A0A096MJD7_RAT Loading...

Phosphatidylinositol N-acetylglucosaminyltransferase subunit C

AlphaFold DB , UniProt , Accession A0A096MJD7, Species RAT (Rattus norvegicus, Rat), Gene Pigc, Length 133 aa.

						>A0A096MJD7_RAT|A0A096MJD7|Pigc
MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFITFTYGF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.5	Very low	47.5	Very low	246 Å²	246	144.3 Å²	144.3	100%	1.212	82%	0.821	S	S	*	*				0	115.3	0	-86.3	168.1	170.7	0	0	107.6
2	C	44	Very low	49.9	Very low	130 Å²	130	140.1 Å²	140.1	88%	0.878	80%	0.8	S	S	*	*			trans	-77	131.2	-173.4	-55.2	0	0	0	0	110.3
3	A	42.4	Very low	52.5	Low	101 Å²	101	140.7 Å²	140.7	84%	0.835	79%	0.788	S	S	*	*			trans	-135.6	79.7	159	0	0	0	0	0	107.1	H5	A3-H5 PolarHBondContact O-N 3.12Å
4	Q	44.1	Very low	54.9	Low	183 Å²	183	135.1 Å²	135.1	86%	0.855	75%	0.749	S	S	*	*			trans	-74.5	99.4	164.9	-76.4	173.1	-38.7	0	0	106.5	V6	Q4-V6 PolarHBondContact O-N 2.94Å; Q4-V6 VanDerWaalsContact O-N 3.13Å
5	H	41.6	Very low	56.8	Low	181 Å²	181	133.5 Å²	133.5	84%	0.838	73%	0.733	S	S	*	*			trans	-72.1	102	164.6	-139.4	-80.5	0	0	0	105.9	A3 A7	A3-H5 PolarHBondContact O-N 3.12Å; H5-A7 PolarHBondContact O-N 3.13Å
6	V	49.8	Very low	58.4	Low	131 Å²	131	133.6 Å²	133.6	79%	0.794	72%	0.724	S	S	*	*			trans	-67.9	90.1	167.7	178.9	0	0	0	0	105.4	Q4 D8	Q4-V6 PolarHBondContact O-N 2.94Å; Q4-V6 VanDerWaalsContact O-N 3.13Å; V6-D8 PolarHBondContact O-N 3.22Å
7	A	47.7	Very low	60	Low	72 Å²	72	129.8 Å²	129.8	60%	0.595	71%	0.706	S	S	*	*			trans	-66.2	114	165.6	0	0	0	0	0	105.8	H5 T9	H5-A7 PolarHBondContact O-N 3.13Å; A7-T9 PolarHBondContact O-N 2.89Å
8	D	42.1	Very low	61.2	Low	139 Å²	139	130.4 Å²	130.4	74%	0.743	71%	0.708	S	S	*	*			trans	-41.4	108	163.3	-175.4	31.2	0	0	0	107.9	V6 S10	V6-D8 PolarHBondContact O-N 3.22Å; D8-S10 PolarHBondContact O-N 2.75Å
9	T	48.1	Very low	62.3	Low	132 Å²	132	134.7 Å²	134.7	81%	0.81	71%	0.714	S	S	*	*			trans	-74.5	67.3	177.7	51.6	0	0	0	0	107.5	A7 E11	A7-T9 PolarHBondContact O-N 2.89Å; T9-E11 PolarHBondContact O-N 2.92Å; T9-E11 VanDerWaalsContact O-N 3.12Å
10	S	58	Low	63.5	Low	85 Å²	85	133.6 Å²	133.6	59%	0.594	71%	0.705	S	S	*	*			trans	-55.4	114.2	153	53.4	0	0	0	0	105.4	D8 V12	D8-S10 PolarHBondContact O-N 2.75Å; S10-V12 PolarHBondContact O-N 2.87Å
11	E	68.7	Low	64.4	Low	187 Å²	187	139.1 Å²	139.1	87%	0.874	72%	0.716	S	S	*	*			trans	-50.6	112.8	176.2	-73.3	-173.9	153.6	0	0	108	T9 K13	T9-E11 PolarHBondContact O-N 2.92Å; T9-E11 VanDerWaalsContact O-N 3.12Å; E11-K13 PolarHBondContact O-N 3.19Å
12	V	76	Confident	66.8	Low	94 Å²	94	129.6 Å²	129.6	57%	0.57	67%	0.669	S	S	*	*			trans	-67.6	102.8	179.7	-179.8	0	0	0	0	106.5	S10 P23 F24	S10-V12 PolarHBondContact O-N 2.87Å; V12-P23 HydrophobicContact CB-CG 4.31Å; V12-P23 HydrophobicContact CG1-CG 3.72Å; V12-F24 HydrophobicContact CG1-CE2 4.35Å; V12-F24 WeakPolarHBondContact O-CZ 3.32Å
13	K	84.1	Confident	69	Low	148 Å²	148	128.3 Å²	128.3	64%	0.643	66%	0.658	S	S	*	*			trans	-83.6	134.7	178.1	-168.3	176.8	-177.1	176.1	0	109.3	E11 Q15	E11-K13 PolarHBondContact O-N 3.19Å; K13-Q15 PolarHBondContact O-N 3.48Å
14	W	85	Confident	71.1	Confident	63 Å²	63	126.1 Å²	126.1	24%	0.239	63%	0.63	C	S	.	*			trans	-57	136.7	172.3	179.2	90.1	0	0	0	110.9	K16 F24 Y28 D30	W14-K16 HydrophobicContact CH2-CB 3.63Å; W14-K16 HydrophobicContact CH2-CD 4.41Å; W14-K16 HydrophobicContact CH2-CG 3.79Å; W14-K16 HydrophobicContact CZ2-CB 4.48Å; W14-K16 HydrophobicContact CZ3-CB 3.78Å; W14-K16 HydrophobicContact CZ3-CG 4.36Å; W14-F24 VanDerWaalsContact CA-CE2 3.41Å; W14-F24 HydrophobicContact CB-CD1 4.4Å; W14-F24 HydrophobicContact CB-CD2 4Å; W14-F24 HydrophobicContact CB-CE1 4.08Å; W14-F24 HydrophobicContact CB-CE2 3.67Å; W14-F24 HydrophobicContact CB-CG 4.37Å; W14-F24 HydrophobicContact CB-CZ 3.71Å; W14-F24 AromaticContact CD1-CD2 3.71Å; W14-F24 AromaticContact CD1-CG 3.8Å; W14-F24 HydrophobicContact CG-CD2 4.27Å; W14-F24 HydrophobicContact CG-CE2 4.4Å; W14-F24 HydrophobicContact CG-CG 4.5Å; W14-Y28 HydrophobicContact CB-CD1 4.23Å; W14-Y28 HydrophobicContact CB-CE1 3.69Å; W14-Y28 AromaticContact CD1-CD1 3.36Å; W14-Y28 AromaticContact CD1-CE1 3.74Å; W14-Y28 HydrophobicContact CD2-CD1 4.32Å; W14-Y28 HydrophobicContact CD2-CE1 4.26Å; W14-Y28 AromaticContact CG-CD1 3.72Å; W14-Y28 HydrophobicContact CG-CD1 3.72Å; W14-Y28 AromaticContact CG-CE1 3.61Å; W14-Y28 HydrophobicContact CG-CE1 3.61Å; W14-Y28 AromaticContact NE1-CD1 3.72Å; W14-D30 HydrophobicContact CD2-CB 4.3Å; W14-D30 HydrophobicContact CE3-CB 3.59Å; W14-D30 HydrophobicContact CZ3-CB 3.7Å
15	Q	83.8	Confident	73.2	Confident	110 Å²	110	121.9 Å²	121.9	51%	0.514	62%	0.618	S	S	.	*			trans	-122.9	140.7	177.9	-58.1	-171.7	10.3	0	0	110.8	K13 V17 Q22	K13-Q15 PolarHBondContact O-N 3.48Å; Q15-V17 HydrophobicContact CB-CG2 4.09Å; Q15-V17 PolarHBondContact O-N 3.47Å; Q15-Q22 PolarHBondContact O-NE2 3.47Å; Q15-Q22 PolarHBondContact O-OE1 2.97Å
16	K	83.1	Confident	75.2	Confident	136 Å²	136	121.5 Å²	121.5	59%	0.591	62%	0.623	S	S	*	*			trans	-80.8	64.6	179.2	-163.6	177.9	-169.6	175.9	0	111.2	W14 E36	W14-K16 HydrophobicContact CH2-CB 3.63Å; W14-K16 HydrophobicContact CH2-CD 4.41Å; W14-K16 HydrophobicContact CH2-CG 3.79Å; W14-K16 HydrophobicContact CZ2-CB 4.48Å; W14-K16 HydrophobicContact CZ3-CB 3.78Å; W14-K16 HydrophobicContact CZ3-CG 4.36Å; K16-E36 IonicContact NZ-OE2 2.78Å; K16-E36 PolarHBondContact NZ-OE2 2.79Å
17	V	84.4	Confident	76.8	Confident	68 Å²	68	122.7 Å²	122.7	41%	0.412	63%	0.625	S	S	.	*			trans	-116.3	131	-179.9	-178.6	0	0	0	0	108.9	Q15 Y19 E20	Q15-V17 HydrophobicContact CB-CG2 4.09Å; Q15-V17 PolarHBondContact O-N 3.47Å; V17-Y19 PolarHBondContact O-N 3.36Å; V17-E20 HydrophobicContact CB-CB 4.11Å; V17-E20 HydrophobicContact CG1-CB 3.73Å
18	L	82.2	Confident	78.7	Confident	141 Å²	141	123.5 Å²	123.5	74%	0.738	61%	0.613	S	S	*	*	S	Bend	trans	-72	-30	-168.2	-173.1	61.5	0	0	0	114.5
19	Y	82.8	Confident	80.6	Confident	212 Å²	212	121.1 Å²	121.1	83%	0.831	60%	0.603	S	S	*	*	S	Bend	trans	-125.8	8.3	-169.3	-61.1	-66.7	0	0	0	114.7	V17	V17-Y19 PolarHBondContact O-N 3.36Å
20	E	85.3	Confident	82.4	Confident	113 Å²	113	116.6 Å²	116.6	53%	0.528	57%	0.574	S	S	.	*			trans	-91.9	131.9	-178.4	-169.1	165.3	-172.4	0	0	110.9	V17 Q22	V17-E20 HydrophobicContact CB-CB 4.11Å; V17-E20 HydrophobicContact CG1-CB 3.73Å; E20-Q22 PolarHBondContact O-N 2.93Å
21	R	82.5	Confident	83.7	Confident	249 Å²	249	120.9 Å²	120.9	94%	0.94	59%	0.585	S	S	*	*			trans	-75.2	115.2	176.5	-83.4	-173.9	167.5	178.7	-2.9	109.7
22	Q	87.4	Confident	84.2	Confident	47 Å²	47	118.6 Å²	118.6	22%	0.22	57%	0.568	C	S	.	*			trans	-120.5	154.5	179.4	-59.4	176.6	49	0	0	110.8	Q15 E20 F24	Q15-Q22 PolarHBondContact O-NE2 3.47Å; Q15-Q22 PolarHBondContact O-OE1 2.97Å; E20-Q22 PolarHBondContact O-N 2.93Å; Q22-F24 HydrophobicContact CB-CD2 3.86Å; Q22-F24 PolarHBondContact O-N 3.32Å
23	P	89.6	Confident	84.6	Confident	102 Å²	102	118.1 Å²	118.1	66%	0.662	56%	0.558	S	S	*	*	S	Bend	trans	-79.1	44.7	-179	35.2	-37.4	0	0	0	112.5	V12	V12-P23 HydrophobicContact CB-CG 4.31Å; V12-P23 HydrophobicContact CG1-CG 3.72Å
24	F	86.9	Confident	84.5	Confident	56 Å²	56	117 Å²	117	25%	0.246	56%	0.559	C	S	.	*	S	Bend	trans	-123.6	147.1	177.7	-63.6	-82.9	0	0	0	109.6	V12 W14 Q22 Y28	V12-F24 HydrophobicContact CG1-CE2 4.35Å; V12-F24 WeakPolarHBondContact O-CZ 3.32Å; W14-F24 VanDerWaalsContact CA-CE2 3.41Å; W14-F24 HydrophobicContact CB-CD1 4.4Å; W14-F24 HydrophobicContact CB-CD2 4Å; W14-F24 HydrophobicContact CB-CE1 4.08Å; W14-F24 HydrophobicContact CB-CE2 3.67Å; W14-F24 HydrophobicContact CB-CG 4.37Å; W14-F24 HydrophobicContact CB-CZ 3.71Å; W14-F24 AromaticContact CD1-CD2 3.71Å; W14-F24 AromaticContact CD1-CG 3.8Å; W14-F24 HydrophobicContact CG-CD2 4.27Å; W14-F24 HydrophobicContact CG-CE2 4.4Å; W14-F24 HydrophobicContact CG-CG 4.5Å; Q22-F24 HydrophobicContact CB-CD2 3.86Å; Q22-F24 PolarHBondContact O-N 3.32Å; F24-Y28 HydrophobicContact CB-CD1 4.26Å; F24-Y28 HydrophobicContact CB-CG 4.14Å; F24-Y28 AromaticContact CD1-CD1 3.94Å; F24-Y28 HydrophobicContact CD1-CD1 3.94Å; F24-Y28 HydrophobicContact CD1-CD2 4.19Å; F24-Y28 AromaticContact CD1-CE1 3.97Å; F24-Y28 HydrophobicContact CD1-CE1 3.97Å; F24-Y28 HydrophobicContact CD1-CE2 4.22Å; F24-Y28 HydrophobicContact CD1-CG 4.04Å; F24-Y28 HydrophobicContact CE1-CE1 4.26Å; F24-Y28 HydrophobicContact CG-CD1 4.22Å; F24-Y28 HydrophobicContact CG-CG 4.41Å
25	P	87.8	Confident	84.3	Confident	93 Å²	93	120.7 Å²	120.7	60%	0.604	58%	0.579	S	S	*	*			trans	-65.1	151	175.4	25.2	-29.9	0	0	0	110.8	N27 Y28	P25-N27 PolarHBondContact O-N 3.25Å; P25-Y28 WeakPolarHBondContact O-CB 3.42Å; P25-Y28 PolarHBondContact O-N 3.37Å
26	D	83.7	Confident	84.1	Confident	173 Å²	173	120.7 Å²	120.7	93%	0.925	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	-27.6	-177.2	-99.5	15.7	0	0	0	114.2
27	N	84.9	Confident	84	Confident	157 Å²	157	118.3 Å²	118.3	84%	0.84	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	7.6	179	-66.7	-21	0	0	0	113.6	P25 V29	P25-N27 PolarHBondContact O-N 3.25Å; N27-V29 PolarHBondContact O-N 2.98Å
28	Y	86.1	Confident	83.7	Confident	88 Å²	88	124 Å²	124	35%	0.345	59%	0.586	S	S	.	*			trans	-72.3	128.4	178.8	-173.4	-91.9	0	0	0	110.8	W14 F24 P25	W14-Y28 HydrophobicContact CB-CD1 4.23Å; W14-Y28 HydrophobicContact CB-CE1 3.69Å; W14-Y28 AromaticContact CD1-CD1 3.36Å; W14-Y28 AromaticContact CD1-CE1 3.74Å; W14-Y28 HydrophobicContact CD2-CD1 4.32Å; W14-Y28 HydrophobicContact CD2-CE1 4.26Å; W14-Y28 AromaticContact CG-CD1 3.72Å; W14-Y28 HydrophobicContact CG-CD1 3.72Å; W14-Y28 AromaticContact CG-CE1 3.61Å; W14-Y28 HydrophobicContact CG-CE1 3.61Å; W14-Y28 AromaticContact NE1-CD1 3.72Å; F24-Y28 HydrophobicContact CB-CD1 4.26Å; F24-Y28 HydrophobicContact CB-CG 4.14Å; F24-Y28 AromaticContact CD1-CD1 3.94Å; F24-Y28 HydrophobicContact CD1-CD1 3.94Å; F24-Y28 HydrophobicContact CD1-CD2 4.19Å; F24-Y28 AromaticContact CD1-CE1 3.97Å; F24-Y28 HydrophobicContact CD1-CE1 3.97Å; F24-Y28 HydrophobicContact CD1-CE2 4.22Å; F24-Y28 HydrophobicContact CD1-CG 4.04Å; F24-Y28 HydrophobicContact CE1-CE1 4.26Å; F24-Y28 HydrophobicContact CG-CD1 4.22Å; F24-Y28 HydrophobicContact CG-CG 4.41Å; P25-Y28 WeakPolarHBondContact O-CB 3.42Å; P25-Y28 PolarHBondContact O-N 3.37Å
29	V	81.9	Confident	83.3	Confident	89 Å²	89	126.1 Å²	126.1	54%	0.539	59%	0.589	S	S	.	*			trans	-123.3	139.2	168.8	-66.9	0	0	0	0	108.7	N27 F33	N27-V29 PolarHBondContact O-N 2.98Å; V29-F33 HydrophobicContact CB-CB 4.42Å; V29-F33 HydrophobicContact CB-CG 4.47Å
30	D	87.1	Confident	82.6	Confident	37 Å²	37	122 Å²	122	20%	0.198	58%	0.582	C	S	.	*			trans	-66.3	151.6	176.2	-173.7	29.6	0	0	0	111.4	W14 R32 F33	W14-D30 HydrophobicContact CD2-CB 4.3Å; W14-D30 HydrophobicContact CE3-CB 3.59Å; W14-D30 HydrophobicContact CZ3-CB 3.7Å; D30-R32 PolarHBondContact O-N 3.19Å; D30-R32 WeakPolarHBondContact OD2-CB 3.17Å; D30-R32 WeakPolarHBondContact OD2-CG 3.32Å; D30-F33 WeakPolarHBondContact O-CB 3.43Å; D30-F33 PolarHBondContact O-N 2.9Å
31	Q	83.9	Confident	81.9	Confident	175 Å²	175	120.6 Å²	120.6	82%	0.818	58%	0.577	S	S	*	*	G	3₁₀ helix	trans	-60.5	-30	178.6	-64.9	-176.8	-6.3	0	0	111.8	F33	Q31-F33 PolarHBondContact O-N 3.47Å
32	R	80.6	Confident	81.5	Confident	140 Å²	140	118.5 Å²	118.5	53%	0.528	57%	0.571	S	S	.	*	G	3₁₀ helix	trans	-76.5	-8	178	-48.9	-172.7	97.7	175.4	13.6	113.5	D30 L34 E35 E36	D30-R32 PolarHBondContact O-N 3.19Å; D30-R32 WeakPolarHBondContact OD2-CB 3.17Å; D30-R32 WeakPolarHBondContact OD2-CG 3.32Å; R32-L34 VanDerWaalsContact C-N 3.26Å; R32-L34 PolarHBondContact O-N 2.86Å; R32-E35 IonicContact NE-OE2 3.81Å; R32-E35 PolarHBondContact NE-OE2 3.49Å; R32-E35 WeakPolarHBondContact O-CA 3.09Å; R32-E35 WeakPolarHBondContact O-CB 3.48Å; R32-E35 PolarHBondContact O-N 3.26Å; R32-E36 PolarHBondContact O-N 3.37Å
33	F	83.5	Confident	80.8	Confident	83 Å²	83	119 Å²	119	36%	0.364	58%	0.583	S	S	.	*	G	3₁₀ helix	trans	-53.5	-44.7	179.8	172.8	-101.9	0	0	0	112.1	V29 D30 Q31 E35 E36 L37	V29-F33 HydrophobicContact CB-CB 4.42Å; V29-F33 HydrophobicContact CB-CG 4.47Å; D30-F33 WeakPolarHBondContact O-CB 3.43Å; D30-F33 PolarHBondContact O-N 2.9Å; Q31-F33 PolarHBondContact O-N 3.47Å; F33-E35 VanDerWaalsContact C-N 3.34Å; F33-E36 PolarHBondContact O-N 2.82Å; F33-L37 HydrophobicContact CE1-CD1 4.3Å; F33-L37 HydrophobicContact CZ-CD2 4.42Å; F33-L37 PolarHBondContact O-N 3.48Å
34	L	82.2	Confident	79.8	Confident	125 Å²	125	124 Å²	124	65%	0.654	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.3	-28.2	178.4	-62.8	-179.8	0	0	0	112.3	R32 E36 L37	R32-L34 VanDerWaalsContact C-N 3.26Å; R32-L34 PolarHBondContact O-N 2.86Å; L34-E36 VanDerWaalsContact C-N 3.31Å; L34-L37 HydrophobicContact CD2-CD1 3.58Å; L34-L37 WeakPolarHBondContact O-CB 3.47Å; L34-L37 PolarHBondContact O-N 3.02Å
35	E	81.1	Confident	79.2	Confident	140 Å²	140	130.5 Å²	130.5	65%	0.654	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68	-33.8	173.5	-55.5	179.5	165.6	0	0	111.2	R32 F33 L37	R32-E35 IonicContact NE-OE2 3.81Å; R32-E35 PolarHBondContact NE-OE2 3.49Å; R32-E35 WeakPolarHBondContact O-CA 3.09Å; R32-E35 WeakPolarHBondContact O-CB 3.48Å; R32-E35 PolarHBondContact O-N 3.26Å; F33-E35 VanDerWaalsContact C-N 3.34Å; E35-L37 VanDerWaalsContact C-N 3.3Å; E35-L37 PolarHBondContact O-N 2.91Å
36	E	79.3	Confident	78.4	Confident	110 Å²	110	134.4 Å²	134.4	51%	0.514	62%	0.62	S	S	.	*	S	Bend	trans	-77.3	-11.7	176	-70.7	-176.4	179.2	0	0	113.7	K16 R32 F33 L34 R38	K16-E36 IonicContact NZ-OE2 2.78Å; K16-E36 PolarHBondContact NZ-OE2 2.79Å; R32-E36 PolarHBondContact O-N 3.37Å; F33-E36 PolarHBondContact O-N 2.82Å; L34-E36 VanDerWaalsContact C-N 3.31Å; E36-R38 VanDerWaalsContact C-N 3.32Å; E36-R38 PolarHBondContact O-N 2.8Å
37	L	81.5	Confident	78.3	Confident	87 Å²	87	132.7 Å²	132.7	46%	0.455	61%	0.607	S	S	.	*			trans	-70.7	86.8	178.4	-75.4	-179.5	0	0	0	111.2	F33 L34 E35 K39	F33-L37 HydrophobicContact CE1-CD1 4.3Å; F33-L37 HydrophobicContact CZ-CD2 4.42Å; F33-L37 PolarHBondContact O-N 3.48Å; L34-L37 HydrophobicContact CD2-CD1 3.58Å; L34-L37 WeakPolarHBondContact O-CB 3.47Å; L34-L37 PolarHBondContact O-N 3.02Å; E35-L37 VanDerWaalsContact C-N 3.3Å; E35-L37 PolarHBondContact O-N 2.91Å; L37-K39 PolarHBondContact O-N 3.32Å
38	R	77.6	Confident	78.2	Confident	187 Å²	187	133.4 Å²	133.4	71%	0.706	60%	0.599	S	S	*	*			trans	-79.4	103.8	169.2	-63.4	-165.7	76.5	176.3	5.1	110.4	E36 I41	E36-R38 VanDerWaalsContact C-N 3.32Å; E36-R38 PolarHBondContact O-N 2.8Å; R38-I41 HydrophobicContact CB-CD1 3.45Å; R38-I41 VanDerWaalsContact CB-CD1 3.45Å; R38-I41 HydrophobicContact CB-CG1 3.55Å; R38-I41 HydrophobicContact CG-CD1 4.15Å; R38-I41 HydrophobicContact CG-CG1 4.44Å
39	K	73.8	Confident	78.4	Confident	185 Å²	185	137.6 Å²	137.6	80%	0.804	61%	0.614	S	S	*	*			trans	-85.3	132.7	170.6	-67	-179.6	-176.2	173.1	0	110.3	L37 I41	L37-K39 PolarHBondContact O-N 3.32Å; K39-I41 PolarHBondContact O-N 3.37Å
40	N	68.7	Low	78.5	Confident	127 Å²	127	135.9 Å²	135.9	68%	0.679	61%	0.61	S	S	*	*			trans	55.2	48.4	166.1	-152.2	-0.6	0	0	0	115.1	Y42 A43	N40-Y42 PolarHBondContact O-N 3.4Å; N40-Y42 VanDerWaalsContact O-N 3.16Å; N40-A43 PolarHBondContact O-N 3.16Å; N40-A43 WeakPolarHBondContact OD1-CB 3.42Å; N40-A43 PolarHBondContact OD1-N 3.3Å
41	I	69.3	Low	78.5	Confident	82 Å²	82	137.6 Å²	137.6	42%	0.421	62%	0.621	S	S	.	*	T	Hydrogen-bonded Turn	trans	-58.4	-27.8	-179.8	-55.1	171.4	0	0	0	112.2	R38 K39	R38-I41 HydrophobicContact CB-CD1 3.45Å; R38-I41 VanDerWaalsContact CB-CD1 3.45Å; R38-I41 HydrophobicContact CB-CG1 3.55Å; R38-I41 HydrophobicContact CG-CD1 4.15Å; R38-I41 HydrophobicContact CG-CG1 4.44Å; K39-I41 PolarHBondContact O-N 3.37Å
42	Y	74.5	Confident	78.7	Confident	206 Å²	206	131.7 Å²	131.7	81%	0.808	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.6	23.8	-172.5	-57.8	-70.6	0	0	0	114	N40 R44	N40-Y42 PolarHBondContact O-N 3.4Å; N40-Y42 VanDerWaalsContact O-N 3.16Å; Y42-R44 PolarHBondContact O-N 3.08Å
43	A	72.4	Confident	79	Confident	57 Å²	57	131.7 Å²	131.7	47%	0.471	60%	0.601	S	S	.	*			trans	-60.9	106	175.8	0	0	0	0	0	111	N40 K45	N40-A43 PolarHBondContact O-N 3.16Å; N40-A43 WeakPolarHBondContact OD1-CB 3.42Å; N40-A43 PolarHBondContact OD1-N 3.3Å; A43-K45 PolarHBondContact O-N 3.33Å
44	R	69.1	Low	79.2	Confident	208 Å²	208	134.9 Å²	134.9	79%	0.785	62%	0.617	S	S	*	*			trans	-73.3	114.2	171.8	-90.3	175.1	-177.9	157	2.3	109.7	Y42 Y46	Y42-R44 PolarHBondContact O-N 3.08Å; R44-Y46 HydrophobicContact CB-CD2 4.27Å; R44-Y46 HydrophobicContact CB-CE2 3.89Å; R44-Y46 PolarHBondContact O-N 3.5Å
45	K	73.4	Confident	79.5	Confident	192 Å²	192	131.3 Å²	131.3	84%	0.835	60%	0.602	S	S	*	*			trans	-79.5	96.6	168.9	-64.8	-171.2	-179.8	-176.7	0	108.7	A43	A43-K45 PolarHBondContact O-N 3.33Å
46	Y	72.5	Confident	80.1	Confident	174 Å²	174	127.1 Å²	127.1	68%	0.682	59%	0.589	S	S	*	*			trans	-69.7	129.3	170.2	-75.9	-89.2	0	0	0	109.5	R44 Y48 V51	R44-Y46 HydrophobicContact CB-CD2 4.27Å; R44-Y46 HydrophobicContact CB-CE2 3.89Å; R44-Y46 PolarHBondContact O-N 3.5Å; Y46-Y48 PolarHBondContact O-N 3.05Å; Y46-V51 HydrophobicContact CD1-CG2 4.03Å; Y46-V51 HydrophobicContact CG-CG2 4.35Å
47	Q	81.6	Confident	80.7	Confident	137 Å²	137	126.1 Å²	126.1	64%	0.64	59%	0.59	S	S	*	*			trans	-72	117.7	170.6	-63.8	-61.4	-51.3	0	0	107.7	W49 A50 V51	Q47-W49 VanDerWaalsContact C-N 3.26Å; Q47-W49 PolarHBondContact O-N 3.18Å; Q47-A50 HydrophobicContact CB-CB 4.15Å; Q47-A50 WeakPolarHBondContact O-CB 3.47Å; Q47-A50 PolarHBondContact O-N 3.27Å; Q47-V51 PolarHBondContact O-N 3.38Å
48	Y	83	Confident	81.2	Confident	172 Å²	172	127.1 Å²	127.1	68%	0.675	60%	0.599	S	S	*	*	H	α-helix	trans	-49.7	-47.4	-176.2	176.5	-100.7	0	0	0	112.2	Y46 A50 V51 V52	Y46-Y48 PolarHBondContact O-N 3.05Å; Y48-A50 PolarHBondContact O-N 3.23Å; Y48-V51 PolarHBondContact O-N 3.21Å; Y48-V52 HydrophobicContact CD1-CG2 4.06Å; Y48-V52 HydrophobicContact CE1-CG2 3.66Å; Y48-V52 HydrophobicContact CE2-CG2 4.18Å; Y48-V52 HydrophobicContact CG-CG2 4.48Å; Y48-V52 WeakPolarHBondContact O-CG2 3.23Å; Y48-V52 PolarHBondContact O-N 2.98Å
49	W	88.5	Confident	82	Confident	176 Å²	176	122.9 Å²	122.9	67%	0.667	59%	0.59	S	S	*	*	H	α-helix	trans	-59.9	-41.3	179.5	-71.9	108.5	0	0	0	113.8	Q47 V51 V52 F53	Q47-W49 VanDerWaalsContact C-N 3.26Å; Q47-W49 PolarHBondContact O-N 3.18Å; W49-V51 VanDerWaalsContact C-N 3.3Å; W49-V51 PolarHBondContact O-N 3.33Å; W49-V52 PolarHBondContact O-N 2.9Å; W49-F53 HydrophobicContact CE3-CE2 4.42Å; W49-F53 WeakPolarHBondContact O-CD2 3.46Å; W49-F53 PolarHBondContact O-N 3.39Å
50	A	85.9	Confident	82.9	Confident	54 Å²	54	120.4 Å²	120.4	45%	0.446	58%	0.581	S	S	.	*	H	α-helix	trans	-61.6	-43.7	178	0	0	0	0	0	110.6	Q47 Y48 V52 F53 E54	Q47-A50 HydrophobicContact CB-CB 4.15Å; Q47-A50 WeakPolarHBondContact O-CB 3.47Å; Q47-A50 PolarHBondContact O-N 3.27Å; Y48-A50 PolarHBondContact O-N 3.23Å; A50-V52 VanDerWaalsContact C-N 3.33Å; A50-V52 PolarHBondContact O-N 3.26Å; A50-F53 PolarHBondContact O-N 3.33Å; A50-E54 VanDerWaalsContact O-CG 3.28Å; A50-E54 WeakPolarHBondContact O-CG 3.48Å; A50-E54 PolarHBondContact O-N 3.39Å
51	V	86.3	Confident	84.2	Confident	72 Å²	72	120.3 Å²	120.3	44%	0.436	58%	0.576	S	S	.	*	H	α-helix	trans	-64.5	-39.2	177.3	-176.8	0	0	0	0	111.4	Y46 Q47 Y48 W49 E54 S55	Y46-V51 HydrophobicContact CD1-CG2 4.03Å; Y46-V51 HydrophobicContact CG-CG2 4.35Å; Q47-V51 PolarHBondContact O-N 3.38Å; Y48-V51 PolarHBondContact O-N 3.21Å; W49-V51 VanDerWaalsContact C-N 3.3Å; W49-V51 PolarHBondContact O-N 3.33Å; V51-E54 PolarHBondContact O-N 2.99Å; V51-S55 VanDerWaalsContact O-CB 3.31Å; V51-S55 WeakPolarHBondContact O-CB 3.27Å; V51-S55 PolarHBondContact O-N 2.96Å; V51-S55 PolarHBondContact O-OG 2.89Å; V51-S55 VanDerWaalsContact O-OG 3.13Å
52	V	87.8	Confident	85.5	Confident	51 Å²	51	121.9 Å²	121.9	31%	0.309	59%	0.585	S	S	.	*	H	α-helix	trans	-61.7	-48.2	175.9	173	0	0	0	0	110.9	Y48 W49 A50 E54 S55 S56	Y48-V52 HydrophobicContact CD1-CG2 4.06Å; Y48-V52 HydrophobicContact CE1-CG2 3.66Å; Y48-V52 HydrophobicContact CE2-CG2 4.18Å; Y48-V52 HydrophobicContact CG-CG2 4.48Å; Y48-V52 WeakPolarHBondContact O-CG2 3.23Å; Y48-V52 PolarHBondContact O-N 2.98Å; W49-V52 PolarHBondContact O-N 2.9Å; A50-V52 VanDerWaalsContact C-N 3.33Å; A50-V52 PolarHBondContact O-N 3.26Å; V52-E54 PolarHBondContact O-N 3.5Å; V52-S55 WeakPolarHBondContact CA-OG 3.45Å; V52-S55 PolarHBondContact O-N 3.34Å; V52-S55 PolarHBondContact O-OG 3.27Å; V52-S56 WeakPolarHBondContact O-CB 3.47Å; V52-S56 PolarHBondContact O-N 2.91Å
53	F	87.1	Confident	86.4	Confident	141 Å²	141	115.3 Å²	115.3	62%	0.618	57%	0.569	S	S	*	*	H	α-helix	trans	-60.3	-45.5	177.4	-79.6	-67.3	0	0	0	112.3	W49 A50 S55 S56	W49-F53 HydrophobicContact CE3-CE2 4.42Å; W49-F53 WeakPolarHBondContact O-CD2 3.46Å; W49-F53 PolarHBondContact O-N 3.39Å; A50-F53 PolarHBondContact O-N 3.33Å; F53-S55 VanDerWaalsContact C-N 3.35Å; F53-S55 PolarHBondContact O-N 3.15Å; F53-S56 WeakPolarHBondContact O-CB 3.28Å; F53-S56 PolarHBondContact O-N 3.11Å; F53-S56 PolarHBondContact O-OG 2.94Å
54	E	87.1	Confident	87.5	Confident	150 Å²	150	116 Å²	116	70%	0.701	57%	0.57	S	S	*	*	H	α-helix	trans	-63.2	-41.2	177.6	-66.9	-63	150.9	0	0	111.7	A50 V51 V52 S56	A50-E54 VanDerWaalsContact O-CG 3.28Å; A50-E54 WeakPolarHBondContact O-CG 3.48Å; A50-E54 PolarHBondContact O-N 3.39Å; V51-E54 PolarHBondContact O-N 2.99Å; V52-E54 PolarHBondContact O-N 3.5Å; E54-S56 VanDerWaalsContact C-N 3.3Å; E54-S56 PolarHBondContact O-N 3.37Å
55	S	90.1	Very high	88.8	Confident	49 Å²	49	110.3 Å²	110.3	34%	0.343	56%	0.558	S	S	.	*	H	α-helix	trans	-71.3	-23.7	177.8	71.2	0	0	0	0	113.9	V51 V52 F53 V57 V58 I59	V51-S55 VanDerWaalsContact O-CB 3.31Å; V51-S55 WeakPolarHBondContact O-CB 3.27Å; V51-S55 PolarHBondContact O-N 2.96Å; V51-S55 PolarHBondContact O-OG 2.89Å; V51-S55 VanDerWaalsContact O-OG 3.13Å; V52-S55 WeakPolarHBondContact CA-OG 3.45Å; V52-S55 PolarHBondContact O-N 3.34Å; V52-S55 PolarHBondContact O-OG 3.27Å; F53-S55 VanDerWaalsContact C-N 3.35Å; F53-S55 PolarHBondContact O-N 3.15Å; S55-V57 PolarHBondContact O-N 3.47Å; S55-V58 PolarHBondContact O-N 2.87Å; S55-I59 PolarHBondContact O-N 3.4Å
56	S	91.9	Very high	89.9	Confident	52 Å²	52	104.4 Å²	104.4	36%	0.364	54%	0.54	S	S	.	.	H	α-helix	trans	-62.5	-30.8	-175.8	75.1	0	0	0	0	112.8	V52 F53 E54 V58 I59 Q60	V52-S56 WeakPolarHBondContact O-CB 3.47Å; V52-S56 PolarHBondContact O-N 2.91Å; F53-S56 WeakPolarHBondContact O-CB 3.28Å; F53-S56 PolarHBondContact O-N 3.11Å; F53-S56 PolarHBondContact O-OG 2.94Å; E54-S56 VanDerWaalsContact C-N 3.3Å; E54-S56 PolarHBondContact O-N 3.37Å; S56-V58 VanDerWaalsContact C-N 3.33Å; S56-V58 PolarHBondContact O-N 3.48Å; S56-I59 PolarHBondContact O-N 3.05Å; S56-Q60 WeakPolarHBondContact O-CB 3.47Å; S56-Q60 PolarHBondContact O-N 3.33Å
57	V	91.7	Very high	90.9	Very high	90 Å²	90	100 Å²	100	55%	0.545	53%	0.531	S	S	.	.	H	α-helix	trans	-61.8	-43.4	179	179.4	0	0	0	0	110.8	S55 Q60 Q61	S55-V57 PolarHBondContact O-N 3.47Å; V57-Q60 PolarHBondContact O-N 2.93Å; V57-Q61 WeakPolarHBondContact O-CG 3.37Å; V57-Q61 PolarHBondContact O-N 3.03Å
58	V	92.6	Very high	91.4	Very high	107 Å²	107	100 Å²	100	65%	0.648	53%	0.529	S	S	*	.	H	α-helix	trans	-67.9	-42	178.5	-178.6	0	0	0	0	110.5	S55 S56 Q60 Q61 L62	S55-V58 PolarHBondContact O-N 2.87Å; S56-V58 VanDerWaalsContact C-N 3.33Å; S56-V58 PolarHBondContact O-N 3.48Å; V58-Q60 VanDerWaalsContact C-N 3.31Å; V58-Q60 PolarHBondContact O-N 2.91Å; V58-Q61 PolarHBondContact O-N 3.01Å; V58-L62 PolarHBondContact O-N 3.28Å
59	I	94	Very high	92	Very high	99 Å²	99	95.8 Å²	95.8	51%	0.508	52%	0.521	S	S	.	.	H	α-helix	trans	-63	-39.8	177.8	-62.8	170.5	0	0	0	110.8	S55 S56 Q61 L62 C63	S55-I59 PolarHBondContact O-N 3.4Å; S56-I59 PolarHBondContact O-N 3.05Å; I59-Q61 PolarHBondContact O-N 3.47Å; I59-L62 PolarHBondContact O-N 3.44Å; I59-C63 WeakPolarHBondContact O-CB 3.09Å; I59-C63 PolarHBondContact O-N 2.99Å
60	Q	94.3	Very high	92.2	Very high	133 Å²	133	91 Å²	91	62%	0.621	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-44.5	177.3	-175.5	66.9	14.4	0	0	111.5	S56 V57 V58 C63 S64	S56-Q60 WeakPolarHBondContact O-CB 3.47Å; S56-Q60 PolarHBondContact O-N 3.33Å; V57-Q60 PolarHBondContact O-N 2.93Å; V58-Q60 VanDerWaalsContact C-N 3.31Å; V58-Q60 PolarHBondContact O-N 2.91Å; Q60-C63 PolarHBondContact O-N 3.21Å; Q60-S64 WeakPolarHBondContact O-CB 3.39Å; Q60-S64 PolarHBondContact O-N 3.43Å
61	Q	95.3	Very high	92.4	Very high	124 Å²	124	91.1 Å²	91.1	58%	0.579	50%	0.504	S	S	*	.	H	α-helix	trans	-65	-43.5	177.4	-66.1	-61.7	-14.3	0	0	111.3	V57 V58 I59 S64 V65	V57-Q61 WeakPolarHBondContact O-CG 3.37Å; V57-Q61 PolarHBondContact O-N 3.03Å; V58-Q61 PolarHBondContact O-N 3.01Å; I59-Q61 PolarHBondContact O-N 3.47Å; Q61-S64 WeakPolarHBondContact O-CB 3.34Å; Q61-S64 PolarHBondContact O-N 3.23Å; Q61-V65 WeakPolarHBondContact O-CG2 3.23Å; Q61-V65 PolarHBondContact O-N 3.43Å; Q61-V65 VanDerWaalsContact O-N 3.11Å
62	L	95.7	Very high	92.5	Very high	115 Å²	115	95.5 Å²	95.5	60%	0.602	51%	0.513	S	S	*	.	H	α-helix	trans	-60.8	-46.5	175.8	-172.8	70.8	0	0	0	111.6	V58 I59 S64 V65 C66	V58-L62 PolarHBondContact O-N 3.28Å; I59-L62 PolarHBondContact O-N 3.44Å; L62-S64 VanDerWaalsContact C-N 3.32Å; L62-S64 PolarHBondContact O-N 2.95Å; L62-V65 PolarHBondContact O-N 3.41Å; L62-C66 PolarHBondContact O-N 3.44Å; L62-C66 PolarHBondContact O-SG 3.12Å
63	C	95.3	Very high	92.7	Very high	69 Å²	69	100.7 Å²	100.7	47%	0.466	53%	0.527	S	S	.	.	H	α-helix	trans	-58.8	-42.3	175.4	-96.7	0	0	0	0	111.9	I59 Q60 V65 C66 V67	I59-C63 WeakPolarHBondContact O-CB 3.09Å; I59-C63 PolarHBondContact O-N 2.99Å; Q60-C63 PolarHBondContact O-N 3.21Å; C63-V65 VanDerWaalsContact C-N 3.35Å; C63-V65 PolarHBondContact O-N 3.41Å; C63-C66 PolarHBondContact O-N 2.9Å; C63-V67 WeakPolarHBondContact O-CB 3.44Å; C63-V67 VanDerWaalsContact O-CG2 3.29Å; C63-V67 WeakPolarHBondContact O-CG2 3.31Å; C63-V67 PolarHBondContact O-N 2.86Å
64	S	94.6	Very high	92.7	Very high	70 Å²	70	99.5 Å²	99.5	49%	0.49	52%	0.519	S	S	.	.	H	α-helix	trans	-57.7	-46.8	176.9	-173.3	0	0	0	0	111.7	Q60 Q61 L62 V67 F68	Q60-S64 WeakPolarHBondContact O-CB 3.39Å; Q60-S64 PolarHBondContact O-N 3.43Å; Q61-S64 WeakPolarHBondContact O-CB 3.34Å; Q61-S64 PolarHBondContact O-N 3.23Å; L62-S64 VanDerWaalsContact C-N 3.32Å; L62-S64 PolarHBondContact O-N 2.95Å; S64-V67 PolarHBondContact O-N 3.13Å; S64-F68 WeakPolarHBondContact O-CB 3.28Å; S64-F68 PolarHBondContact O-N 3.46Å
65	V	96.5	Very high	92.8	Very high	90 Å²	90	96.1 Å²	96.1	55%	0.545	50%	0.504	S	S	.	.	H	α-helix	trans	-63	-46.3	176.6	177.2	0	0	0	0	111.1	Q61 L62 C63 V67 F68 V69	Q61-V65 WeakPolarHBondContact O-CG2 3.23Å; Q61-V65 PolarHBondContact O-N 3.43Å; Q61-V65 VanDerWaalsContact O-N 3.11Å; L62-V65 PolarHBondContact O-N 3.41Å; C63-V65 VanDerWaalsContact C-N 3.35Å; C63-V65 PolarHBondContact O-N 3.41Å; V65-V67 PolarHBondContact O-N 2.88Å; V65-F68 PolarHBondContact O-N 3.3Å; V65-V69 WeakPolarHBondContact O-CG2 3.11Å; V65-V69 PolarHBondContact O-N 3.46Å
66	C	96.2	Very high	92.7	Very high	67 Å²	67	99.8 Å²	99.8	45%	0.453	52%	0.52	S	S	.	.	H	α-helix	trans	-60.5	-46.2	178.3	-68.2	0	0	0	0	112.1	L62 C63 F68 V69 V70	L62-C66 PolarHBondContact O-N 3.44Å; L62-C66 PolarHBondContact O-SG 3.12Å; C63-C66 PolarHBondContact O-N 2.9Å; C66-F68 VanDerWaalsContact C-N 3.33Å; C66-F68 PolarHBondContact O-N 2.93Å; C66-V69 PolarHBondContact O-N 2.78Å; C66-V70 VanDerWaalsContact O-CG2 3.27Å; C66-V70 WeakPolarHBondContact O-CG2 3.11Å; C66-V70 PolarHBondContact O-N 2.86Å
67	V	93.4	Very high	92.6	Very high	82 Å²	82	102.6 Å²	102.6	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-62.1	-42.4	178.6	168.6	0	0	0	0	110.8	C63 S64 V65 V69 V70 I71	C63-V67 WeakPolarHBondContact O-CB 3.44Å; C63-V67 VanDerWaalsContact O-CG2 3.29Å; C63-V67 WeakPolarHBondContact O-CG2 3.31Å; C63-V67 PolarHBondContact O-N 2.86Å; S64-V67 PolarHBondContact O-N 3.13Å; V65-V67 PolarHBondContact O-N 2.88Å; V67-V69 PolarHBondContact O-N 3.41Å; V67-V70 PolarHBondContact O-N 3.4Å; V67-I71 HydrophobicContact CG1-CD1 3.63Å; V67-I71 HydrophobicContact CG1-CG1 4.3Å; V67-I71 WeakPolarHBondContact O-CB 3.48Å; V67-I71 VanDerWaalsContact O-CG1 3.27Å; V67-I71 WeakPolarHBondContact O-CG1 3.29Å; V67-I71 PolarHBondContact O-N 3.23Å
68	F	92.4	Very high	92.2	Very high	138 Å²	138	101.3 Å²	101.3	61%	0.605	53%	0.532	S	S	*	.	H	α-helix	trans	-58.9	-48.2	175.7	177	-98.2	0	0	0	112.1	S64 V65 C66 V70 I71 W72	S64-F68 WeakPolarHBondContact O-CB 3.28Å; S64-F68 PolarHBondContact O-N 3.46Å; V65-F68 PolarHBondContact O-N 3.3Å; C66-F68 VanDerWaalsContact C-N 3.33Å; C66-F68 PolarHBondContact O-N 2.93Å; F68-V70 VanDerWaalsContact C-N 3.34Å; F68-V70 PolarHBondContact O-N 2.91Å; F68-I71 PolarHBondContact O-N 3.3Å; F68-W72 WeakPolarHBondContact O-CB 3.49Å; F68-W72 PolarHBondContact O-N 3.21Å
69	V	94.7	Very high	91.6	Very high	82 Å²	82	102.5 Å²	102.5	50%	0.497	53%	0.534	S	S	.	.	H	α-helix	trans	-62.5	-41.8	178.6	173.1	0	0	0	0	111.5	V65 C66 V67 W72 W73	V65-V69 WeakPolarHBondContact O-CG2 3.11Å; V65-V69 PolarHBondContact O-N 3.46Å; C66-V69 PolarHBondContact O-N 2.78Å; V67-V69 PolarHBondContact O-N 3.41Å; V69-W72 WeakPolarHBondContact O-CB 3.34Å; V69-W72 PolarHBondContact O-N 3.45Å; V69-W73 WeakPolarHBondContact O-CB 3.4Å; V69-W73 PolarHBondContact O-N 3.25Å
70	V	92.6	Very high	90.9	Very high	76 Å²	76	100.2 Å²	100.2	46%	0.461	52%	0.523	S	S	.	.	H	α-helix	trans	-62.4	-50.4	176.6	170.5	0	0	0	0	110.5	C66 V67 F68 W72 W73 Y74	C66-V70 VanDerWaalsContact O-CG2 3.27Å; C66-V70 WeakPolarHBondContact O-CG2 3.11Å; C66-V70 PolarHBondContact O-N 2.86Å; V67-V70 PolarHBondContact O-N 3.4Å; F68-V70 VanDerWaalsContact C-N 3.34Å; F68-V70 PolarHBondContact O-N 2.91Å; V70-W72 VanDerWaalsContact C-N 3.27Å; V70-W72 PolarHBondContact O-N 2.62Å; V70-W73 PolarHBondContact O-N 3.25Å; V70-W73 VanDerWaalsContact O-N 3.17Å; V70-Y74 HydrophobicContact CG1-CD2 3.65Å; V70-Y74 HydrophobicContact CG1-CE2 3.67Å; V70-Y74 VanDerWaalsContact O-CD2 3.29Å; V70-Y74 WeakPolarHBondContact O-CD2 3.39Å; V70-Y74 PolarHBondContact O-N 3.43Å
71	I	90.5	Very high	90.4	Very high	57 Å²	57	95.4 Å²	95.4	29%	0.292	51%	0.506	S	S	.	.	H	α-helix	trans	-57.5	-43.5	178.5	-70.3	168.5	0	0	0	110.9	V67 F68 Y74 M75 L85	V67-I71 HydrophobicContact CG1-CD1 3.63Å; V67-I71 HydrophobicContact CG1-CG1 4.3Å; V67-I71 WeakPolarHBondContact O-CB 3.48Å; V67-I71 VanDerWaalsContact O-CG1 3.27Å; V67-I71 WeakPolarHBondContact O-CG1 3.29Å; V67-I71 PolarHBondContact O-N 3.23Å; F68-I71 PolarHBondContact O-N 3.3Å; I71-Y74 PolarHBondContact O-N 3Å; I71-M75 HydrophobicContact CG2-CE 4.12Å; I71-M75 WeakPolarHBondContact O-CB 3.46Å; I71-M75 PolarHBondContact O-N 3.01Å; I71-M75 VanDerWaalsContact O-N 3.08Å; I71-L85 HydrophobicContact CD1-CD2 4.38Å; I71-L85 HydrophobicContact CG1-CD2 4.32Å; I71-L85 HydrophobicContact CG2-CD1 3.66Å; I71-L85 HydrophobicContact CG2-CD2 4.01Å
72	W	88.8	Confident	89.7	Confident	163 Å²	163	92.8 Å²	92.8	62%	0.617	50%	0.499	S	S	*	.	H	α-helix	trans	-57.8	-52.3	175.4	177.7	-80.4	0	0	0	111.6	F68 V69 V70 Y74 M75 D76	F68-W72 WeakPolarHBondContact O-CB 3.49Å; F68-W72 PolarHBondContact O-N 3.21Å; V69-W72 WeakPolarHBondContact O-CB 3.34Å; V69-W72 PolarHBondContact O-N 3.45Å; V70-W72 VanDerWaalsContact C-N 3.27Å; V70-W72 PolarHBondContact O-N 2.62Å; W72-Y74 VanDerWaalsContact C-N 3.33Å; W72-Y74 PolarHBondContact O-N 3.11Å; W72-M75 WeakPolarHBondContact O-CB 3.27Å; W72-M75 PolarHBondContact O-N 3.35Å; W72-D76 PolarHBondContact O-N 2.96Å
73	W	92.1	Very high	89.2	Confident	161 Å²	161	94.1 Å²	94.1	61%	0.61	50%	0.503	S	S	*	.	H	α-helix	trans	-55.8	-48.4	-179.8	-173.4	-65.8	0	0	0	111.7	V69 V70 M75 D76 E77	V69-W73 WeakPolarHBondContact O-CB 3.4Å; V69-W73 PolarHBondContact O-N 3.25Å; V70-W73 PolarHBondContact O-N 3.25Å; V70-W73 VanDerWaalsContact O-N 3.17Å; W73-M75 PolarHBondContact O-N 3.37Å; W73-D76 PolarHBondContact O-N 2.99Å; W73-E77 WeakPolarHBondContact O-CG 3.38Å; W73-E77 PolarHBondContact O-N 2.85Å; W73-E77 VanDerWaalsContact O-N 3.07Å
74	Y	88	Confident	88.8	Confident	115 Å²	115	99.1 Å²	99.1	45%	0.451	51%	0.512	S	S	.	.	H	α-helix	trans	-65.7	-26.7	-180	-87.7	-87.1	0	0	0	113.4	V70 I71 W72 L79 L80	V70-Y74 HydrophobicContact CG1-CD2 3.65Å; V70-Y74 HydrophobicContact CG1-CE2 3.67Å; V70-Y74 VanDerWaalsContact O-CD2 3.29Å; V70-Y74 WeakPolarHBondContact O-CD2 3.39Å; V70-Y74 PolarHBondContact O-N 3.43Å; I71-Y74 PolarHBondContact O-N 3Å; W72-Y74 VanDerWaalsContact C-N 3.33Å; W72-Y74 PolarHBondContact O-N 3.11Å; Y74-L79 HydrophobicContact CD1-CB 4.31Å; Y74-L79 HydrophobicContact CD1-CD1 4.36Å; Y74-L79 PolarHBondContact O-N 2.83Å; Y74-L80 VanDerWaalsContact CB-CD1 3.41Å; Y74-L80 HydrophobicContact CD1-CD1 4.04Å; Y74-L80 HydrophobicContact CG-CD1 3.81Å; Y74-L80 PolarHBondContact O-N 3.5Å
75	M	88.1	Confident	88.4	Confident	79 Å²	79	98 Å²	98	39%	0.389	50%	0.5	S	S	.	.	H	α-helix	trans	-76.6	-37.7	174.7	-162.5	-178.9	-44	0	0	111.5	I71 W72 W73 G78 L85	I71-M75 HydrophobicContact CG2-CE 4.12Å; I71-M75 WeakPolarHBondContact O-CB 3.46Å; I71-M75 PolarHBondContact O-N 3.01Å; I71-M75 VanDerWaalsContact O-N 3.08Å; W72-M75 WeakPolarHBondContact O-CB 3.27Å; W72-M75 PolarHBondContact O-N 3.35Å; W73-M75 PolarHBondContact O-N 3.37Å; M75-G78 PolarHBondContact O-N 2.79Å; M75-G78 VanDerWaalsContact O-N 3.08Å; M75-L85 HydrophobicContact CE-CD1 3.8Å
76	D	88.6	Confident	88	Confident	126 Å²	126	99.9 Å²	99.9	67%	0.674	50%	0.501	S	S	*	.	H	α-helix	trans	-63.8	-42.2	176.6	-167.8	62.1	0	0	0	111.8	W72 W73 G78	W72-D76 PolarHBondContact O-N 2.96Å; W73-D76 PolarHBondContact O-N 2.99Å; D76-G78 PolarHBondContact O-N 2.74Å; D76-G78 VanDerWaalsContact O-N 3.15Å
77	E	89	Confident	87.6	Confident	111 Å²	111	98.5 Å²	98.5	52%	0.519	50%	0.498	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.1	-4	173.3	-66.3	-74.6	-178.5	0	0	113.4	W73 L79	W73-E77 WeakPolarHBondContact O-CG 3.38Å; W73-E77 PolarHBondContact O-N 2.85Å; W73-E77 VanDerWaalsContact O-N 3.07Å; E77-L79 HydrophobicContact CB-CD1 4.18Å; E77-L79 HydrophobicContact CB-CG 4.13Å; E77-L79 PolarHBondContact O-N 3.33Å; E77-L79 VanDerWaalsContact O-N 3.16Å
78	G	84.1	Confident	87.4	Confident	63 Å²	63	98.7 Å²	98.7	65%	0.649	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	69.8	6.7	179.9	0	0	0	0	0	115.2	M75 D76	M75-G78 PolarHBondContact O-N 2.79Å; M75-G78 VanDerWaalsContact O-N 3.08Å; D76-G78 PolarHBondContact O-N 2.74Å; D76-G78 VanDerWaalsContact O-N 3.15Å
79	L	79.1	Confident	87.3	Confident	132 Å²	132	93.4 Å²	93.4	69%	0.691	48%	0.484	S	S	*	.			trans	-76.5	-23.3	-178.4	-65.2	175.1	0	0	0	112.8	Y74 E77	Y74-L79 HydrophobicContact CD1-CB 4.31Å; Y74-L79 HydrophobicContact CD1-CD1 4.36Å; Y74-L79 PolarHBondContact O-N 2.83Å; E77-L79 HydrophobicContact CB-CD1 4.18Å; E77-L79 HydrophobicContact CB-CG 4.13Å; E77-L79 PolarHBondContact O-N 3.33Å; E77-L79 VanDerWaalsContact O-N 3.16Å
80	L	79.9	Confident	87.1	Confident	51 Å²	51	95.1 Å²	95.1	27%	0.267	49%	0.49	S	S	.	.	S	Bend	trans	-116.7	104.7	-178.5	-105.6	157.8	0	0	0	111	Y74 W84 L85	Y74-L80 VanDerWaalsContact CB-CD1 3.41Å; Y74-L80 HydrophobicContact CD1-CD1 4.04Å; Y74-L80 HydrophobicContact CG-CD1 3.81Å; Y74-L80 PolarHBondContact O-N 3.5Å; L80-W84 HydrophobicContact CD2-CB 4.25Å; L80-L85 HydrophobicContact CD2-CD2 4.29Å; L80-L85 HydrophobicContact CD2-CG 4.29Å
81	A	83.9	Confident	87.1	Confident	32 Å²	32	94 Å²	94	26%	0.264	49%	0.488	S	S	.	.			trans	-71.1	136.8	171.4	0	0	0	0	0	110.2	Q83 W84	A81-Q83 HydrophobicContact CB-CG 3.9Å; A81-Q83 PolarHBondContact O-N 3.33Å; A81-W84 PolarHBondContact O-N 3.27Å
82	P	81.3	Confident	87.2	Confident	69 Å²	69	94.8 Å²	94.8	45%	0.448	50%	0.499	S	S	.	.	H	α-helix	trans	-53.8	-32.9	-176.1	-28.8	34.4	0	0	0	114.5	W84 L85 F86	P82-W84 VanDerWaalsContact C-N 3.27Å; P82-W84 PolarHBondContact O-N 3.46Å; P82-L85 WeakPolarHBondContact O-CB 3.34Å; P82-L85 PolarHBondContact O-N 2.96Å; P82-L85 VanDerWaalsContact O-N 3.14Å; P82-F86 WeakPolarHBondContact O-CD2 3.28Å; P82-F86 PolarHBondContact O-N 3.43Å
83	Q	85.3	Confident	87.2	Confident	143 Å²	143	90.9 Å²	90.9	67%	0.668	50%	0.497	S	S	*	.	H	α-helix	trans	-57.2	-34.9	176.2	60.7	-167	-34.3	0	0	114	A81 F86 G87	A81-Q83 HydrophobicContact CB-CG 3.9Å; A81-Q83 PolarHBondContact O-N 3.33Å; Q83-F86 PolarHBondContact O-N 3.04Å; Q83-G87 PolarHBondContact O-N 2.86Å
84	W	85.8	Confident	87.2	Confident	175 Å²	175	88.9 Å²	88.9	66%	0.663	50%	0.497	S	S	*	.	H	α-helix	trans	-69.8	-34.7	178.2	-71.6	109.4	0	0	0	111.6	L80 A81 P82 G87 T88	L80-W84 HydrophobicContact CD2-CB 4.25Å; A81-W84 PolarHBondContact O-N 3.27Å; P82-W84 VanDerWaalsContact C-N 3.27Å; P82-W84 PolarHBondContact O-N 3.46Å; W84-G87 PolarHBondContact O-N 2.92Å; W84-T88 WeakPolarHBondContact O-CG2 3.37Å; W84-T88 PolarHBondContact O-N 2.91Å; W84-T88 PolarHBondContact O-OG1 3.42Å; W84-T88 VanDerWaalsContact O-OG1 3.11Å
85	L	86.4	Confident	87.5	Confident	45 Å²	45	88 Å²	88	24%	0.236	50%	0.504	C	S	.	.	H	α-helix	trans	-65.1	-43.3	174.7	-67.2	168.1	0	0	0	111.4	I71 M75 L80 P82 G87 T88 G89	I71-L85 HydrophobicContact CD1-CD2 4.38Å; I71-L85 HydrophobicContact CG1-CD2 4.32Å; I71-L85 HydrophobicContact CG2-CD1 3.66Å; I71-L85 HydrophobicContact CG2-CD2 4.01Å; M75-L85 HydrophobicContact CE-CD1 3.8Å; L80-L85 HydrophobicContact CD2-CD2 4.29Å; L80-L85 HydrophobicContact CD2-CG 4.29Å; P82-L85 WeakPolarHBondContact O-CB 3.34Å; P82-L85 PolarHBondContact O-N 2.96Å; P82-L85 VanDerWaalsContact O-N 3.14Å; L85-G87 VanDerWaalsContact C-N 3.35Å; L85-T88 PolarHBondContact O-OG1 2.82Å; L85-G89 PolarHBondContact O-N 3.45Å
86	F	87	Confident	87.7	Confident	131 Å²	131	86.1 Å²	86.1	58%	0.575	51%	0.505	S	S	*	.	H	α-helix	trans	-63.9	-41.8	174.1	-70.6	-69.7	0	0	0	111.6	P82 Q83 G89 L90	P82-F86 WeakPolarHBondContact O-CD2 3.28Å; P82-F86 PolarHBondContact O-N 3.43Å; Q83-F86 PolarHBondContact O-N 3.04Å; F86-G89 PolarHBondContact O-N 3.18Å; F86-L90 WeakPolarHBondContact O-CB 3.22Å; F86-L90 VanDerWaalsContact O-CG 3.27Å; F86-L90 WeakPolarHBondContact O-CG 3.31Å; F86-L90 PolarHBondContact O-N 3.43Å
87	G	89.5	Confident	87.7	Confident	37 Å²	37	84.2 Å²	84.2	38%	0.381	49%	0.489	S	S	.	.	H	α-helix	trans	-60.7	-49.2	177.4	0	0	0	0	0	112.9	Q83 W84 L85 L90 A91	Q83-G87 PolarHBondContact O-N 2.86Å; W84-G87 PolarHBondContact O-N 2.92Å; L85-G87 VanDerWaalsContact C-N 3.35Å; G87-L90 PolarHBondContact O-N 3.3Å; G87-A91 VanDerWaalsContact O-CB 3.28Å; G87-A91 WeakPolarHBondContact O-CB 3.34Å; G87-A91 PolarHBondContact O-N 2.88Å
88	T	88.9	Confident	87.8	Confident	86 Å²	86	82.7 Å²	82.7	53%	0.528	49%	0.487	S	S	.	.	H	α-helix	trans	-68.7	-35.9	178	58.1	0	0	0	0	112.3	W84 L85 A91 S92	W84-T88 WeakPolarHBondContact O-CG2 3.37Å; W84-T88 PolarHBondContact O-N 2.91Å; W84-T88 PolarHBondContact O-OG1 3.42Å; W84-T88 VanDerWaalsContact O-OG1 3.11Å; L85-T88 PolarHBondContact O-OG1 2.82Å; T88-A91 PolarHBondContact O-N 3.38Å; T88-S92 VanDerWaalsContact O-CB 3.31Å; T88-S92 WeakPolarHBondContact O-CB 3.48Å; T88-S92 PolarHBondContact O-N 2.93Å; T88-S92 PolarHBondContact O-OG 2.89Å
89	G	89.7	Confident	88.2	Confident	28 Å²	28	84.5 Å²	84.5	29%	0.289	48%	0.481	S	S	.	.	H	α-helix	trans	-62.8	-45.3	173.5	0	0	0	0	0	113	L85 F86 S92 S93	L85-G89 PolarHBondContact O-N 3.45Å; F86-G89 PolarHBondContact O-N 3.18Å; G89-S92 WeakPolarHBondContact CA-OG 3.5Å; G89-S92 PolarHBondContact O-OG 3.47Å; G89-S93 WeakPolarHBondContact O-CB 3.43Å; G89-S93 PolarHBondContact O-N 2.84Å; G89-S93 PolarHBondContact O-OG 3.26Å
90	L	89.9	Confident	88.6	Confident	118 Å²	118	84.4 Å²	84.4	62%	0.618	48%	0.475	S	S	*	.	H	α-helix	trans	-66	-44.6	174.9	-71.9	173.8	0	0	0	111.6	F86 G87 S93 L94	F86-L90 WeakPolarHBondContact O-CB 3.22Å; F86-L90 VanDerWaalsContact O-CG 3.27Å; F86-L90 WeakPolarHBondContact O-CG 3.31Å; F86-L90 PolarHBondContact O-N 3.43Å; G87-L90 PolarHBondContact O-N 3.3Å; L90-S93 PolarHBondContact O-N 3.3Å; L90-L94 WeakPolarHBondContact O-CG 3.35Å; L90-L94 PolarHBondContact O-N 3.05Å
91	A	93.5	Very high	88.9	Confident	51 Å²	51	83.6 Å²	83.6	42%	0.421	47%	0.471	S	S	.	.	H	α-helix	trans	-60.8	-48.1	178.1	0	0	0	0	0	111.9	G87 T88 S93 L94 V95	G87-A91 VanDerWaalsContact O-CB 3.28Å; G87-A91 WeakPolarHBondContact O-CB 3.34Å; G87-A91 PolarHBondContact O-N 2.88Å; T88-A91 PolarHBondContact O-N 3.38Å; A91-S93 VanDerWaalsContact C-N 3.33Å; A91-S93 PolarHBondContact O-N 3.11Å; A91-L94 PolarHBondContact O-N 3.09Å; A91-V95 VanDerWaalsContact O-CG2 3.29Å; A91-V95 WeakPolarHBondContact O-CG2 3.38Å; A91-V95 PolarHBondContact O-N 3.18Å
92	S	92.1	Very high	89.1	Confident	75 Å²	75	88.1 Å²	88.1	52%	0.524	49%	0.49	S	S	.	.	H	α-helix	trans	-61.6	-39.6	177.1	59.3	0	0	0	0	112.5	T88 G89 V95 G96	T88-S92 VanDerWaalsContact O-CB 3.31Å; T88-S92 WeakPolarHBondContact O-CB 3.48Å; T88-S92 PolarHBondContact O-N 2.93Å; T88-S92 PolarHBondContact O-OG 2.89Å; G89-S92 WeakPolarHBondContact CA-OG 3.5Å; G89-S92 PolarHBondContact O-OG 3.47Å; S92-V95 PolarHBondContact O-N 2.91Å; S92-G96 PolarHBondContact O-N 3.44Å
93	S	89.8	Confident	89.5	Confident	81 Å²	81	91.3 Å²	91.3	57%	0.566	50%	0.502	S	S	*	.	H	α-helix	trans	-63.8	-42.4	175.7	-60.1	0	0	0	0	112.1	G89 L90 A91 G96 Y97	G89-S93 WeakPolarHBondContact O-CB 3.43Å; G89-S93 PolarHBondContact O-N 2.84Å; G89-S93 PolarHBondContact O-OG 3.26Å; L90-S93 PolarHBondContact O-N 3.3Å; A91-S93 VanDerWaalsContact C-N 3.33Å; A91-S93 PolarHBondContact O-N 3.11Å; S93-G96 PolarHBondContact O-N 3.45Å; S93-Y97 PolarHBondContact O-N 3.25Å
94	L	91.7	Very high	89.5	Confident	118 Å²	118	87.2 Å²	87.2	62%	0.618	48%	0.484	S	S	*	.	H	α-helix	trans	-64.8	-45	175.7	-72.8	171	0	0	0	111.8	L90 A91 G96 Y97 V98	L90-L94 WeakPolarHBondContact O-CG 3.35Å; L90-L94 PolarHBondContact O-N 3.05Å; A91-L94 PolarHBondContact O-N 3.09Å; L94-G96 VanDerWaalsContact C-N 3.32Å; L94-G96 PolarHBondContact O-N 3.11Å; L94-Y97 PolarHBondContact O-N 3.25Å; L94-V98 WeakPolarHBondContact O-CG2 3.29Å; L94-V98 PolarHBondContact O-N 3.27Å
95	V	94.8	Very high	89.2	Confident	98 Å²	98	81.7 Å²	81.7	59%	0.594	48%	0.482	S	S	*	.	H	α-helix	trans	-59.7	-45.1	176	170.8	0	0	0	0	110.4	A91 S92 Y97 V98 L99	A91-V95 VanDerWaalsContact O-CG2 3.29Å; A91-V95 WeakPolarHBondContact O-CG2 3.38Å; A91-V95 PolarHBondContact O-N 3.18Å; S92-V95 PolarHBondContact O-N 2.91Å; V95-Y97 PolarHBondContact O-N 3.33Å; V95-V98 PolarHBondContact O-N 2.85Å; V95-L99 WeakPolarHBondContact O-CB 3.38Å; V95-L99 PolarHBondContact O-N 3.48Å
96	G	91.4	Very high	88.4	Confident	39 Å²	39	80.1 Å²	80.1	40%	0.402	48%	0.477	S	S	.	.	H	α-helix	trans	-59.3	-43.6	176.2	0	0	0	0	0	112.7	S92 S93 L94 L99 F100	S92-G96 PolarHBondContact O-N 3.44Å; S93-G96 PolarHBondContact O-N 3.45Å; L94-G96 VanDerWaalsContact C-N 3.32Å; L94-G96 PolarHBondContact O-N 3.11Å; G96-L99 PolarHBondContact O-N 2.95Å; G96-F100 WeakPolarHBondContact O-CB 3.37Å; G96-F100 PolarHBondContact O-N 3.01Å
97	Y	88.7	Confident	87.9	Confident	86 Å²	86	77.5 Å²	77.5	34%	0.337	47%	0.469	S	S	.	.	H	α-helix	trans	-63.4	-43.9	176.4	-176.9	-99.2	0	0	0	112.4	S93 L94 V95 F100 D101 D119	S93-Y97 PolarHBondContact O-N 3.25Å; L94-Y97 PolarHBondContact O-N 3.25Å; V95-Y97 PolarHBondContact O-N 3.33Å; Y97-F100 PolarHBondContact O-N 2.92Å; Y97-D101 WeakPolarHBondContact O-CB 3.42Å; Y97-D101 PolarHBondContact O-N 3.47Å; Y97-D119 PolarHBondContact OH-OD2 3.41Å
98	V	90.4	Very high	87.1	Confident	79 Å²	79	77 Å²	77	48%	0.479	46%	0.464	S	S	.	.	H	α-helix	trans	-64.7	-45	177.2	172.4	0	0	0	0	110.8	L94 V95 F100 D101 L102	L94-V98 WeakPolarHBondContact O-CG2 3.29Å; L94-V98 PolarHBondContact O-N 3.27Å; V95-V98 PolarHBondContact O-N 2.85Å; V98-F100 VanDerWaalsContact C-N 3.29Å; V98-F100 PolarHBondContact O-N 3.43Å; V98-D101 PolarHBondContact O-N 2.88Å; V98-L102 HydrophobicContact CG1-CD1 3.98Å; V98-L102 HydrophobicContact CG1-CG 4.3Å; V98-L102 WeakPolarHBondContact O-CB 3.27Å; V98-L102 VanDerWaalsContact O-CG 3.27Å; V98-L102 WeakPolarHBondContact O-CG 3.4Å; V98-L102 PolarHBondContact O-N 2.78Å
99	L	92.3	Very high	86.3	Confident	100 Å²	100	77.7 Å²	77.7	52%	0.524	46%	0.456	S	S	.	.	H	α-helix	trans	-61.9	-40.4	179	-162.9	72.5	0	0	0	111.1	V95 G96 L102 I103	V95-L99 WeakPolarHBondContact O-CB 3.38Å; V95-L99 PolarHBondContact O-N 3.48Å; G96-L99 PolarHBondContact O-N 2.95Å; L99-L102 PolarHBondContact O-N 3.42Å; L99-I103 HydrophobicContact CD2-CD1 4.45Å; L99-I103 HydrophobicContact CG-CD1 4.02Å; L99-I103 WeakPolarHBondContact O-CB 3.47Å; L99-I103 VanDerWaalsContact O-CG1 3.23Å; L99-I103 WeakPolarHBondContact O-CG1 3.47Å; L99-I103 PolarHBondContact O-N 2.86Å
100	F	88.4	Confident	85.5	Confident	131 Å²	131	84.3 Å²	84.3	58%	0.575	48%	0.477	S	S	*	.	H	α-helix	trans	-61.6	-48.4	173.4	178	-98	0	0	0	112.2	G96 Y97 V98 L102 I103 D104	G96-F100 WeakPolarHBondContact O-CB 3.37Å; G96-F100 PolarHBondContact O-N 3.01Å; Y97-F100 PolarHBondContact O-N 2.92Å; V98-F100 VanDerWaalsContact C-N 3.29Å; V98-F100 PolarHBondContact O-N 3.43Å; F100-L102 VanDerWaalsContact C-N 3.25Å; F100-L102 PolarHBondContact O-N 2.91Å; F100-I103 PolarHBondContact O-N 3.46Å; F100-D104 VanDerWaalsContact O-CB 3.28Å; F100-D104 WeakPolarHBondContact O-CB 3.43Å; F100-D104 PolarHBondContact O-N 3.29Å
101	D	86.7	Confident	84.9	Confident	34 Å²	34	86.6 Å²	86.6	18%	0.182	48%	0.482	C	S	.	.	H	α-helix	trans	-61.8	-34.5	178.5	-161.1	35	0	0	0	111.4	Y97 V98 G105 G106 R116	Y97-D101 WeakPolarHBondContact O-CB 3.42Å; Y97-D101 PolarHBondContact O-N 3.47Å; V98-D101 PolarHBondContact O-N 2.88Å; D101-G105 PolarHBondContact O-N 3.36Å; D101-G105 VanDerWaalsContact O-N 3.15Å; D101-G106 PolarHBondContact O-N 2.91Å; D101-R116 IonicContact OD2-CZ 2.79Å; D101-R116 IonicContact OD2-NH2 3.08Å; D101-R116 PolarHBondContact OD2-NH2 3.5Å
102	L	87.9	Confident	83.9	Confident	127 Å²	127	88 Å²	88	67%	0.665	49%	0.489	S	S	*	.	H	α-helix	trans	-70.9	-44.9	174.8	-70.8	174.7	0	0	0	112.8	V98 L99 F100 G105	V98-L102 HydrophobicContact CG1-CD1 3.98Å; V98-L102 HydrophobicContact CG1-CG 4.3Å; V98-L102 WeakPolarHBondContact O-CB 3.27Å; V98-L102 VanDerWaalsContact O-CG 3.27Å; V98-L102 WeakPolarHBondContact O-CG 3.4Å; V98-L102 PolarHBondContact O-N 2.78Å; L99-L102 PolarHBondContact O-N 3.42Å; F100-L102 VanDerWaalsContact C-N 3.25Å; F100-L102 PolarHBondContact O-N 2.91Å; L102-G105 PolarHBondContact O-N 3.41Å
103	I	89.6	Confident	83.2	Confident	135 Å²	135	87.5 Å²	87.5	69%	0.692	50%	0.496	S	S	*	.	H	α-helix	trans	-66.4	-42.5	179.1	-70.6	165.9	0	0	0	110.8	L99 F100 G105	L99-I103 HydrophobicContact CD2-CD1 4.45Å; L99-I103 HydrophobicContact CG-CD1 4.02Å; L99-I103 WeakPolarHBondContact O-CB 3.47Å; L99-I103 VanDerWaalsContact O-CG1 3.23Å; L99-I103 WeakPolarHBondContact O-CG1 3.47Å; L99-I103 PolarHBondContact O-N 2.86Å; F100-I103 PolarHBondContact O-N 3.46Å; I103-G105 PolarHBondContact O-N 2.99Å
104	D	85.2	Confident	82.5	Confident	57 Å²	57	88.8 Å²	88.8	31%	0.305	49%	0.488	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.8	-10.4	-179.6	-164.9	36.6	0	0	0	112.1	F100 G106 D107 G108	F100-D104 VanDerWaalsContact O-CB 3.28Å; F100-D104 WeakPolarHBondContact O-CB 3.43Å; F100-D104 PolarHBondContact O-N 3.29Å; D104-G106 PolarHBondContact O-N 3.35Å; D104-D107 WeakPolarHBondContact O-CB 3.29Å; D104-D107 PolarHBondContact O-N 3.28Å; D104-G108 PolarHBondContact OD1-N 2.97Å; D104-G108 WeakPolarHBondContact OD2-CA 3.27Å; D104-G108 PolarHBondContact OD2-N 2.99Å
105	G	79	Confident	82	Confident	59 Å²	59	87 Å²	87	61%	0.608	48%	0.483	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.8	18.7	176.7	0	0	0	0	0	114	D101 L102 I103 D107	D101-G105 PolarHBondContact O-N 3.36Å; D101-G105 VanDerWaalsContact O-N 3.15Å; L102-G105 PolarHBondContact O-N 3.41Å; I103-G105 PolarHBondContact O-N 2.99Å; G105-D107 PolarHBondContact O-N 3.3Å
106	G	70.7	Confident	81.4	Confident	13 Å²	13	88.8 Å²	88.8	13%	0.134	48%	0.478	C	S	.	.	T	Hydrogen-bonded Turn	trans	67.8	9.5	-170.2	0	0	0	0	0	115.2	D101 D104 R109 K110	D101-G106 PolarHBondContact O-N 2.91Å; D104-G106 PolarHBondContact O-N 3.35Å; G106-R109 PolarHBondContact O-N 2.93Å; G106-K110 WeakPolarHBondContact O-CG 3.27Å; G106-K110 PolarHBondContact O-N 3.3Å; G106-K110 VanDerWaalsContact O-N 3.11Å
107	D	75	Confident	80.9	Confident	76 Å²	76	96.4 Å²	96.4	41%	0.406	50%	0.495	S	S	.	.	H	α-helix	trans	-75.5	-40.5	-178	-156.1	44.5	0	0	0	111.7	D104 G105 R109 K110 K111	D104-D107 WeakPolarHBondContact O-CB 3.29Å; D104-D107 PolarHBondContact O-N 3.28Å; G105-D107 PolarHBondContact O-N 3.3Å; D107-R109 VanDerWaalsContact C-N 3.26Å; D107-R109 PolarHBondContact O-N 3.46Å; D107-K110 PolarHBondContact O-N 3.46Å; D107-K111 WeakPolarHBondContact O-CG 3.35Å; D107-K111 PolarHBondContact O-N 2.89Å; D107-K111 WeakPolarHBondContact OD2-CE 3.29Å; D107-K111 IonicContact OD2-NZ 3.48Å; D107-K111 PolarHBondContact OD2-NZ 3.42Å; D107-K111 VanDerWaalsContact OD2-NZ 3.08Å
108	G	72.8	Confident	80.8	Confident	26 Å²	26	94 Å²	94	27%	0.268	49%	0.493	S	S	.	.	H	α-helix	trans	-62.5	-33.7	170.9	0	0	0	0	0	112.5	D104 K111 S112	D104-G108 PolarHBondContact OD1-N 2.97Å; D104-G108 WeakPolarHBondContact OD2-CA 3.27Å; D104-G108 PolarHBondContact OD2-N 2.99Å; G108-K111 PolarHBondContact O-N 3.17Å; G108-S112 VanDerWaalsContact O-CB 3.23Å; G108-S112 WeakPolarHBondContact O-CB 3.43Å; G108-S112 PolarHBondContact O-N 3.33Å
109	R	72.5	Confident	80.6	Confident	100 Å²	100	92 Å²	92	38%	0.377	48%	0.48	S	S	.	.	H	α-helix	trans	-69.8	-37.8	175.5	-160.6	161.7	67.6	87.6	-2.4	113	G106 D107 G113 R114	G106-R109 PolarHBondContact O-N 2.93Å; D107-R109 VanDerWaalsContact C-N 3.26Å; D107-R109 PolarHBondContact O-N 3.46Å; R109-G113 PolarHBondContact O-N 3.35Å; R109-R114 WeakPolarHBondContact CG-O 3.16Å
110	K	72.4	Confident	80.4	Confident	167 Å²	167	92.1 Å²	92.1	73%	0.726	48%	0.48	S	S	*	.	H	α-helix	trans	-65.8	-40.6	174	-73	173	-173.4	174.7	0	112	G106 D107	G106-K110 WeakPolarHBondContact O-CG 3.27Å; G106-K110 PolarHBondContact O-N 3.3Å; G106-K110 VanDerWaalsContact O-N 3.11Å; D107-K110 PolarHBondContact O-N 3.46Å
111	K	77.3	Confident	80.5	Confident	166 Å²	166	93.2 Å²	93.2	72%	0.722	49%	0.485	S	S	*	.	H	α-helix	trans	-69.2	-37.3	176.4	-70.4	175.2	-172.5	163.1	0	112.8	D107 G108	D107-K111 WeakPolarHBondContact O-CG 3.35Å; D107-K111 PolarHBondContact O-N 2.89Å; D107-K111 WeakPolarHBondContact OD2-CE 3.29Å; D107-K111 IonicContact OD2-NZ 3.48Å; D107-K111 PolarHBondContact OD2-NZ 3.42Å; D107-K111 VanDerWaalsContact OD2-NZ 3.08Å; G108-K111 PolarHBondContact O-N 3.17Å
112	S	73.6	Confident	80.5	Confident	80 Å²	80	93.6 Å²	93.6	56%	0.559	49%	0.49	S	S	*	.	H	α-helix	trans	-80	-19.2	-179.8	-174.7	0	0	0	0	113.5	G108 R114	G108-S112 VanDerWaalsContact O-CB 3.23Å; G108-S112 WeakPolarHBondContact O-CB 3.43Å; G108-S112 PolarHBondContact O-N 3.33Å; S112-R114 PolarHBondContact O-N 2.94Å; S112-R114 VanDerWaalsContact O-N 3.12Å
113	G	77	Confident	80.6	Confident	65 Å²	65	91.1 Å²	91.1	67%	0.67	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.3	10	-176.3	0	0	0	0	0	113.9	R109	R109-G113 PolarHBondContact O-N 3.35Å
114	R	75.1	Confident	80.6	Confident	108 Å²	108	89.9 Å²	89.9	41%	0.408	48%	0.475	S	S	.	.			trans	-88.2	130.2	-169.7	-164.2	168.4	149.5	126.6	-1.9	110.6	R109 S112 A118 D119	R109-R114 WeakPolarHBondContact CG-O 3.16Å; S112-R114 PolarHBondContact O-N 2.94Å; S112-R114 VanDerWaalsContact O-N 3.12Å; R114-A118 HydrophobicContact CG-CB 3.92Å; R114-D119 IonicContact CZ-OD1 3.21Å; R114-D119 IonicContact NE-OD1 2.74Å; R114-D119 PolarHBondContact NE-OD1 2.99Å; R114-D119 IonicContact NH2-OD1 2.79Å; R114-D119 PolarHBondContact NH2-OD1 3.08Å
115	T	82.2	Confident	81	Confident	82 Å²	82	91.4 Å²	91.4	50%	0.503	49%	0.486	S	S	.	.			trans	-91	153.1	-179.9	34.7	0	0	0	0	111.3	W117 A118 D119	T115-W117 PolarHBondContact O-N 3.03Å; T115-W117 VanDerWaalsContact O-N 3.11Å; T115-A118 WeakPolarHBondContact O-CA 3.47Å; T115-A118 VanDerWaalsContact O-CB 3.27Å; T115-A118 WeakPolarHBondContact O-CB 3.45Å; T115-A118 PolarHBondContact O-N 3.14Å; T115-D119 PolarHBondContact O-N 3.3Å
116	R	81.8	Confident	81.4	Confident	134 Å²	134	95 Å²	95	51%	0.506	49%	0.485	S	S	.	.	H	α-helix	trans	-55.7	-29.4	176.1	-73.8	-177	156.2	-179.5	-4.8	113.2	D101 A118 D119 L120	D101-R116 IonicContact OD2-CZ 2.79Å; D101-R116 IonicContact OD2-NH2 3.08Å; D101-R116 PolarHBondContact OD2-NH2 3.5Å; R116-A118 VanDerWaalsContact C-N 3.34Å; R116-D119 PolarHBondContact O-N 2.95Å; R116-L120 PolarHBondContact O-N 3.25Å
117	W	81.3	Confident	82.3	Confident	200 Å²	200	98.8 Å²	98.8	76%	0.758	50%	0.501	S	S	*	.	H	α-helix	trans	-66.1	-33.2	173	-77.8	104.6	0	0	0	113.4	T115 L120 K121	T115-W117 PolarHBondContact O-N 3.03Å; T115-W117 VanDerWaalsContact O-N 3.11Å; W117-L120 HydrophobicContact CE3-CD2 4.2Å; W117-L120 HydrophobicContact CZ3-CD2 4.09Å; W117-K121 VanDerWaalsContact O-CB 3.22Å; W117-K121 WeakPolarHBondContact O-CB 3.46Å; W117-K121 PolarHBondContact O-N 3.4Å
118	A	85.6	Confident	83.1	Confident	35 Å²	35	99.3 Å²	99.3	29%	0.289	51%	0.507	S	S	.	.	H	α-helix	trans	-69.2	-37.8	175.1	0	0	0	0	0	111.1	R114 T115 R116 S122	R114-A118 HydrophobicContact CG-CB 3.92Å; T115-A118 WeakPolarHBondContact O-CA 3.47Å; T115-A118 VanDerWaalsContact O-CB 3.27Å; T115-A118 WeakPolarHBondContact O-CB 3.45Å; T115-A118 PolarHBondContact O-N 3.14Å; R116-A118 VanDerWaalsContact C-N 3.34Å; A118-S122 WeakPolarHBondContact O-CB 3.39Å; A118-S122 PolarHBondContact O-N 3.46Å
119	D	86.3	Confident	84	Confident	37 Å²	37	105.1 Å²	105.1	20%	0.198	53%	0.526	C	S	.	.	H	α-helix	trans	-63.6	-49.8	173.1	-66.1	-23.6	0	0	0	110.9	Y97 R114 T115 R116 K121 S122 T123	Y97-D119 PolarHBondContact OH-OD2 3.41Å; R114-D119 IonicContact CZ-OD1 3.21Å; R114-D119 IonicContact NE-OD1 2.74Å; R114-D119 PolarHBondContact NE-OD1 2.99Å; R114-D119 IonicContact NH2-OD1 2.79Å; R114-D119 PolarHBondContact NH2-OD1 3.08Å; T115-D119 PolarHBondContact O-N 3.3Å; R116-D119 PolarHBondContact O-N 2.95Å; D119-K121 VanDerWaalsContact C-N 3.34Å; D119-K121 PolarHBondContact O-N 3.22Å; D119-S122 WeakPolarHBondContact O-CA 3.34Å; D119-S122 WeakPolarHBondContact O-CB 3.44Å; D119-S122 PolarHBondContact O-N 2.87Å; D119-S122 VanDerWaalsContact O-N 3.09Å; D119-T123 PolarHBondContact O-N 3.33Å; D119-T123 PolarHBondContact O-OG1 2.86Å; D119-T123 VanDerWaalsContact O-OG1 3.05Å
120	L	87.6	Confident	84.8	Confident	103 Å²	103	104.5 Å²	104.5	54%	0.539	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-42.6	178.2	-174.6	65.5	0	0	0	112.2	R116 W117 S122 T123 L124	R116-L120 PolarHBondContact O-N 3.25Å; W117-L120 HydrophobicContact CE3-CD2 4.2Å; W117-L120 HydrophobicContact CZ3-CD2 4.09Å; L120-S122 VanDerWaalsContact C-N 3.31Å; L120-S122 PolarHBondContact O-N 3.31Å; L120-T123 PolarHBondContact O-N 2.96Å; L120-L124 WeakPolarHBondContact O-CB 3.48Å; L120-L124 PolarHBondContact O-N 3.16Å
121	K	90.3	Very high	85.3	Confident	153 Å²	153	104.5 Å²	104.5	67%	0.665	53%	0.529	S	S	*	.	H	α-helix	trans	-61.1	-42.4	175	-176.8	178.9	178.2	179.4	0	111.1	W117 D119 L124 V125	W117-K121 VanDerWaalsContact O-CB 3.22Å; W117-K121 WeakPolarHBondContact O-CB 3.46Å; W117-K121 PolarHBondContact O-N 3.4Å; D119-K121 VanDerWaalsContact C-N 3.34Å; D119-K121 PolarHBondContact O-N 3.22Å; K121-L124 PolarHBondContact O-N 3.2Å; K121-V125 VanDerWaalsContact O-CG2 3.29Å; K121-V125 WeakPolarHBondContact O-CG2 3.37Å; K121-V125 PolarHBondContact O-N 2.9Å
122	S	88.3	Confident	85.4	Confident	42 Å²	42	99.3 Å²	99.3	29%	0.294	52%	0.523	S	S	.	.	H	α-helix	trans	-62.8	-46.2	176.2	-162.9	0	0	0	0	110.9	A118 D119 L120 L124 V125 F126	A118-S122 WeakPolarHBondContact O-CB 3.39Å; A118-S122 PolarHBondContact O-N 3.46Å; D119-S122 WeakPolarHBondContact O-CA 3.34Å; D119-S122 WeakPolarHBondContact O-CB 3.44Å; D119-S122 PolarHBondContact O-N 2.87Å; D119-S122 VanDerWaalsContact O-N 3.09Å; L120-S122 VanDerWaalsContact C-N 3.31Å; L120-S122 PolarHBondContact O-N 3.31Å; S122-L124 VanDerWaalsContact C-N 3.34Å; S122-L124 PolarHBondContact O-N 3.2Å; S122-V125 PolarHBondContact O-N 3.3Å; S122-F126 WeakPolarHBondContact O-CD2 3.3Å; S122-F126 PolarHBondContact O-N 3.07Å
123	T	88.9	Confident	84.5	Confident	75 Å²	75	107 Å²	107	46%	0.46	55%	0.547	S	S	.	.	H	α-helix	trans	-60.3	-43.5	176.8	-55.2	0	0	0	0	111.5	D119 L120 F126 I127	D119-T123 PolarHBondContact O-N 3.33Å; D119-T123 PolarHBondContact O-OG1 2.86Å; D119-T123 VanDerWaalsContact O-OG1 3.05Å; L120-T123 PolarHBondContact O-N 2.96Å; T123-F126 PolarHBondContact O-N 3.08Å; T123-I127 HydrophobicContact CG2-CD1 3.9Å; T123-I127 HydrophobicContact CG2-CG1 4.45Å; T123-I127 WeakPolarHBondContact O-CG1 3.43Å; T123-I127 PolarHBondContact O-N 3.24Å
124	L	90.1	Very high	84.9	Confident	109 Å²	109	109.1 Å²	109.1	57%	0.571	54%	0.541	S	S	*	.	H	α-helix	trans	-59.9	-49	176.5	-171.4	82.9	0	0	0	111.1	L120 K121 S122 F126 I127 T128	L120-L124 WeakPolarHBondContact O-CB 3.48Å; L120-L124 PolarHBondContact O-N 3.16Å; K121-L124 PolarHBondContact O-N 3.2Å; S122-L124 VanDerWaalsContact C-N 3.34Å; S122-L124 PolarHBondContact O-N 3.2Å; L124-F126 VanDerWaalsContact C-N 3.28Å; L124-F126 PolarHBondContact O-N 3.37Å; L124-I127 PolarHBondContact O-N 3.2Å; L124-T128 WeakPolarHBondContact O-CB 3.49Å; L124-T128 PolarHBondContact O-N 2.93Å; L124-T128 PolarHBondContact O-OG1 3.4Å
125	V	92.4	Very high	85.4	Confident	90 Å²	90	109.2 Å²	109.2	55%	0.545	55%	0.548	S	S	.	.	H	α-helix	trans	-58.6	-42.2	177.8	170.1	0	0	0	0	111.1	K121 S122 F129	K121-V125 VanDerWaalsContact O-CG2 3.29Å; K121-V125 WeakPolarHBondContact O-CG2 3.37Å; K121-V125 PolarHBondContact O-N 2.9Å; S122-V125 PolarHBondContact O-N 3.3Å; V125-F129 VanDerWaalsContact O-CB 3.3Å; V125-F129 WeakPolarHBondContact O-CB 3.42Å; V125-F129 PolarHBondContact O-N 3.04Å
126	F	89.1	Confident	85.5	Confident	135 Å²	135	110.7 Å²	110.7	59%	0.592	55%	0.55	S	S	*	*	H	α-helix	trans	-63.2	-47.8	176	-95	-79.3	0	0	0	112.4	S122 T123 L124 T128 F129 T130	S122-F126 WeakPolarHBondContact O-CD2 3.3Å; S122-F126 PolarHBondContact O-N 3.07Å; T123-F126 PolarHBondContact O-N 3.08Å; L124-F126 VanDerWaalsContact C-N 3.28Å; L124-F126 PolarHBondContact O-N 3.37Å; F126-T128 VanDerWaalsContact C-N 3.35Å; F126-T128 PolarHBondContact O-N 2.93Å; F126-F129 PolarHBondContact O-N 2.95Å; F126-T130 WeakPolarHBondContact O-CB 3.5Å; F126-T130 PolarHBondContact O-N 3.47Å; F126-T130 PolarHBondContact O-OG1 3.15Å; F126-T130 VanDerWaalsContact O-OG1 3.08Å
127	I	89.7	Confident	85.8	Confident	91 Å²	91	109.3 Å²	109.3	47%	0.467	55%	0.553	S	S	.	*	H	α-helix	trans	-61	-46.5	178.2	-68.6	168.8	0	0	0	110.3	T123 L124 F129 T130 Y131	T123-I127 HydrophobicContact CG2-CD1 3.9Å; T123-I127 HydrophobicContact CG2-CG1 4.45Å; T123-I127 WeakPolarHBondContact O-CG1 3.43Å; T123-I127 PolarHBondContact O-N 3.24Å; L124-I127 PolarHBondContact O-N 3.2Å; I127-F129 VanDerWaalsContact C-N 3.29Å; I127-F129 PolarHBondContact O-N 2.87Å; I127-T130 PolarHBondContact O-N 2.94Å; I127-Y131 HydrophobicContact CG2-CD2 4.02Å; I127-Y131 WeakPolarHBondContact O-CD2 3.45Å; I127-Y131 PolarHBondContact O-N 3.08Å
128	T	90.3	Very high	86	Confident	87 Å²	87	103.6 Å²	103.6	53%	0.534	54%	0.54	S	S	.	.	H	α-helix	trans	-62.1	-37.8	177.8	-55.4	0	0	0	0	111.7	L124 F126 G132	L124-T128 WeakPolarHBondContact O-CB 3.49Å; L124-T128 PolarHBondContact O-N 2.93Å; L124-T128 PolarHBondContact O-OG1 3.4Å; F126-T128 VanDerWaalsContact C-N 3.35Å; F126-T128 PolarHBondContact O-N 2.93Å; T128-G132 WeakPolarHBondContact O-CA 3.11Å; T128-G132 PolarHBondContact O-N 3.07Å
129	F	92.2	Very high	86.1	Confident	149 Å²	149	108.2 Å²	108.2	65%	0.654	56%	0.557	S	S	*	*	H	α-helix	trans	-71.3	-40	176.7	-177.1	-102	0	0	0	112.7	V125 F126 I127	V125-F129 VanDerWaalsContact O-CB 3.3Å; V125-F129 WeakPolarHBondContact O-CB 3.42Å; V125-F129 PolarHBondContact O-N 3.04Å; F126-F129 PolarHBondContact O-N 2.95Å; I127-F129 VanDerWaalsContact C-N 3.29Å; I127-F129 PolarHBondContact O-N 2.87Å
130	T	88.6	Confident	86.1	Confident	86 Å²	86	113.3 Å²	113.3	53%	0.528	58%	0.583	S	S	.	*	H	α-helix	trans	-75	-31.8	-177.5	-62.8	0	0	0	0	113.3	F126 I127	F126-T130 WeakPolarHBondContact O-CB 3.5Å; F126-T130 PolarHBondContact O-N 3.47Å; F126-T130 PolarHBondContact O-OG1 3.15Å; F126-T130 VanDerWaalsContact O-OG1 3.08Å; I127-T130 PolarHBondContact O-N 2.94Å
131	Y	83.6	Confident	86	Confident	167 Å²	167	114.1 Å²	114.1	66%	0.655	59%	0.586	S	S	*	*	H	α-helix	trans	-115.5	-5.2	-176.1	-65.5	-78.9	0	0	0	114.3	I127	I127-Y131 HydrophobicContact CG2-CD2 4.02Å; I127-Y131 WeakPolarHBondContact O-CD2 3.45Å; I127-Y131 PolarHBondContact O-N 3.08Å
132	G	78.8	Confident	85.6	Confident	58 Å²	58	110.8 Å²	110.8	60%	0.598	58%	0.579	S	S	*	*			trans	-98.3	5.2	-177.8	0	0	0	0	0	115	T128	T128-G132 WeakPolarHBondContact O-CA 3.11Å; T128-G132 PolarHBondContact O-N 3.07Å
133	F	55.1	Low	85.3	Confident	241 Å²	241	117.1 Å²	117.1	100%	1.057	61%	0.605	S	S	*	*			trans	-118.1	0	168.6	-110.5	-80.7	0	0	0	109.2

Retrieved 133 of 133 residues in 24.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).