Å; S55-L58 PolarHBondContact O-N 3.38Å; S55-L58 VanDerWaalsContact O-N 3.14Å; S55-D129 WeakPolarHBondContact CB-OD1 3.15Å; S55-D129 WeakPolarHBondContact CB-OD2 3.36Å; S55-D129 PolarHBondContact N-OD1 2.86Å; S55-D129 VanDerWaalsContact OG-CG 3.29Å; S55-D129 PolarHBondContact OG-OD1 2.88Å; S55-D129 PolarHBondContact OG-OD2 2.94Å
56	D	97.8	Very high	97.3	Very high	155 Å²	155	113.3 Å²	113.3	83%	0.829	59%	0.594	S	S	*	*	G	3₁₀ helix	trans	-66.9	-19.3	179.2	-66.5	-20	0	0	0	114.1	T54	T54-D56 HydrophobicContact CG2-CB 4.45Å; T54-D56 PolarHBondContact O-N 3.46Å
57	L	97.8	Very high	97.3	Very high	141 Å²	141	113.6 Å²	113.6	74%	0.738	59%	0.585	S	S	*	*	G	3₁₀ helix	trans	-95.5	-5	177.9	-59.5	-178.9	0	0	0	112.6	T54 S55	T54-L57 HydrophobicContact CG2-CD1 4.4Å; T54-L57 HydrophobicContact CG2-CG 4.19Å; T54-L57 PolarHBondContact O-N 2.8Å; S55-L57 PolarHBondContact O-N 3.29Å
58	L	97.2	Very high	97.3	Very high	112 Å²	112	107.9 Å²	107.9	59%	0.586	56%	0.561	S	S	*	*			trans	-69.5	140.3	-179.5	-64.4	179.4	0	0	0	111	I53 S55	I53-L58 HydrophobicContact CG2-CD1 4.41Å; I53-L58 HydrophobicContact CG2-CD2 3.93Å; S55-L58 WeakPolarHBondContact O-CB 3.4Å; S55-L58 WeakPolarHBondContact O-CG 3.34Å; S55-L58 PolarHBondContact O-N 3.38Å; S55-L58 VanDerWaalsContact O-N 3.14Å
59	R	97.9	Very high	97.2	Very high	232 Å²	232	108 Å²	108	88%	0.875	57%	0.568	S	S	*	*			trans	-110.1	114.7	174.1	-64.2	-177.3	66	-172.9	-0.1	108.7	S61	R59-S61 PolarHBondContact O-N 3.39Å
60	F	97.2	Very high	97.2	Very high	185 Å²	185	108.9 Å²	108.9	81%	0.811	56%	0.556	S	S	*	*			trans	-59.3	134.8	173.2	175.2	-106.1	0	0	0	110.3	P62	F60-P62 HydrophobicContact CE1-CB 3.75Å; F60-P62 HydrophobicContact CE1-CG 4.33Å; F60-P62 HydrophobicContact CZ-CB 4.13Å
61	S	96.5	Very high	97.2	Very high	40 Å²	40	110.5 Å²	110.5	28%	0.28	56%	0.561	S	S	.	*			trans	-123.7	111.3	174.8	179.4	0	0	0	0	109.5	R59 T63 L64	R59-S61 PolarHBondContact O-N 3.39Å; S61-T63 PolarHBondContact O-N 2.98Å; S61-T63 PolarHBondContact OG-OG1 3.12Å; S61-L64 PolarHBondContact O-N 2.94Å
62	P	96.3	Very high	97.1	Very high	107 Å²	107	110.3 Å²	110.3	70%	0.695	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-10.3	-179.8	28.5	-34.7	0	0	0	113.2	F60	F60-P62 HydrophobicContact CE1-CB 3.75Å; F60-P62 HydrophobicContact CE1-CG 4.33Å; F60-P62 HydrophobicContact CZ-CB 4.13Å
63	T	95.4	Very high	96.9	Very high	115 Å²	115	116.1 Å²	116.1	71%	0.706	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.3	-9.7	179.2	61.5	0	0	0	0	112.9	S61 R65	S61-T63 PolarHBondContact O-N 2.98Å; S61-T63 PolarHBondContact OG-OG1 3.12Å; T63-R65 PolarHBondContact O-N 2.8Å
64	L	95.6	Very high	96.6	Very high	138 Å²	138	116.7 Å²	116.7	72%	0.723	58%	0.583	S	S	*	*	P	Polyproline II helix	trans	-67.1	124.7	175.3	-70.3	174.6	0	0	0	109.9	S61	S61-L64 PolarHBondContact O-N 2.94Å
65	R	94.9	Very high	96.3	Very high	164 Å²	164	117.8 Å²	117.8	62%	0.619	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-93.9	154	172.9	-62.1	-174.2	-61.7	-174.5	-0.8	109.7	T63 I67 G101 L102	T63-R65 PolarHBondContact O-N 2.8Å; R65-I67 PolarHBondContact O-N 2.77Å; R65-G101 PolarHBondContact NE-O 2.87Å; R65-G101 PolarHBondContact NH2-O 2.99Å; R65-L102 PolarHBondContact NH2-O 2.81Å
66	P	96.6	Very high	96.1	Very high	106 Å²	106	121.4 Å²	121.4	69%	0.688	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-53.4	140.8	171.2	-25.5	35.1	0	0	0	111.7
67	I	97.3	Very high	95.9	Very high	123 Å²	123	119.2 Å²	119.2	63%	0.631	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-72.5	131	169.9	-63.3	176.4	0	0	0	108	R65 V99	R65-I67 PolarHBondContact O-N 2.77Å; I67-V99 HydrophobicContact CG2-CG1 3.6Å
68	E	97.2	Very high	95.7	Very high	78 Å²	78	117 Å²	117	36%	0.364	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.2	113.7	178.8	-64.2	-177.7	-168.8	0	0	110.4	R70 V99 A100	E68-R70 IonicContact OE2-CZ 3.35Å; E68-R70 IonicContact OE2-NE 3.2Å; E68-R70 PolarHBondContact OE2-NE 3.41Å; E68-R70 IonicContact OE2-NH2 2.69Å; E68-R70 PolarHBondContact OE2-NH2 3.11Å; E68-V99 CarbonylContact O-C 3.48Å; E68-V99 WeakPolarHBondContact O-CA 3.42Å; E68-A100 HydrophobicContact CB-CB 4.17Å; E68-A100 PolarHBondContact N-O 2.81Å; E68-A100 PolarHBondContact O-N 3.27Å
69	V	97.1	Very high	95.6	Very high	90 Å²	90	120.3 Å²	120.3	55%	0.545	61%	0.608	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.1	120.9	172.4	-66.1	0	0	0	0	109.8	Y72 V99	V69-Y72 HydrophobicContact CB-CD2 3.74Å; V69-Y72 HydrophobicContact CB-CE2 3.94Å; V69-Y72 HydrophobicContact CB-CG 4.15Å; V69-Y72 HydrophobicContact CG1-CE2 4.35Å; V69-V99 HydrophobicContact CG1-CG2 4.43Å
70	R	97.8	Very high	95.6	Very high	114 Å²	114	112 Å²	112	43%	0.43	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.4	135.9	-173.8	-61	-65.9	-170.5	161.3	0.8	110.7	E68 Y72 Y98	E68-R70 IonicContact OE2-CZ 3.35Å; E68-R70 IonicContact OE2-NE 3.2Å; E68-R70 PolarHBondContact OE2-NE 3.41Å; E68-R70 IonicContact OE2-NH2 2.69Å; E68-R70 PolarHBondContact OE2-NH2 3.11Å; R70-Y72 VanDerWaalsContact C-N 3.3Å; R70-Y72 VanDerWaalsContact O-CD2 3.26Å; R70-Y72 WeakPolarHBondContact O-CD2 3.3Å; R70-Y72 PolarHBondContact O-N 2.88Å; R70-Y98 HydrophobicContact CB-CD1 4.04Å; R70-Y98 HydrophobicContact CB-CD2 3.91Å; R70-Y98 HydrophobicContact CB-CE1 3.61Å; R70-Y98 HydrophobicContact CB-CE2 3.51Å; R70-Y98 HydrophobicContact CB-CG 4.17Å; R70-Y98 HydrophobicContact CG-CD2 4.09Å; R70-Y98 HydrophobicContact CG-CE1 4.4Å; R70-Y98 HydrophobicContact CG-CE2 3.44Å; R70-Y98 VanDerWaalsContact CG-CE2 3.44Å; R70-Y98 PolarHBondContact N-O 2.79Å; R70-Y98 PolarHBondContact O-N 2.9Å
71	N	96.8	Very high	95.6	Very high	94 Å²	94	107.7 Å²	107.7	50%	0.503	57%	0.57	S	S	.	*	S	Bend	trans	66	20	-178.4	-53.5	-31.9	0	0	0	116	K73 T96 M97	N71-K73 VanDerWaalsContact C-N 3.3Å; N71-K73 PolarHBondContact O-N 2.79Å; N71-T96 PolarHBondContact ND2-O 2.64Å; N71-M97 WeakPolarHBondContact O-CG 3.22Å
72	Y	96.1	Very high	95.7	Very high	89 Å²	89	110.8 Å²	110.8	35%	0.349	58%	0.583	S	S	.	*			trans	-78.5	-11.4	176.8	-79.6	-112.1	0	0	0	113.8	V69 R70 L74 M97 A108	V69-Y72 HydrophobicContact CB-CD2 3.74Å; V69-Y72 HydrophobicContact CB-CE2 3.94Å; V69-Y72 HydrophobicContact CB-CG 4.15Å; V69-Y72 HydrophobicContact CG1-CE2 4.35Å; R70-Y72 VanDerWaalsContact C-N 3.3Å; R70-Y72 VanDerWaalsContact O-CD2 3.26Å; R70-Y72 WeakPolarHBondContact O-CD2 3.3Å; R70-Y72 PolarHBondContact O-N 2.88Å; Y72-L74 PolarHBondContact O-N 2.92Å; Y72-L74 VanDerWaalsContact O-N 3.15Å; Y72-M97 HydrophobicContact CD1-SD 4.23Å; Y72-M97 HydrophobicContact CD2-CB 4.28Å; Y72-M97 HydrophobicContact CD2-CG 4.4Å; Y72-M97 HydrophobicContact CD2-SD 4.44Å; Y72-M97 HydrophobicContact CE1-SD 4.39Å; Y72-M97 HydrophobicContact CE2-CB 3.94Å; Y72-M97 HydrophobicContact CG-SD 4.26Å; Y72-A108 WeakPolarHBondContact OH-CB 2.99Å
73	K	95.3	Very high	95.7	Very high	206 Å²	206	113.9 Å²	113.9	90%	0.896	58%	0.581	S	S	*	*			trans	-80.7	94.9	173.7	-174	176.9	-179.9	178.8	0	109.2	N71	N71-K73 VanDerWaalsContact C-N 3.3Å; N71-K73 PolarHBondContact O-N 2.79Å
74	L	91.8	Very high	95.8	Very high	69 Å²	69	113.8 Å²	113.8	36%	0.361	58%	0.576	S	S	.	*			trans	-78.6	151.6	177.9	-68	180	0	0	0	112.5	Y72 E78 L80 M97	Y72-L74 PolarHBondContact O-N 2.92Å; Y72-L74 VanDerWaalsContact O-N 3.15Å; L74-E78 HydrophobicContact CB-CB 4.13Å; L74-E78 HydrophobicContact CD1-CB 4.43Å; L74-E78 HydrophobicContact CD1-CG 4.15Å; L74-E78 HydrophobicContact CD2-CB 4.27Å; L74-E78 HydrophobicContact CD2-CG 3.8Å; L74-E78 HydrophobicContact CG-CG 4.39Å; L74-L80 HydrophobicContact CD1-CD1 3.65Å; L74-L80 HydrophobicContact CD1-CD2 4.15Å; L74-L80 HydrophobicContact CD1-CG 4.04Å; L74-M97 HydrophobicContact CD1-CE 3.73Å; L74-M97 HydrophobicContact CD2-CE 3.17Å; L74-M97 HydrophobicContact CG-CE 3.48Å; L74-M97 VanDerWaalsContact CG-CE 3.48Å
75	S	92.8	Very high	95.8	Very high	65 Å²	65	109.5 Å²	109.5	46%	0.455	55%	0.554	S	S	.	*			trans	-65.2	150.7	164	177.9	0	0	0	0	109.7	T77 E78	S75-T77 PolarHBondContact O-N 2.8Å; S75-T77 VanDerWaalsContact O-N 3.13Å; S75-T77 PolarHBondContact OG-N 3.35Å; S75-T77 PolarHBondContact OG-OG1 3.04Å; S75-E78 WeakPolarHBondContact O-CB 3.26Å; S75-E78 PolarHBondContact O-N 3.35Å; S75-E78 VanDerWaalsContact O-N 3.08Å
76	S	91.9	Very high	95.8	Very high	127 Å²	127	104.8 Å²	104.8	89%	0.888	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.3	-16.2	170.5	54.7	0	0	0	0	113.3
77	T	94	Very high	95.8	Very high	108 Å²	108	102.5 Å²	102.5	66%	0.663	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.7	-8.1	177.3	61.6	0	0	0	0	113.4	S75 Q79	S75-T77 PolarHBondContact O-N 2.8Å; S75-T77 VanDerWaalsContact O-N 3.13Å; S75-T77 PolarHBondContact OG-N 3.35Å; S75-T77 PolarHBondContact OG-OG1 3.04Å; T77-Q79 PolarHBondContact O-N 3.01Å
78	E	94.3	Very high	95.7	Very high	96 Å²	96	96.8 Å²	96.8	45%	0.449	51%	0.507	S	S	.	.			trans	-68.3	130.6	179.1	-169.2	67.4	-157.2	0	0	109.7	L74 S75 L80	L74-E78 HydrophobicContact CB-CB 4.13Å; L74-E78 HydrophobicContact CD1-CB 4.43Å; L74-E78 HydrophobicContact CD1-CG 4.15Å; L74-E78 HydrophobicContact CD2-CB 4.27Å; L74-E78 HydrophobicContact CD2-CG 3.8Å; L74-E78 HydrophobicContact CG-CG 4.39Å; S75-E78 WeakPolarHBondContact O-CB 3.26Å; S75-E78 PolarHBondContact O-N 3.35Å; S75-E78 VanDerWaalsContact O-N 3.08Å; E78-L80 HydrophobicContact CG-CD2 4.13Å
79	Q	95.9	Very high	95.8	Very high	180 Å²	180	96 Å²	96	84%	0.841	51%	0.505	S	S	*	.			trans	-109.4	118.6	177.8	-69.4	-178.2	64.1	0	0	109.8	T77	T77-Q79 PolarHBondContact O-N 3.01Å
80	L	96.3	Very high	95.8	Very high	57 Å²	57	95.1 Å²	95.1	30%	0.298	49%	0.494	S	S	.	.	P	Polyproline II helix	trans	-102.4	156.2	175.2	-58.8	-174.5	0	0	0	110.8	L74 E78 L91 L93 P94	L74-L80 HydrophobicContact CD1-CD1 3.65Å; L74-L80 HydrophobicContact CD1-CD2 4.15Å; L74-L80 HydrophobicContact CD1-CG 4.04Å; E78-L80 HydrophobicContact CG-CD2 4.13Å; L80-L91 HydrophobicContact CB-CD1 3.66Å; L80-L91 HydrophobicContact CB-CG 4.27Å; L80-L91 HydrophobicContact CD1-CD1 4.11Å; L80-L91 HydrophobicContact CD1-CD2 3.74Å; L80-L91 HydrophobicContact CD1-CG 3.99Å; L80-L93 HydrophobicContact CD1-CD2 4.2Å; L80-P94 HydrophobicContact CD2-CG 3.93Å
81	T	97.8	Very high	95.8	Very high	95 Å²	95	91.4 Å²	91.4	58%	0.583	48%	0.482	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.9	119.5	177.2	-59.9	0	0	0	0	110.2	L91 S92	T81-L91 WeakPolarHBondContact O-CA 3.26Å; T81-S92 PolarHBondContact O-N 3.2Å
82	L	97.9	Very high	95.9	Very high	106 Å²	106	89.9 Å²	89.9	56%	0.555	48%	0.479	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.9	128.3	170.7	-174.8	64.2	0	0	0	109.7	L89 K90 L91	L82-L89 HydrophobicContact CD1-CB 4.26Å; L82-K90 CarbonylContact C-O 3.58Å; L82-K90 WeakPolarHBondContact CA-O 3.34Å; L82-L91 HydrophobicContact CB-CD1 4.21Å; L82-L91 HydrophobicContact CD1-CB 4.23Å; L82-L91 HydrophobicContact CD1-CD1 4.29Å
83	R	97.5	Very high	96	Very high	171 Å²	171	86.8 Å²	86.8	65%	0.645	47%	0.468	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128.3	133.7	-179	178.8	176.9	175.6	-178.6	-1.4	110.5	K90	R83-K90 PolarHBondContact N-O 2.99Å; R83-K90 PolarHBondContact O-N 3.11Å
84	N	97.2	Very high	96	Very high	113 Å²	113	78 Å²	78	60%	0.604	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.6	120.4	161	-173.4	-22.3	0	0	0	108.1	G86 L89	N84-G86 PolarHBondContact OD1-N 3.26Å; N84-L89 HydrophobicContact CB-CD2 3.8Å
85	D	94.4	Very high	96.2	Very high	49 Å²	49	79.8 Å²	79.8	26%	0.262	45%	0.448	S	S	.	.			trans	-101	5.8	178.2	71.8	-8.1	0	0	0	114	H87 S88 K90	D85-H87 VanDerWaalsContact C-N 3.33Å; D85-H87 PolarHBondContact OD1-N 2.87Å; D85-S88 PolarHBondContact N-O 3.23Å; D85-S88 PolarHBondContact OD1-N 3.25Å; D85-K90 VanDerWaalsContact OD2-CD 3.31Å; D85-K90 WeakPolarHBondContact OD2-CD 3.44Å; D85-K90 WeakPolarHBondContact OD2-CE 3.14Å; D85-K90 IonicContact OD2-NZ 2.83Å; D85-K90 PolarHBondContact OD2-NZ 3.02Å
86	G	95.9	Very high	96.4	Very high	64 Å²	64	81 Å²	81	66%	0.66	45%	0.452	S	S	*	.	S	Bend	trans	92.7	-14.5	-175.6	0	0	0	0	0	113.7	N84	N84-G86 PolarHBondContact OD1-N 3.26Å
87	H	95.8	Very high	96.7	Very high	58 Å²	58	75 Å²	75	27%	0.269	41%	0.411	S	S	.	.	S	Bend	trans	-119.5	-29.6	-178.7	-58.3	99.3	0	0	0	112.9	W25 Y27 D85	W25-H87 AromaticContact CD2-CD2 3.97Å; W25-H87 AromaticContact CD2-NE2 3.71Å; W25-H87 AromaticContact CE2-CD2 3.82Å; W25-H87 AromaticContact CE2-CE1 3.92Å; W25-H87 AromaticContact CE2-NE2 3.65Å; W25-H87 AromaticContact CE3-CD2 3.72Å; W25-H87 AromaticContact CE3-NE2 3.84Å; W25-H87 HydrophobicContact CH2-CB 3.68Å; W25-H87 AromaticContact CH2-CD2 3.26Å; W25-H87 WeakPolarHBondContact CH2-CD2 3.29Å; W25-H87 AromaticContact CH2-CG 3.5Å; W25-H87 VanDerWaalsContact CH2-CG 3.5Å; W25-H87 AromaticContact CH2-NE2 3.96Å; W25-H87 HydrophobicContact CZ2-CB 3.98Å; W25-H87 AromaticContact CZ2-CD2 3.49Å; W25-H87 VanDerWaalsContact CZ2-CD2 3.49Å; W25-H87 WeakPolarHBondContact CZ2-CD2 3.5Å; W25-H87 AromaticContact CZ2-CG 3.52Å; W25-H87 AromaticContact CZ2-ND1 3.87Å; W25-H87 AromaticContact CZ2-NE2 3.79Å; W25-H87 HydrophobicContact CZ3-CB 4.48Å; W25-H87 AromaticContact CZ3-CD2 3.37Å; W25-H87 WeakPolarHBondContact CZ3-CD2 3.34Å; W25-H87 AromaticContact CZ3-NE2 3.97Å; W25-H87 PolarHBondContact O-NE2 2.99Å; Y27-H87 HydrophobicContact CE2-CB 4.35Å; D85-H87 VanDerWaalsContact C-N 3.33Å; D85-H87 PolarHBondContact OD1-N 2.87Å
88	S	96.8	Very high	96.9	Very high	3 Å²	3	72.7 Å²	72.7	2%	0.021	39%	0.39	C	S	.	.			trans	-154.9	168.7	178.6	-174.9	0	0	0	0	111.2	D85 F113	D85-S88 PolarHBondContact N-O 3.23Å; D85-S88 PolarHBondContact OD1-N 3.25Å; S88-F113 PolarHBondContact OG-N 3.18Å; S88-F113 VanDerWaalsContact OG-N 3.11Å; S88-F113 PolarHBondContact OG-O 3.46Å
89	L	97.9	Very high	97.1	Very high	63 Å²	63	69.6 Å²	69.6	33%	0.33	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	120.2	161.6	-71.4	179.8	0	0	0	108.4	L82 N84 H112 F113 W115	L82-L89 HydrophobicContact CD1-CB 4.26Å; N84-L89 HydrophobicContact CB-CD2 3.8Å; L89-H112 VanDerWaalsContact O-CA 3.26Å; L89-H112 WeakPolarHBondContact O-CA 3.19Å; L89-F113 HydrophobicContact CB-CD2 4.27Å; L89-F113 WeakPolarHBondContact O-CD2 3.23Å; L89-F113 PolarHBondContact O-N 3.24Å; L89-W115 HydrophobicContact CB-CZ3 4.5Å; L89-W115 HydrophobicContact CG-CH2 4.11Å; L89-W115 HydrophobicContact CG-CZ3 4.49Å
90	K	98.3	Very high	97.1	Very high	70 Å²	70	61.8 Å²	61.8	30%	0.304	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	127.5	-176.9	-58.2	-165.8	165.1	161.8	0	111	L82 R83 D85 L111 H112	L82-K90 CarbonylContact C-O 3.58Å; L82-K90 WeakPolarHBondContact CA-O 3.34Å; R83-K90 PolarHBondContact N-O 2.99Å; R83-K90 PolarHBondContact O-N 3.11Å; D85-K90 VanDerWaalsContact OD2-CD 3.31Å; D85-K90 WeakPolarHBondContact OD2-CD 3.44Å; D85-K90 WeakPolarHBondContact OD2-CE 3.14Å; D85-K90 IonicContact OD2-NZ 2.83Å; D85-K90 PolarHBondContact OD2-NZ 3.02Å; K90-L111 CarbonylContact C-O 3.42Å; K90-L111 WeakPolarHBondContact CA-O 3.45Å; K90-H112 HydrophobicContact CB-CB 4.44Å; K90-H112 HydrophobicContact CG-CB 3.82Å
91	L	98.1	Very high	97	Very high	37 Å²	37	60 Å²	60	19%	0.194	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	117.8	176.4	-174.6	72.2	0	0	0	109.1	L80 T81 L82 L93 Q110 L111	L80-L91 HydrophobicContact CB-CD1 3.66Å; L80-L91 HydrophobicContact CB-CG 4.27Å; L80-L91 HydrophobicContact CD1-CD1 4.11Å; L80-L91 HydrophobicContact CD1-CD2 3.74Å; L80-L91 HydrophobicContact CD1-CG 3.99Å; T81-L91 WeakPolarHBondContact O-CA 3.26Å; L82-L91 HydrophobicContact CB-CD1 4.21Å; L82-L91 HydrophobicContact CD1-CB 4.23Å; L82-L91 HydrophobicContact CD1-CD1 4.29Å; L91-L93 HydrophobicContact CD2-CD2 4.23Å; L91-L93 HydrophobicContact CG-CD2 4.46Å; L91-Q110 CarbonylContact O-C 3.05Å; L91-Q110 WeakPolarHBondContact O-CA 3.31Å; L91-Q110 WeakPolarHBondContact O-CB 3.24Å; L91-L111 HydrophobicContact CB-CD1 3.78Å; L91-L111 HydrophobicContact CB-CG 3.97Å; L91-L111 HydrophobicContact CD2-CD1 4.08Å; L91-L111 HydrophobicContact CD2-CD2 4.12Å; L91-L111 HydrophobicContact CD2-CG 4.07Å; L91-L111 PolarHBondContact N-O 3.35Å; L91-L111 PolarHBondContact O-N 3.23Å
92	S	98.1	Very high	96.9	Very high	62 Å²	62	59 Å²	59	43%	0.434	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	132.7	175.1	-60.2	0	0	0	0	110.7	T81	T81-S92 PolarHBondContact O-N 3.2Å
93	L	97.7	Very high	96.8	Very high	24 Å²	24	59.8 Å²	59.8	13%	0.126	34%	0.342	C	S	.	.			trans	-107.5	145.5	-177.6	-61.9	176.7	0	0	0	111.6	L80 L91 M97 A108 A109 L111	L80-L93 HydrophobicContact CD1-CD2 4.2Å; L91-L93 HydrophobicContact CD2-CD2 4.23Å; L91-L93 HydrophobicContact CG-CD2 4.46Å; L93-M97 HydrophobicContact CB-SD 4.21Å; L93-M97 HydrophobicContact CD2-SD 4.14Å; L93-A108 HydrophobicContact CB-CB 4.31Å; L93-A108 HydrophobicContact CD1-CB 3.92Å; L93-A109 PolarHBondContact N-O 3.46Å; L93-L111 HydrophobicContact CD1-CB 4.41Å; L93-L111 HydrophobicContact CD1-CD2 4.48Å; L93-L111 HydrophobicContact CD2-CD2 4.4Å
94	P	96.2	Very high	96.7	Very high	22 Å²	22	57 Å²	57	14%	0.143	34%	0.34	C	S	.	.			trans	-62.6	141.6	176.3	-22.5	34.1	0	0	0	111.9	L80 T96 M97	L80-P94 HydrophobicContact CD2-CG 3.93Å; P94-T96 PolarHBondContact O-N 3.29Å; P94-M97 HydrophobicContact CG-CE 4.22Å; P94-M97 WeakPolarHBondContact O-CB 3.42Å; P94-M97 PolarHBondContact O-N 2.6Å
95	P	96.3	Very high	96.7	Very high	106 Å²	106	57.3 Å²	57.3	69%	0.688	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-5.4	-179.7	30.3	-37	0	0	0	113.5	M97 T107	P95-M97 VanDerWaalsContact C-N 3.3Å; P95-T107 HydrophobicContact CB-CG2 4.21Å; P95-T107 VanDerWaalsContact O-CG2 3.31Å; P95-T107 WeakPolarHBondContact O-CG2 3.41Å
96	T	96.4	Very high	96.9	Very high	89 Å²	89	59.9 Å²	59.9	55%	0.546	35%	0.347	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.1	-17	172	55.7	0	0	0	0	112.5	N71 P94 Y98	N71-T96 PolarHBondContact ND2-O 2.64Å; P94-T96 PolarHBondContact O-N 3.29Å; T96-Y98 WeakPolarHBondContact O-CD1 3.42Å
97	M	97.9	Very high	97	Very high	3 Å²	3	60.9 Å²	60.9	2%	0.015	34%	0.34	C	S	.	.			trans	-80.7	138.1	173.8	-67	-172.5	-176.8	0	0	110.9	N71 Y72 L74 L93 P94 P95 A108	N71-M97 WeakPolarHBondContact O-CG 3.22Å; Y72-M97 HydrophobicContact CD1-SD 4.23Å; Y72-M97 HydrophobicContact CD2-CB 4.28Å; Y72-M97 HydrophobicContact CD2-CG 4.4Å; Y72-M97 HydrophobicContact CD2-SD 4.44Å; Y72-M97 HydrophobicContact CE1-SD 4.39Å; Y72-M97 HydrophobicContact CE2-CB 3.94Å; Y72-M97 HydrophobicContact CG-SD 4.26Å; L74-M97 HydrophobicContact CD1-CE 3.73Å; L74-M97 HydrophobicContact CD2-CE 3.17Å; L74-M97 HydrophobicContact CG-CE 3.48Å; L74-M97 VanDerWaalsContact CG-CE 3.48Å; L93-M97 HydrophobicContact CB-SD 4.21Å; L93-M97 HydrophobicContact CD2-SD 4.14Å; P94-M97 HydrophobicContact CG-CE 4.22Å; P94-M97 WeakPolarHBondContact O-CB 3.42Å; P94-M97 PolarHBondContact O-N 2.6Å; P95-M97 VanDerWaalsContact C-N 3.3Å; M97-A108 HydrophobicContact CB-CB 3.78Å; M97-A108 PolarHBondContact O-N 2.77Å
98	Y	98.2	Very high	97.1	Very high	59 Å²	59	58.7 Å²	58.7	23%	0.231	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.4	160	177.4	63.5	-89	0	0	0	112.8	R70 T96 A100 Q105 F106	R70-Y98 HydrophobicContact CB-CD1 4.04Å; R70-Y98 HydrophobicContact CB-CD2 3.91Å; R70-Y98 HydrophobicContact CB-CE1 3.61Å; R70-Y98 HydrophobicContact CB-CE2 3.51Å; R70-Y98 HydrophobicContact CB-CG 4.17Å; R70-Y98 HydrophobicContact CG-CD2 4.09Å; R70-Y98 HydrophobicContact CG-CE1 4.4Å; R70-Y98 HydrophobicContact CG-CE2 3.44Å; R70-Y98 VanDerWaalsContact CG-CE2 3.44Å; R70-Y98 PolarHBondContact N-O 2.79Å; R70-Y98 PolarHBondContact O-N 2.9Å; T96-Y98 WeakPolarHBondContact O-CD1 3.42Å; Y98-A100 HydrophobicContact CD2-CB 4.32Å; Y98-A100 HydrophobicContact CE2-CB 4.2Å; Y98-Q105 VanDerWaalsContact CD2-CD 3.42Å; Y98-Q105 HydrophobicContact CD2-CG 3.5Å; Y98-Q105 VanDerWaalsContact CD2-CG 3.5Å; Y98-Q105 HydrophobicContact CE2-CG 4.17Å; Y98-Q105 HydrophobicContact CG-CG 3.99Å; Y98-F106 CarbonylContact C-O 3.58Å; Y98-F106 WeakPolarHBondContact CA-O 3.44Å; Y98-F106 VanDerWaalsContact CB-O 3.29Å; Y98-F106 WeakPolarHBondContact CB-O 3.1Å
99	V	98.1	Very high	97.2	Very high	30 Å²	30	62.1 Å²	62.1	18%	0.182	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	129.6	172.5	-177.2	0	0	0	0	109.2	I67 E68 V69 L102 F106	I67-V99 HydrophobicContact CG2-CG1 3.6Å; E68-V99 CarbonylContact O-C 3.48Å; E68-V99 WeakPolarHBondContact O-CA 3.42Å; V69-V99 HydrophobicContact CG1-CG2 4.43Å; V99-L102 HydrophobicContact CG1-CD1 4.12Å; V99-F106 PolarHBondContact N-O 3.38Å; V99-F106 PolarHBondContact O-N 3.11Å
100	A	97	Very high	97.2	Very high	17 Å²	17	62.5 Å²	62.5	14%	0.14	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	-179.7	173.6	0	0	0	0	0	110.6	E68 Y98 L102	E68-A100 HydrophobicContact CB-CB 4.17Å; E68-A100 PolarHBondContact N-O 2.81Å; E68-A100 PolarHBondContact O-N 3.27Å; Y98-A100 HydrophobicContact CD2-CB 4.32Å; Y98-A100 HydrophobicContact CE2-CB 4.2Å; A100-L102 VanDerWaalsContact C-N 3.26Å; A100-L102 PolarHBondContact O-N 3.14Å
101	G	94.6	Very high	97.2	Very high	20 Å²	20	61 Å²	61	21%	0.206	36%	0.355	C	S	.	.	S	Bend	trans	89.6	-17.2	-173.5	0	0	0	0	0	113.9	R65	R65-G101 PolarHBondContact NE-O 2.87Å; R65-G101 PolarHBondContact NH2-O 2.99Å
102	L	94.9	Very high	97.2	Very high	72 Å²	72	60.9 Å²	60.9	38%	0.377	35%	0.354	S	S	.	.	S	Bend	trans	-81	172.7	171.7	-60.6	176.8	0	0	0	111.8	R65 V99 A100 N104 F106	R65-L102 PolarHBondContact NH2-O 2.81Å; V99-L102 HydrophobicContact CG1-CD1 4.12Å; A100-L102 VanDerWaalsContact C-N 3.26Å; A100-L102 PolarHBondContact O-N 3.14Å; L102-N104 WeakPolarHBondContact CB-O 3.26Å; L102-N104 PolarHBondContact O-N 3.1Å; L102-F106 HydrophobicContact CB-CD2 4.15Å; L102-F106 HydrophobicContact CB-CE2 3.85Å; L102-F106 HydrophobicContact CD1-CD2 3.64Å; L102-F106 HydrophobicContact CD1-CE2 3.79Å; L102-F106 HydrophobicContact CG-CE2 4.49Å
103	P	95.2	Very high	97.2	Very high	124 Å²	124	61.5 Å²	61.5	81%	0.805	35%	0.349	S	S	*	.	S	Bend	trans	-58.7	-27.8	176.5	-27.9	36.9	0	0	0	114.2
104	N	96.4	Very high	97.2	Very high	111 Å²	111	61.3 Å²	61.3	59%	0.594	35%	0.348	S	S	*	.	S	Bend	trans	-127.1	163.4	172.7	-63.5	-66.7	0	0	0	109.8	L102 F106	L102-N104 WeakPolarHBondContact CB-O 3.26Å; L102-N104 PolarHBondContact O-N 3.1Å; N104-F106 HydrophobicContact CB-CD2 4.46Å; N104-F106 HydrophobicContact CB-CE2 3.82Å; N104-F106 HydrophobicContact CB-CZ 3.99Å; N104-F106 WeakPolarHBondContact O-CD2 3.41Å; N104-F106 VanDerWaalsContact O-CE2 3.23Å; N104-F106 WeakPolarHBondContact O-CE2 3.46Å
105	Q	97.2	Very high	97.3	Very high	120 Å²	120	67 Å²	67	56%	0.561	37%	0.366	S	S	*	.			trans	-81.9	134.3	165.5	-177.1	179.3	-52.8	0	0	109.4	Y98	Y98-Q105 VanDerWaalsContact CD2-CD 3.42Å; Y98-Q105 HydrophobicContact CD2-CG 3.5Å; Y98-Q105 VanDerWaalsContact CD2-CG 3.5Å; Y98-Q105 HydrophobicContact CE2-CG 4.17Å; Y98-Q105 HydrophobicContact CG-CG 3.99Å
106	F	98.2	Very high	97.3	Very high	104 Å²	104	63 Å²	63	46%	0.456	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	118.7	-179.8	-65.8	-93.5	0	0	0	110.2	Y98 V99 L102 N104	Y98-F106 CarbonylContact C-O 3.58Å; Y98-F106 WeakPolarHBondContact CA-O 3.44Å; Y98-F106 VanDerWaalsContact CB-O 3.29Å; Y98-F106 WeakPolarHBondContact CB-O 3.1Å; V99-F106 PolarHBondContact N-O 3.38Å; V99-F106 PolarHBondContact O-N 3.11Å; L102-F106 HydrophobicContact CB-CD2 4.15Å; L102-F106 HydrophobicContact CB-CE2 3.85Å; L102-F106 HydrophobicContact CD1-CD2 3.64Å; L102-F106 HydrophobicContact CD1-CE2 3.79Å; L102-F106 HydrophobicContact CG-CE2 4.49Å; N104-F106 HydrophobicContact CB-CD2 4.46Å; N104-F106 HydrophobicContact CB-CE2 3.82Å; N104-F106 HydrophobicContact CB-CZ 3.99Å; N104-F106 WeakPolarHBondContact O-CD2 3.41Å; N104-F106 VanDerWaalsContact O-CE2 3.23Å; N104-F106 WeakPolarHBondContact O-CE2 3.46Å
107	T	98.5	Very high	97.2	Very high	84 Å²	84	61.8 Å²	61.8	52%	0.515	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.2	133.2	174.4	-62.4	0	0	0	0	110.3	P95	P95-T107 HydrophobicContact CB-CG2 4.21Å; P95-T107 VanDerWaalsContact O-CG2 3.31Å; P95-T107 WeakPolarHBondContact O-CG2 3.41Å
108	A	98	Very high	97	Very high	12 Å²	12	67.6 Å²	67.6	10%	0.099	38%	0.381	C	S	.	.			trans	-73	136.6	174	0	0	0	0	0	109.8	Y72 L93 M97	Y72-A108 WeakPolarHBondContact OH-CB 2.99Å; L93-A108 HydrophobicContact CB-CB 4.31Å; L93-A108 HydrophobicContact CD1-CB 3.92Å; M97-A108 HydrophobicContact CB-CB 3.78Å; M97-A108 PolarHBondContact O-N 2.77Å
109	A	97.9	Very high	96.8	Very high	75 Å²	75	71.7 Å²	71.7	62%	0.62	41%	0.406	S	S	*	.			trans	-114.3	-44.3	179.5	0	0	0	0	0	112	L93	L93-A109 PolarHBondContact N-O 3.46Å
110	Q	98	Very high	96.5	Very high	71 Å²	71	79.2 Å²	79.2	33%	0.332	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.4	161.8	-178.2	60.4	88.1	-6.7	0	0	109.9	L91 H112	L91-Q110 CarbonylContact O-C 3.05Å; L91-Q110 WeakPolarHBondContact O-CA 3.31Å; L91-Q110 WeakPolarHBondContact O-CB 3.24Å; Q110-H112 PolarHBondContact NE2-CE1 3.06Å; Q110-H112 PolarHBondContact NE2-ND1 3.19Å; Q110-H112 VanDerWaalsContact NE2-ND1 3.12Å; Q110-H112 PolarHBondContact OE1-ND1 2.92Å
111	L	97.4	Very high	96.3	Very high	38 Å²	38	83.1 Å²	83.1	20%	0.199	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	155.9	155.3	66.1	79.9	0	0	0	110.5	K90 L91 L93 F113 V137 N138	K90-L111 CarbonylContact C-O 3.42Å; K90-L111 WeakPolarHBondContact CA-O 3.45Å; L91-L111 HydrophobicContact CB-CD1 3.78Å; L91-L111 HydrophobicContact CB-CG 3.97Å; L91-L111 HydrophobicContact CD2-CD1 4.08Å; L91-L111 HydrophobicContact CD2-CD2 4.12Å; L91-L111 HydrophobicContact CD2-CG 4.07Å; L91-L111 PolarHBondContact N-O 3.35Å; L91-L111 PolarHBondContact O-N 3.23Å; L93-L111 HydrophobicContact CD1-CB 4.41Å; L93-L111 HydrophobicContact CD1-CD2 4.48Å; L93-L111 HydrophobicContact CD2-CD2 4.4Å; L111-F113 HydrophobicContact CD1-CD2 4.32Å; L111-F113 HydrophobicContact CD1-CE2 3.43Å; L111-F113 VanDerWaalsContact CD1-CE2 3.43Å; L111-F113 HydrophobicContact CD1-CZ 3.63Å; L111-V137 HydrophobicContact CB-CG1 4.46Å; L111-V137 HydrophobicContact CD1-CG1 4.37Å; L111-N138 CarbonylContact C-O 3.51Å; L111-N138 WeakPolarHBondContact CA-O 3.5Å
112	H	98.4	Very high	96.4	Very high	36 Å²	36	84.7 Å²	84.7	17%	0.167	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.9	168.5	-179.6	62.4	-65.8	0	0	0	112	L89 K90 Q110 H114 V137 N138	L89-H112 VanDerWaalsContact O-CA 3.26Å; L89-H112 WeakPolarHBondContact O-CA 3.19Å; K90-H112 HydrophobicContact CB-CB 4.44Å; K90-H112 HydrophobicContact CG-CB 3.82Å; Q110-H112 PolarHBondContact NE2-CE1 3.06Å; Q110-H112 PolarHBondContact NE2-ND1 3.19Å; Q110-H112 VanDerWaalsContact NE2-ND1 3.12Å; Q110-H112 PolarHBondContact OE1-ND1 2.92Å; H112-H114 AromaticContact CD2-NE2 3.38Å; H112-H114 PolarHBondContact CD2-NE2 2.96Å; H112-H114 AromaticContact NE2-NE2 3.59Å; H112-V137 WeakPolarHBondContact O-CA 3.29Å; H112-N138 WeakPolarHBondContact CE1-CB 3.48Å; H112-N138 PolarHBondContact N-O 3.42Å; H112-N138 PolarHBondContact ND1-O 2.96Å; H112-N138 PolarHBondContact O-N 2.88Å
113	F	98.2	Very high	96.5	Very high	75 Å²	75	81.9 Å²	81.9	33%	0.329	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	141.9	-170.1	-59.9	-96.2	0	0	0	111.5	S88 L89 L111 W115 E136 V137	S88-F113 PolarHBondContact OG-N 3.18Å; S88-F113 VanDerWaalsContact OG-N 3.11Å; S88-F113 PolarHBondContact OG-O 3.46Å; L89-F113 HydrophobicContact CB-CD2 4.27Å; L89-F113 WeakPolarHBondContact O-CD2 3.23Å; L89-F113 PolarHBondContact O-N 3.24Å; L111-F113 HydrophobicContact CD1-CD2 4.32Å; L111-F113 HydrophobicContact CD1-CE2 3.43Å; L111-F113 VanDerWaalsContact CD1-CE2 3.43Å; L111-F113 HydrophobicContact CD1-CZ 3.63Å; F113-W115 HydrophobicContact CB-CE3 3.77Å; F113-W115 HydrophobicContact CB-CZ3 3.86Å; F113-W115 VanDerWaalsContact O-CZ3 3.24Å; F113-W115 WeakPolarHBondContact O-CZ3 3.28Å; F113-E136 WeakPolarHBondContact CA-O 3.46Å; F113-V137 HydrophobicContact CD1-CG2 3.63Å; F113-V137 HydrophobicContact CE1-CG1 4.31Å; F113-V137 HydrophobicContact CE1-CG2 3.58Å
114	H	98.3	Very high	96.6	Very high	20 Å²	20	76.1 Å²	76.1	9%	0.093	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	134.8	166.1	-66.9	-101.8	0	0	0	108.1	Y27 H112 G123 E125 A135 E136 N138	Y27-H114 PolarHBondContact OH-CE1 3.29Å; Y27-H114 VanDerWaalsContact OH-CE1 3.29Å; Y27-H114 PolarHBondContact OH-ND1 2.86Å; H112-H114 AromaticContact CD2-NE2 3.38Å; H112-H114 PolarHBondContact CD2-NE2 2.96Å; H112-H114 AromaticContact NE2-NE2 3.59Å; H114-G123 CarbonylContact C-O 3.4Å; H114-E125 HydrophobicContact CB-CG 3.79Å; H114-E125 VanDerWaalsContact CE1-CD 3.43Å; H114-E125 IonicContact CE1-OE1 2.64Å; H114-E125 PolarHBondContact CE1-OE1 3.26Å; H114-E125 IonicContact CE1-OE2 3.83Å; H114-E125 IonicContact CG-OE1 3.2Å; H114-E125 IonicContact ND1-OE1 3.83Å; H114-E125 PolarHBondContact ND1-OE1 2.77Å; H114-E125 IonicContact ND1-OE2 3.66Å; H114-E125 IonicContact NE2-OE2 3.02Å; H114-A135 CarbonylContact O-C 3.5Å; H114-A135 WeakPolarHBondContact O-CA 3.44Å; H114-A135 WeakPolarHBondContact O-CB 3.49Å; H114-E136 HydrophobicContact CB-CB 4.47Å; H114-E136 PolarHBondContact N-O 2.93Å; H114-E136 PolarHBondContact O-N 2.8Å; H114-N138 PolarHBondContact CD2-OD1 3.11Å; H114-N138 VanDerWaalsContact CD2-OD1 3.29Å
115	W	98.1	Very high	96.7	Very high	140 Å²	140	73.9 Å²	73.9	53%	0.53	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.6	164	-176.9	66.4	92.8	0	0	0	111	L89 F113 A135	L89-W115 HydrophobicContact CB-CZ3 4.5Å; L89-W115 HydrophobicContact CG-CH2 4.11Å; L89-W115 HydrophobicContact CG-CZ3 4.49Å; F113-W115 HydrophobicContact CB-CE3 3.77Å; F113-W115 HydrophobicContact CB-CZ3 3.86Å; F113-W115 VanDerWaalsContact O-CZ3 3.24Å; F113-W115 WeakPolarHBondContact O-CZ3 3.28Å; W115-A135 HydrophobicContact CB-CB 4.16Å
116	G	96.3	Very high	96.8	Very high	23 Å²	23	70.5 Å²	70.5	24%	0.237	38%	0.382	C	S	.	.			trans	-81.2	-150.3	-180	0	0	0	0	0	113.1	W120 T122	G116-W120 CarbonylContact C-O 3.6Å; G116-W120 VanDerWaalsContact CA-O 3.23Å; G116-W120 WeakPolarHBondContact CA-O 3.5Å; G116-T122 WeakPolarHBondContact CA-O 3.36Å
117	S	94.4	Very high	96.8	Very high	63 Å²	63	68 Å²	68	44%	0.441	37%	0.373	S	S	.	.	B	Isolated β-bridge	trans	-132.7	173.3	171.2	68.2	0	0	0	0	110.3	N119 W120	S117-N119 PolarHBondContact O-N 2.85Å; S117-N119 VanDerWaalsContact O-N 3.08Å; S117-N119 PolarHBondContact OG-N 2.87Å; S117-W120 PolarHBondContact N-O 3.49Å; S117-W120 CarbonylContact O-C 3.52Å; S117-W120 PolarHBondContact O-N 3.26Å; S117-W120 PolarHBondContact OG-N 2.96Å
118	S	93	Very high	96.8	Very high	126 Å²	126	66.8 Å²	66.8	88%	0.881	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.4	-31	175.5	-39.9	0	0	0	0	113
119	N	94.7	Very high	96.8	Very high	144 Å²	144	70 Å²	70	77%	0.77	38%	0.382	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92	-14.8	179.1	-62.9	-26.4	0	0	0	113.2	S117	S117-N119 PolarHBondContact O-N 2.85Å; S117-N119 VanDerWaalsContact O-N 3.08Å; S117-N119 PolarHBondContact OG-N 2.87Å
120	W	92.4	Very high	96.8	Very high	188 Å²	188	70.8 Å²	70.8	71%	0.712	38%	0.382	S	S	*	.	B	Isolated β-bridge	trans	-134	82.8	-178.6	-69	93.8	0	0	0	108.3	G116 S117 T122	G116-W120 CarbonylContact C-O 3.6Å; G116-W120 VanDerWaalsContact CA-O 3.23Å; G116-W120 WeakPolarHBondContact CA-O 3.5Å; S117-W120 PolarHBondContact N-O 3.49Å; S117-W120 CarbonylContact O-C 3.52Å; S117-W120 PolarHBondContact O-N 3.26Å; S117-W120 PolarHBondContact OG-N 2.96Å; W120-T122 PolarHBondContact O-N 3.08Å; W120-T122 VanDerWaalsContact O-N 3.14Å; W120-T122 VanDerWaalsContact O-O 3.13Å
121	P	92.4	Very high	96.8	Very high	99 Å²	99	73.3 Å²	73.3	64%	0.643	39%	0.392	S	S	*	.			trans	-72.2	-7.6	-167.4	28.2	-35.9	0	0	0	114.1	A134	P121-A134 WeakPolarHBondContact O-CA 3.45Å
122	T	96.8	Very high	96.8	Very high	54 Å²	54	75.2 Å²	75.2	33%	0.331	40%	0.4	S	S	.	.			trans	-92.2	147.1	170.6	56.9	0	0	0	0	110.7	G116 W120 Q132 F133	G116-T122 WeakPolarHBondContact CA-O 3.36Å; W120-T122 PolarHBondContact O-N 3.08Å; W120-T122 VanDerWaalsContact O-N 3.14Å; W120-T122 VanDerWaalsContact O-O 3.13Å; T122-Q132 HydrophobicContact CG2-CB 4.24Å; T122-Q132 PolarHBondContact OG1-OE1 2.99Å; T122-F133 CarbonylContact C-O 3.47Å; T122-F133 WeakPolarHBondContact CA-O 3.31Å
123	G	96.5	Very high	96.7	Very high	12 Å²	12	77.8 Å²	77.8	12%	0.124	41%	0.411	C	S	.	.			trans	-164	2.3	-171.8	0	0	0	0	0	116.5	H114 F133 A134	H114-G123 CarbonylContact C-O 3.4Å; G123-F133 PolarHBondContact N-O 2.8Å; G123-A134 PolarHBondContact N-O 3.07Å
124	S	98.4	Very high	96.7	Very high	4 Å²	4	77.6 Å²	77.6	3%	0.028	42%	0.423	C	S	.	.			trans	-65.7	145.9	167.6	67.9	0	0	0	0	110.6	H126 Q132 F133	S124-H126 PolarHBondContact OG-O 3.43Å; S124-Q132 WeakPolarHBondContact O-CG 3.49Å; S124-Q132 PolarHBondContact O-NE2 2.67Å; S124-Q132 VanDerWaalsContact OG-CG 3.26Å; S124-Q132 WeakPolarHBondContact OG-CG 3.26Å; S124-F133 PolarHBondContact N-O 2.83Å; S124-F133 PolarHBondContact OG-N 3.26Å
125	E	98.3	Very high	96.7	Very high	63 Å²	63	79 Å²	79	29%	0.294	44%	0.438	S	S	.	.	S	Bend	trans	-79.2	-48.1	178.1	-59.7	-155.2	119.5	0	0	109.9	P50 H114 E136	P50-E125 HydrophobicContact CB-CB 3.73Å; P50-E125 VanDerWaalsContact CB-O 3.26Å; P50-E125 WeakPolarHBondContact CB-O 3.05Å; P50-E125 HydrophobicContact CG-CB 3.83Å; P50-E125 VanDerWaalsContact CG-O 3.3Å; P50-E125 WeakPolarHBondContact CG-O 3.4Å; H114-E125 HydrophobicContact CB-CG 3.79Å; H114-E125 VanDerWaalsContact CE1-CD 3.43Å; H114-E125 IonicContact CE1-OE1 2.64Å; H114-E125 PolarHBondContact CE1-OE1 3.26Å; H114-E125 IonicContact CE1-OE2 3.83Å; H114-E125 IonicContact CG-OE1 3.2Å; H114-E125 IonicContact ND1-OE1 3.83Å; H114-E125 PolarHBondContact ND1-OE1 2.77Å; H114-E125 IonicContact ND1-OE2 3.66Å; H114-E125 IonicContact NE2-OE2 3.02Å; E125-E136 PolarHBondContact N-OE2 2.89Å
126	H	98.6	Very high	96.7	Very high	49 Å²	49	73.8 Å²	73.8	23%	0.227	42%	0.42	C	S	.	.	S	Bend	trans	-76.6	153	173.8	-67.9	86.3	0	0	0	111.9	I51 S124 E136	I51-H126 PolarHBondContact N-CD2 3.49Å; I51-H126 PolarHBondContact O-CD2 3.11Å; S124-H126 PolarHBondContact OG-O 3.43Å; H126-E136 IonicContact CE1-OE1 3.49Å; H126-E136 IonicContact CG-OE1 3.91Å; H126-E136 IonicContact CG-OE2 3.95Å; H126-E136 PolarHBondContact N-OE2 3.02Å; H126-E136 IonicContact ND1-OE1 3.85Å; H126-E136 PolarHBondContact ND1-OE1 2.94Å; H126-E136 IonicContact ND1-OE2 3.65Å; H126-E136 PolarHBondContact ND1-OE2 3.35Å
127	L	98.4	Very high	96.8	Very high	51 Å²	51	76.8 Å²	76.8	27%	0.267	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	146.2	171.3	-66.5	81	0	0	0	109.5	I51 H52 I53 K131 Q132	I51-L127 PolarHBondContact O-N 3Å; H52-L127 HydrophobicContact CB-CB 4.31Å; I53-L127 WeakPolarHBondContact CB-O 3.18Å; I53-L127 PolarHBondContact N-O 2.93Å; L127-K131 WeakPolarHBondContact CA-O 3.37Å; L127-Q132 HydrophobicContact CG-CB 4.36Å
128	V	98.4	Very high	97	Very high	59 Å²	59	78 Å²	78	36%	0.358	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	118.5	170.9	-177.9	0	0	0	0	108	I53 S130 K131 F133	I53-V128 WeakPolarHBondContact O-CA 3.4Å; V128-S130 VanDerWaalsContact C-N 3.31Å; V128-S130 PolarHBondContact O-N 2.67Å; V128-K131 PolarHBondContact N-O 3Å; V128-K131 WeakPolarHBondContact O-CB 3.27Å; V128-K131 PolarHBondContact O-N 2.85Å; V128-F133 HydrophobicContact CB-CE2 4.34Å; V128-F133 HydrophobicContact CG2-CE2 4.33Å
129	D	98	Very high	97.2	Very high	81 Å²	81	75.6 Å²	75.6	43%	0.433	41%	0.412	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.3	50.7	-177.9	-59.5	-38.4	0	0	0	112.6	I53 S55 K131	I53-D129 PolarHBondContact O-N 3.07Å; S55-D129 WeakPolarHBondContact CB-OD1 3.15Å; S55-D129 WeakPolarHBondContact CB-OD2 3.36Å; S55-D129 PolarHBondContact N-OD1 2.86Å; S55-D129 VanDerWaalsContact OG-CG 3.29Å; S55-D129 PolarHBondContact OG-OD1 2.88Å; S55-D129 PolarHBondContact OG-OD2 2.94Å; D129-K131 PolarHBondContact O-N 2.79Å; D129-K131 VanDerWaalsContact O-N 3.07Å
130	S	97.1	Very high	97.3	Very high	90 Å²	90	71.9 Å²	71.9	63%	0.629	39%	0.393	S	S	*	.	T	Hydrogen-bonded Turn	trans	61	8.6	-176.2	-49.5	0	0	0	0	115	H52 V128	H52-S130 PolarHBondContact CE1-OG 2.94Å; H52-S130 PolarHBondContact NE2-N 2.78Å; V128-S130 VanDerWaalsContact C-N 3.31Å; V128-S130 PolarHBondContact O-N 2.67Å
131	K	97.7	Very high	97.6	Very high	125 Å²	125	65.5 Å²	65.5	54%	0.543	38%	0.376	S	S	.	.	B	Isolated β-bridge	trans	-94.1	122.3	177.4	-171.6	176.6	176.9	178	0	110.7	L127 V128 D129 F133	L127-K131 WeakPolarHBondContact CA-O 3.37Å; V128-K131 PolarHBondContact N-O 3Å; V128-K131 WeakPolarHBondContact O-CB 3.27Å; V128-K131 PolarHBondContact O-N 2.85Å; D129-K131 PolarHBondContact O-N 2.79Å; D129-K131 VanDerWaalsContact O-N 3.07Å; K131-F133 HydrophobicContact CD-CE1 4.14Å; K131-F133 HydrophobicContact CD-CZ 4.1Å; K131-F133 HydrophobicContact CG-CZ 4.37Å
132	Q	97.7	Very high	97.9	Very high	77 Å²	77	63.5 Å²	63.5	36%	0.36	36%	0.36	S	S	.	.			trans	-93.1	145.1	165.7	-159.1	178.4	27	0	0	109.5	T122 S124 L127	T122-Q132 HydrophobicContact CG2-CB 4.24Å; T122-Q132 PolarHBondContact OG1-OE1 2.99Å; S124-Q132 WeakPolarHBondContact O-CG 3.49Å; S124-Q132 PolarHBondContact O-NE2 2.67Å; S124-Q132 VanDerWaalsContact OG-CG 3.26Å; S124-Q132 WeakPolarHBondContact OG-CG 3.26Å; L127-Q132 HydrophobicContact CG-CB 4.36Å
133	F	97.9	Very high	97.9	Very high	91 Å²	91	64.1 Å²	64.1	40%	0.399	36%	0.362	S	S	.	.			trans	-104.5	170.1	178.8	-61.1	-91.8	0	0	0	110.7	T122 G123 S124 V128 K131 A135	T122-F133 CarbonylContact C-O 3.47Å; T122-F133 WeakPolarHBondContact CA-O 3.31Å; G123-F133 PolarHBondContact N-O 2.8Å; S124-F133 PolarHBondContact N-O 2.83Å; S124-F133 PolarHBondContact OG-N 3.26Å; V128-F133 HydrophobicContact CB-CE2 4.34Å; V128-F133 HydrophobicContact CG2-CE2 4.33Å; K131-F133 HydrophobicContact CD-CE1 4.14Å; K131-F133 HydrophobicContact CD-CZ 4.1Å; K131-F133 HydrophobicContact CG-CZ 4.37Å; F133-A135 VanDerWaalsContact C-N 3.27Å; F133-A135 PolarHBondContact O-N 2.73Å
134	A	97.6	Very high	98	Very high	71 Å²	71	67.6 Å²	67.6	59%	0.587	38%	0.378	S	S	*	.	S	Bend	trans	-63.4	-33.3	-176.4	0	0	0	0	0	113.4	P121 G123	P121-A134 WeakPolarHBondContact O-CA 3.45Å; G123-A134 PolarHBondContact N-O 3.07Å
135	A	98	Very high	98	Very high	50 Å²	50	72.1 Å²	72.1	41%	0.413	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.9	164.2	-179.7	0	0	0	0	0	110.7	H114 W115 F133	H114-A135 CarbonylContact O-C 3.5Å; H114-A135 WeakPolarHBondContact O-CA 3.44Å; H114-A135 WeakPolarHBondContact O-CB 3.49Å; W115-A135 HydrophobicContact CB-CB 4.16Å; F133-A135 VanDerWaalsContact C-N 3.27Å; F133-A135 PolarHBondContact O-N 2.73Å
136	E	98.7	Very high	98	Very high	30 Å²	30	72.8 Å²	72.8	14%	0.14	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	147	170.1	-174.9	170.4	148	0	0	110.1	F113 H114 E125 H126 N138	F113-E136 WeakPolarHBondContact CA-O 3.46Å; H114-E136 HydrophobicContact CB-CB 4.47Å; H114-E136 PolarHBondContact N-O 2.93Å; H114-E136 PolarHBondContact O-N 2.8Å; E125-E136 PolarHBondContact N-OE2 2.89Å; H126-E136 IonicContact CE1-OE1 3.49Å; H126-E136 IonicContact CG-OE1 3.91Å; H126-E136 IonicContact CG-OE2 3.95Å; H126-E136 PolarHBondContact N-OE2 3.02Å; H126-E136 IonicContact ND1-OE1 3.85Å; H126-E136 PolarHBondContact ND1-OE1 2.94Å; H126-E136 IonicContact ND1-OE2 3.65Å; H126-E136 PolarHBondContact ND1-OE2 3.35Å; E136-N138 PolarHBondContact OE1-ND2 3.1Å; E136-N138 VanDerWaalsContact OE1-ND2 3.08Å
137	V	98.3	Very high	97.9	Very high	86 Å²	86	74.8 Å²	74.8	52%	0.521	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	131.5	174.6	-176.4	0	0	0	0	108	L111 H112 F113	L111-V137 HydrophobicContact CB-CG1 4.46Å; L111-V137 HydrophobicContact CD1-CG1 4.37Å; H112-V137 WeakPolarHBondContact O-CA 3.29Å; F113-V137 HydrophobicContact CD1-CG2 3.63Å; F113-V137 HydrophobicContact CE1-CG1 4.31Å; F113-V137 HydrophobicContact CE1-CG2 3.58Å
138	N	97.4	Very high	97.9	Very high	87 Å²	87	77 Å²	77	47%	0.465	44%	0.441	S	S	.	.			trans	-124.5	0	-177.8	-59.9	88.8	0	0	0	110.6	L111 H112 H114 E136	L111-N138 CarbonylContact C-O 3.51Å; L111-N138 WeakPolarHBondContact CA-O 3.5Å; H112-N138 WeakPolarHBondContact CE1-CB 3.48Å; H112-N138 PolarHBondContact N-O 3.42Å; H112-N138 PolarHBondContact ND1-O 2.96Å; H112-N138 PolarHBondContact O-N 2.88Å; H114-N138 PolarHBondContact CD2-OD1 3.11Å; H114-N138 VanDerWaalsContact CD2-OD1 3.29Å; E136-N138 PolarHBondContact OE1-ND2 3.1Å; E136-N138 VanDerWaalsContact OE1-ND2 3.08Å

Retrieved 138 of 138 residues in 79.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).