A0A096MS21_PAPAN Loading...

FAU ubiquitin like and ribosomal protein S30 fusion

AlphaFold DB , UniProt , Accession A0A096MS21, Species PAPAN (Papio anubis, Olive baboon), Gene FAU, Length 133 aa.

						>A0A096MS21_PAPAN|A0A096MS21|FAU
MQLFVRAQELHTLEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGTPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	92.9	Very high	95.2	Very high	68 Å²	68	73.1 Å²	73.1	34%	0.335	34%	0.343	S	S	.	.				0	134.1	0	71.7	173.4	-121	0	0	106.8	L3 E14 V15 V59 E60 A61	M1-L3 HydrophobicContact CE-CD1 4.05Å; M1-L3 HydrophobicContact CE-CD2 3.48Å; M1-L3 VanDerWaalsContact CE-CD2 3.48Å; M1-L3 HydrophobicContact CE-CG 3.82Å; M1-E14 PolarHBondContact N-OE2 3.01Å; M1-V15 HydrophobicContact CE-CG2 4.19Å; M1-V15 HydrophobicContact CG-CG2 3.64Å; M1-V15 WeakPolarHBondContact CG-O 3.4Å; M1-V15 PolarHBondContact N-O 3.22Å; M1-V15 WeakPolarHBondContact O-CG2 3.27Å; M1-V15 PolarHBondContact O-N 3.11Å; M1-V15 VanDerWaalsContact O-O 3.12Å; M1-V59 HydrophobicContact CE-CG1 4.03Å; M1-E60 VanDerWaalsContact CE-O 3.27Å; M1-E60 WeakPolarHBondContact CE-O 3.4Å; M1-A61 HydrophobicContact CB-CB 4.16Å
2	Q	94.5	Very high	95.3	Very high	69 Å²	69	74.2 Å²	74.2	32%	0.322	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.2	140.6	-177.7	-165.6	175.9	10.7	0	0	110.2	L13 E14 L62	Q2-L13 CarbonylContact C-O 3.58Å; Q2-L13 WeakPolarHBondContact CA-O 3.45Å; Q2-E14 WeakPolarHBondContact CB-OE1 3.24Å; Q2-L62 HydrophobicContact CB-CD2 4.28Å; Q2-L62 PolarHBondContact O-N 3.33Å
3	L	96.1	Very high	95.3	Very high	1 Å²	1	70 Å²	70	1%	0.005	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	153	172.7	-69.7	-178.7	0	0	0	110.9	M1 T12 L13 V15 L54 V59 E60 L65	M1-L3 HydrophobicContact CE-CD1 4.05Å; M1-L3 HydrophobicContact CE-CD2 3.48Å; M1-L3 VanDerWaalsContact CE-CD2 3.48Å; M1-L3 HydrophobicContact CE-CG 3.82Å; L3-T12 CarbonylContact O-C 3.53Å; L3-T12 WeakPolarHBondContact O-CA 3.38Å; L3-L13 PolarHBondContact N-O 3.36Å; L3-L13 PolarHBondContact O-N 3.49Å; L3-V15 HydrophobicContact CD1-CG1 4.49Å; L3-V15 HydrophobicContact CD1-CG2 3.58Å; L3-V15 HydrophobicContact CG-CG2 3.84Å; L3-L54 HydrophobicContact CD1-CD1 3.87Å; L3-V59 HydrophobicContact CD1-CG1 3.77Å; L3-V59 HydrophobicContact CD2-CG1 3.59Å; L3-V59 HydrophobicContact CG-CG1 4.35Å; L3-E60 WeakPolarHBondContact CD2-O 3.48Å; L3-L65 HydrophobicContact CD1-CD1 4.28Å
4	F	97.4	Very high	95.3	Very high	60 Å²	60	75 Å²	75	26%	0.263	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	131.7	166.9	-59.3	-74.2	0	0	0	109	L10 H11 T12 L62 T63 T64 L65	F4-L10 HydrophobicContact CB-CD1 4.18Å; F4-H11 CarbonylContact C-O 3.57Å; F4-H11 WeakPolarHBondContact CA-O 3.25Å; F4-T12 HydrophobicContact CD1-CG2 3.66Å; F4-T12 HydrophobicContact CE1-CG2 3.59Å; F4-L62 WeakPolarHBondContact CD2-O 3.49Å; F4-L62 HydrophobicContact CE2-CB 4.15Å; F4-L62 HydrophobicContact CE2-CD2 4.07Å; F4-L62 HydrophobicContact CZ-CD2 4.38Å; F4-T63 PolarHBondContact N-O 3.31Å; F4-T64 HydrophobicContact CB-CG2 4.21Å; F4-T64 CarbonylContact O-C 3.59Å; F4-T64 VanDerWaalsContact O-CA 3.26Å; F4-T64 WeakPolarHBondContact O-CA 3.33Å; F4-L65 PolarHBondContact O-N 3.42Å
5	V	96.8	Very high	95.2	Very high	1 Å²	1	70.8 Å²	70.8	1%	0.006	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	114.2	175.4	-176	0	0	0	0	107.8	H11 L13 V28 L65 V67	V5-H11 PolarHBondContact N-O 3.38Å; V5-H11 PolarHBondContact O-N 3.23Å; V5-L13 HydrophobicContact CG2-CD1 3.61Å; V5-L13 HydrophobicContact CG2-CG 4.01Å; V5-V28 HydrophobicContact CG1-CG2 3.72Å; V5-L65 WeakPolarHBondContact CA-O 3.09Å; V5-V67 HydrophobicContact CG1-CG2 3.58Å
6	R	96.8	Very high	95.1	Very high	154 Å²	154	73 Å²	73	58%	0.581	36%	0.361	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.4	106.2	178.6	-177	-176.9	-176.5	176.4	3.1	109	L10 T64 L65 E66 V67	R6-L10 HydrophobicContact CB-CD1 4.26Å; R6-T64 HydrophobicContact CB-CG2 4.05Å; R6-L65 PolarHBondContact N-O 3.38Å; R6-E66 CarbonylContact O-C 3.55Å; R6-E66 WeakPolarHBondContact O-CA 3.22Å; R6-V67 PolarHBondContact O-N 3.38Å
7	A	93.3	Very high	94.7	Very high	24 Å²	24	69.1 Å²	69.1	20%	0.198	34%	0.344	C	S	.	.	S	Bend	trans	-124.3	-124.6	177	0	0	0	0	0	109.1	E9 V28 E32 V67	A7-E9 VanDerWaalsContact C-N 3.34Å; A7-E9 PolarHBondContact N-O 3.36Å; A7-V28 HydrophobicContact CB-CG1 4.23Å; A7-E32 WeakPolarHBondContact CB-OE1 3.47Å; A7-E32 WeakPolarHBondContact CB-OE2 3.43Å; A7-V67 HydrophobicContact CB-CB 3.88Å
8	Q	92.1	Very high	94.6	Very high	137 Å²	137	73.2 Å²	73.2	64%	0.64	36%	0.362	S	S	*	.	S	Bend	trans	-64.6	-42.2	167	-66.3	177	61.5	0	0	111.1	E32 I34	Q8-E32 WeakPolarHBondContact CA-OE1 3.41Å; Q8-E32 WeakPolarHBondContact CB-OE1 3.48Å; Q8-E32 WeakPolarHBondContact CB-OE2 3.42Å; Q8-E32 WeakPolarHBondContact CG-OE2 3.48Å; Q8-E32 VanDerWaalsContact N-CD 3.26Å; Q8-E32 PolarHBondContact N-OE1 2.68Å; Q8-E32 PolarHBondContact N-OE2 2.75Å; Q8-E32 PolarHBondContact NE2-O 3Å; Q8-I34 HydrophobicContact CG-CD1 4.46Å
9	E	94.5	Very high	94.6	Very high	140 Å²	140	71 Å²	71	65%	0.654	35%	0.351	S	S	*	.	S	Bend	trans	-117.9	171.8	171.7	-65	-167.2	163.8	0	0	110.9	A7 E32	A7-E9 VanDerWaalsContact C-N 3.34Å; A7-E9 PolarHBondContact N-O 3.36Å; E9-E32 PolarHBondContact N-OE1 2.87Å
10	L	96.3	Very high	94.7	Very high	117 Å²	117	69.1 Å²	69.1	61%	0.613	34%	0.343	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.1	119.5	174.1	-177.6	67.1	0	0	0	109.1	F4 R6	F4-L10 HydrophobicContact CB-CD1 4.18Å; R6-L10 HydrophobicContact CB-CD1 4.26Å
11	H	96.6	Very high	94.8	Very high	33 Å²	33	65.8 Å²	65.8	15%	0.153	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	151.1	177.4	-58.3	-58.9	0	0	0	111.6	F4 V5 L31 E32	F4-H11 CarbonylContact C-O 3.57Å; F4-H11 WeakPolarHBondContact CA-O 3.25Å; V5-H11 PolarHBondContact N-O 3.38Å; V5-H11 PolarHBondContact O-N 3.23Å; H11-L31 HydrophobicContact CB-CD1 4.25Å; H11-E32 IonicContact CD2-OE1 3.78Å; H11-E32 IonicContact NE2-OE1 3.27Å; H11-E32 PolarHBondContact NE2-OE1 2.83Å
12	T	96.8	Very high	95	Very high	86 Å²	86	64.5 Å²	64.5	53%	0.528	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	125.5	169.6	48.2	0	0	0	0	109.8	L3 F4	L3-T12 CarbonylContact O-C 3.53Å; L3-T12 WeakPolarHBondContact O-CA 3.38Å; F4-T12 HydrophobicContact CD1-CG2 3.66Å; F4-T12 HydrophobicContact CE1-CG2 3.59Å
13	L	95.3	Very high	95.1	Very high	20 Å²	20	65.7 Å²	65.7	11%	0.105	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	134.3	177.5	-61.6	-176.2	0	0	0	110.6	Q2 L3 V5 V15 I24 H27 L31	Q2-L13 CarbonylContact C-O 3.58Å; Q2-L13 WeakPolarHBondContact CA-O 3.45Å; L3-L13 PolarHBondContact N-O 3.36Å; L3-L13 PolarHBondContact O-N 3.49Å; V5-L13 HydrophobicContact CG2-CD1 3.61Å; V5-L13 HydrophobicContact CG2-CG 4.01Å; L13-V15 HydrophobicContact CB-CG1 4.08Å; L13-I24 HydrophobicContact CD1-CD1 4.32Å; L13-H27 HydrophobicContact CD1-CB 4.41Å; L13-L31 HydrophobicContact CD2-CD1 4.33Å
14	E	95.3	Very high	95.1	Very high	140 Å²	140	65.7 Å²	65.7	65%	0.654	33%	0.332	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.8	119.9	165.6	-79.5	-64.8	163.5	0	0	109.2	M1 Q2	M1-E14 PolarHBondContact N-OE2 3.01Å; Q2-E14 WeakPolarHBondContact CB-OE1 3.24Å
15	V	94.1	Very high	95	Very high	12 Å²	12	63.5 Å²	63.5	7%	0.073	32%	0.323	C	S	.	.			trans	-132.6	156.8	-175.5	-57.6	0	0	0	0	110.8	M1 L3 L13 E19 I24 L54	M1-V15 HydrophobicContact CE-CG2 4.19Å; M1-V15 HydrophobicContact CG-CG2 3.64Å; M1-V15 WeakPolarHBondContact CG-O 3.4Å; M1-V15 PolarHBondContact N-O 3.22Å; M1-V15 WeakPolarHBondContact O-CG2 3.27Å; M1-V15 PolarHBondContact O-N 3.11Å; M1-V15 VanDerWaalsContact O-O 3.12Å; L3-V15 HydrophobicContact CD1-CG1 4.49Å; L3-V15 HydrophobicContact CD1-CG2 3.58Å; L3-V15 HydrophobicContact CG-CG2 3.84Å; L13-V15 HydrophobicContact CB-CG1 4.08Å; V15-E19 WeakPolarHBondContact CB-OE2 3.14Å; V15-I24 HydrophobicContact CG1-CD1 4.01Å; V15-L54 HydrophobicContact CB-CD1 4.23Å; V15-L54 HydrophobicContact CG1-CD1 4.46Å; V15-L54 HydrophobicContact CG2-CD1 3.89Å
16	T	92.4	Very high	95	Very high	106 Å²	106	65.9 Å²	65.9	65%	0.65	34%	0.342	S	S	*	.			trans	-84.7	-15.7	176.6	63.1	0	0	0	0	112.9	Q18 E19	T16-Q18 VanDerWaalsContact C-N 3.27Å; T16-Q18 PolarHBondContact OG1-N 3.45Å; T16-E19 WeakPolarHBondContact CB-OE1 3.37Å; T16-E19 PolarHBondContact N-OE1 2.64Å; T16-E19 PolarHBondContact N-OE2 3.24Å; T16-E19 PolarHBondContact OG1-OE1 3.25Å; T16-E19 PolarHBondContact OG1-OE2 2.76Å
17	G	88.4	Confident	94.9	Very high	6 Å²	6	63.4 Å²	63.4	6%	0.062	34%	0.337	C	S	.	.	S	Bend	trans	86.4	-5.7	-174.3	0	0	0	0	0	113.4	E19 G55	G17-E19 PolarHBondContact N-OE2 2.82Å; G17-G55 PolarHBondContact O-N 2.87Å
18	Q	92.9	Very high	95	Very high	143 Å²	143	62.3 Å²	62.3	67%	0.668	33%	0.328	S	S	*	.			trans	-95.5	-7.4	174.6	-62.9	-61.6	-40.7	0	0	112.2	T16	T16-Q18 VanDerWaalsContact C-N 3.27Å; T16-Q18 PolarHBondContact OG1-N 3.45Å
19	E	94.9	Very high	95.1	Very high	32 Å²	32	56.7 Å²	56.7	15%	0.15	31%	0.305	C	S	.	.			trans	-61.8	146	176.8	-64.2	76.3	-169.7	0	0	110.7	V15 T16 G17 Q23 T53 L54	V15-E19 WeakPolarHBondContact CB-OE2 3.14Å; T16-E19 WeakPolarHBondContact CB-OE1 3.37Å; T16-E19 PolarHBondContact N-OE1 2.64Å; T16-E19 PolarHBondContact N-OE2 3.24Å; T16-E19 PolarHBondContact OG1-OE1 3.25Å; T16-E19 PolarHBondContact OG1-OE2 2.76Å; G17-E19 PolarHBondContact N-OE2 2.82Å; E19-Q23 HydrophobicContact CB-CB 4.41Å; E19-Q23 VanDerWaalsContact CB-OE1 3.29Å; E19-T53 CarbonylContact O-C 3.6Å; E19-T53 WeakPolarHBondContact O-CA 3.46Å; E19-L54 HydrophobicContact CB-CD1 4.1Å; E19-L54 WeakPolarHBondContact O-CG 3.49Å; E19-L54 PolarHBondContact O-N 3.27Å
20	T	97.1	Very high	95.2	Very high	33 Å²	33	54.4 Å²	54.4	20%	0.202	31%	0.305	C	S	.	.	B	Isolated β-bridge	trans	-83.6	158.9	172.6	62.3	0	0	0	0	111.1	A22 Q23 I24 A52 T53	T20-A22 PolarHBondContact O-N 3.38Å; T20-Q23 WeakPolarHBondContact O-CB 3.48Å; T20-Q23 PolarHBondContact O-N 2.99Å; T20-Q23 WeakPolarHBondContact OG1-CG 3.22Å; T20-Q23 PolarHBondContact OG1-N 3.39Å; T20-I24 PolarHBondContact O-N 3.24Å; T20-A52 WeakPolarHBondContact CA-O 3.5Å; T20-T53 HydrophobicContact CG2-CG2 4.27Å
21	V	96.6	Very high	95.1	Very high	0 Å²	0	53.1 Å²	53.1	0%	0	30%	0.298	C	S	.	.	H	α-helix	trans	-59.9	-34.9	174.3	178.3	0	0	0	0	111.1	Q23 I24 K25 V41 L48 E49 A52	V21-Q23 VanDerWaalsContact C-N 3.29Å; V21-Q23 PolarHBondContact O-N 2.88Å; V21-I24 PolarHBondContact O-N 3.03Å; V21-I24 VanDerWaalsContact O-N 3.15Å; V21-K25 WeakPolarHBondContact O-CG 3.45Å; V21-K25 PolarHBondContact O-N 2.87Å; V21-V41 HydrophobicContact CG1-CB 3.77Å; V21-V41 HydrophobicContact CG1-CG1 4.26Å; V21-V41 HydrophobicContact CG1-CG2 3.9Å; V21-L48 HydrophobicContact CG1-CB 4.16Å; V21-L48 HydrophobicContact CG2-CB 3.76Å; V21-L48 HydrophobicContact CG2-CD1 4.06Å; V21-E49 WeakPolarHBondContact CB-O 3.31Å; V21-E49 WeakPolarHBondContact CG2-O 3.39Å; V21-A52 PolarHBondContact N-O 3.47Å
22	A	96.9	Very high	94.9	Very high	40 Å²	40	52.9 Å²	52.9	33%	0.331	30%	0.297	S	S	.	.	H	α-helix	trans	-57.6	-39.5	172.9	0	0	0	0	0	113	T20 K25 A26 D50	T20-A22 PolarHBondContact O-N 3.38Å; A22-K25 PolarHBondContact O-N 2.78Å; A22-A26 PolarHBondContact O-N 3.17Å; A22-D50 HydrophobicContact CB-CB 4.16Å; A22-D50 WeakPolarHBondContact CB-O 3.38Å; A22-D50 PolarHBondContact N-O 2.95Å; A22-D50 VanDerWaalsContact N-O 3.11Å
23	Q	96.4	Very high	94.7	Very high	94 Å²	94	52.1 Å²	52.1	44%	0.439	31%	0.306	S	S	.	.	H	α-helix	trans	-67.2	-40.2	176.6	-70.3	169.8	-20.4	0	0	111.2	E19 T20 V21 K25 A26 H27	E19-Q23 HydrophobicContact CB-CB 4.41Å; E19-Q23 VanDerWaalsContact CB-OE1 3.29Å; T20-Q23 WeakPolarHBondContact O-CB 3.48Å; T20-Q23 PolarHBondContact O-N 2.99Å; T20-Q23 WeakPolarHBondContact OG1-CG 3.22Å; T20-Q23 PolarHBondContact OG1-N 3.39Å; V21-Q23 VanDerWaalsContact C-N 3.29Å; V21-Q23 PolarHBondContact O-N 2.88Å; Q23-K25 VanDerWaalsContact C-N 3.34Å; Q23-K25 PolarHBondContact O-N 3.14Å; Q23-A26 WeakPolarHBondContact O-CB 3.42Å; Q23-A26 PolarHBondContact O-N 3.35Å; Q23-H27 PolarHBondContact O-CD2 3.04Å; Q23-H27 PolarHBondContact O-N 2.97Å
24	I	95.8	Very high	94.5	Very high	1 Å²	1	52.9 Å²	52.9	1%	0.005	31%	0.31	C	S	.	.	H	α-helix	trans	-62.4	-42.4	174.5	-59.1	-65.6	0	0	0	111.1	L13 V15 T20 V21 A26 H27 V28 L54 L65	L13-I24 HydrophobicContact CD1-CD1 4.32Å; V15-I24 HydrophobicContact CG1-CD1 4.01Å; T20-I24 PolarHBondContact O-N 3.24Å; V21-I24 PolarHBondContact O-N 3.03Å; V21-I24 VanDerWaalsContact O-N 3.15Å; I24-A26 VanDerWaalsContact C-N 3.31Å; I24-A26 PolarHBondContact O-N 2.9Å; I24-H27 WeakPolarHBondContact O-CB 3.43Å; I24-H27 PolarHBondContact O-N 2.83Å; I24-V28 HydrophobicContact CG2-CG2 4.48Å; I24-V28 WeakPolarHBondContact O-CG2 3.41Å; I24-V28 PolarHBondContact O-N 3.3Å; I24-L54 HydrophobicContact CD1-CD1 3.92Å; I24-L54 HydrophobicContact CG1-CD1 4.16Å; I24-L54 HydrophobicContact CG1-CD2 4.1Å; I24-L54 HydrophobicContact CG1-CG 4.39Å; I24-L65 HydrophobicContact CG2-CD1 4.36Å
25	K	96.3	Very high	94.4	Very high	15 Å²	15	47.8 Å²	47.8	7%	0.065	29%	0.291	C	S	.	.	H	α-helix	trans	-59.8	-41.3	174.6	-72	-179.9	173.9	-175.7	0	112.6	V21 A22 Q23 V28 A29 P36 Q39 V41 D50	V21-K25 WeakPolarHBondContact O-CG 3.45Å; V21-K25 PolarHBondContact O-N 2.87Å; A22-K25 PolarHBondContact O-N 2.78Å; Q23-K25 VanDerWaalsContact C-N 3.34Å; Q23-K25 PolarHBondContact O-N 3.14Å; K25-V28 PolarHBondContact O-N 3.2Å; K25-A29 WeakPolarHBondContact O-CB 3.27Å; K25-A29 PolarHBondContact O-N 3.28Å; K25-P36 HydrophobicContact CB-CB 4.14Å; K25-Q39 HydrophobicContact CD-CB 4.27Å; K25-Q39 VanDerWaalsContact CE-O 3.22Å; K25-Q39 WeakPolarHBondContact CE-O 3.32Å; K25-Q39 HydrophobicContact CG-CB 4.11Å; K25-Q39 PolarHBondContact NZ-O 2.96Å; K25-Q39 VanDerWaalsContact NZ-O 3.07Å; K25-Q39 PolarHBondContact O-NE2 2.91Å; K25-Q39 PolarHBondContact O-OE1 3.48Å; K25-Q39 VanDerWaalsContact O-OE1 3.11Å; K25-V41 HydrophobicContact CD-CG2 4.35Å; K25-V41 HydrophobicContact CG-CG2 3.51Å; K25-D50 WeakPolarHBondContact CD-OD1 3.45Å; K25-D50 WeakPolarHBondContact CE-OD1 3.35Å; K25-D50 IonicContact NZ-OD1 2.63Å; K25-D50 PolarHBondContact NZ-OD1 2.67Å; K25-D50 IonicContact NZ-OD2 3.36Å; K25-D50 PolarHBondContact NZ-OD2 2.76Å
26	A	96.4	Very high	94.4	Very high	50 Å²	50	49.6 Å²	49.6	41%	0.413	30%	0.304	S	S	.	.	H	α-helix	trans	-63.5	-41.2	176.1	0	0	0	0	0	112.1	A22 Q23 I24 A29 S30	A22-A26 PolarHBondContact O-N 3.17Å; Q23-A26 WeakPolarHBondContact O-CB 3.42Å; Q23-A26 PolarHBondContact O-N 3.35Å; I24-A26 VanDerWaalsContact C-N 3.31Å; I24-A26 PolarHBondContact O-N 2.9Å; A26-A29 WeakPolarHBondContact O-CB 3.42Å; A26-A29 PolarHBondContact O-N 3.11Å; A26-S30 PolarHBondContact O-N 3.43Å; A26-S30 VanDerWaalsContact O-N 3.1Å
27	H	94.9	Very high	94.4	Very high	102 Å²	102	51.2 Å²	51.2	47%	0.472	30%	0.304	S	S	.	.	H	α-helix	trans	-60.4	-49.3	173.5	-85.2	-76.7	0	0	0	112	L13 Q23 I24 A29 S30 L31	L13-H27 HydrophobicContact CD1-CB 4.41Å; Q23-H27 PolarHBondContact O-CD2 3.04Å; Q23-H27 PolarHBondContact O-N 2.97Å; I24-H27 WeakPolarHBondContact O-CB 3.43Å; I24-H27 PolarHBondContact O-N 2.83Å; H27-A29 VanDerWaalsContact C-N 3.28Å; H27-A29 PolarHBondContact O-N 2.96Å; H27-S30 PolarHBondContact O-N 2.92Å; H27-S30 PolarHBondContact O-OG 2.93Å; H27-L31 WeakPolarHBondContact O-CG 3.26Å; H27-L31 PolarHBondContact O-N 3.03Å
28	V	95.1	Very high	94.6	Very high	1 Å²	1	53.7 Å²	53.7	1%	0.006	32%	0.316	C	S	.	.	H	α-helix	trans	-62.7	-36.5	177.2	176.2	0	0	0	0	111.4	V5 A7 I24 K25 S30 L31 E32 V67	V5-V28 HydrophobicContact CG1-CG2 3.72Å; A7-V28 HydrophobicContact CB-CG1 4.23Å; I24-V28 HydrophobicContact CG2-CG2 4.48Å; I24-V28 WeakPolarHBondContact O-CG2 3.41Å; I24-V28 PolarHBondContact O-N 3.3Å; K25-V28 PolarHBondContact O-N 3.2Å; V28-S30 VanDerWaalsContact C-N 3.31Å; V28-S30 PolarHBondContact O-N 3.15Å; V28-L31 PolarHBondContact O-N 3.18Å; V28-L31 VanDerWaalsContact O-N 3.14Å; V28-E32 HydrophobicContact CG1-CG 4.38Å; V28-E32 PolarHBondContact O-N 2.79Å; V28-V67 HydrophobicContact CG1-CG1 4.18Å; V28-V67 HydrophobicContact CG2-CG2 4.26Å
29	A	95.1	Very high	94.6	Very high	19 Å²	19	46.9 Å²	46.9	16%	0.157	28%	0.284	C	S	.	.	H	α-helix	trans	-60.6	-41.2	176.2	0	0	0	0	0	111.9	K25 A26 H27 L31 G33 I34 P36 Q39	K25-A29 WeakPolarHBondContact O-CB 3.27Å; K25-A29 PolarHBondContact O-N 3.28Å; A26-A29 WeakPolarHBondContact O-CB 3.42Å; A26-A29 PolarHBondContact O-N 3.11Å; H27-A29 VanDerWaalsContact C-N 3.28Å; H27-A29 PolarHBondContact O-N 2.96Å; A29-L31 VanDerWaalsContact C-N 3.32Å; A29-L31 PolarHBondContact O-N 2.84Å; A29-G33 VanDerWaalsContact O-CA 3.25Å; A29-G33 WeakPolarHBondContact O-CA 3.44Å; A29-G33 PolarHBondContact O-N 2.9Å; A29-I34 VanDerWaalsContact CA-O 3.22Å; A29-I34 WeakPolarHBondContact CA-O 3.35Å; A29-I34 WeakPolarHBondContact CB-O 3.35Å; A29-P36 HydrophobicContact CB-CG 3.95Å; A29-Q39 VanDerWaalsContact N-NE2 3.16Å
30	S	95	Very high	94.7	Very high	93 Å²	93	46.9 Å²	46.9	65%	0.65	29%	0.286	S	S	*	.	H	α-helix	trans	-67.6	-29.7	176.5	73.5	0	0	0	0	114	A26 H27 V28	A26-S30 PolarHBondContact O-N 3.43Å; A26-S30 VanDerWaalsContact O-N 3.1Å; H27-S30 PolarHBondContact O-N 2.92Å; H27-S30 PolarHBondContact O-OG 2.93Å; V28-S30 VanDerWaalsContact C-N 3.31Å; V28-S30 PolarHBondContact O-N 3.15Å
31	L	94.1	Very high	94.6	Very high	89 Å²	89	45.3 Å²	45.3	47%	0.466	28%	0.276	S	S	.	.	H	α-helix	trans	-84.9	-41.5	-177.7	-68.9	174	0	0	0	111.7	H11 L13 H27 V28 A29	H11-L31 HydrophobicContact CB-CD1 4.25Å; L13-L31 HydrophobicContact CD2-CD1 4.33Å; H27-L31 WeakPolarHBondContact O-CG 3.26Å; H27-L31 PolarHBondContact O-N 3.03Å; V28-L31 PolarHBondContact O-N 3.18Å; V28-L31 VanDerWaalsContact O-N 3.14Å; A29-L31 VanDerWaalsContact C-N 3.32Å; A29-L31 PolarHBondContact O-N 2.84Å
32	E	93.2	Very high	94.7	Very high	29 Å²	29	46.7 Å²	46.7	14%	0.136	28%	0.284	C	S	.	.	H	α-helix	trans	-113.7	-7.8	-169.5	-60.6	-155.3	157.2	0	0	114.8	A7 Q8 E9 H11 V28 I34	A7-E32 WeakPolarHBondContact CB-OE1 3.47Å; A7-E32 WeakPolarHBondContact CB-OE2 3.43Å; Q8-E32 WeakPolarHBondContact CA-OE1 3.41Å; Q8-E32 WeakPolarHBondContact CB-OE1 3.48Å; Q8-E32 WeakPolarHBondContact CB-OE2 3.42Å; Q8-E32 WeakPolarHBondContact CG-OE2 3.48Å; Q8-E32 VanDerWaalsContact N-CD 3.26Å; Q8-E32 PolarHBondContact N-OE1 2.68Å; Q8-E32 PolarHBondContact N-OE2 2.75Å; Q8-E32 PolarHBondContact NE2-O 3Å; E9-E32 PolarHBondContact N-OE1 2.87Å; H11-E32 IonicContact CD2-OE1 3.78Å; H11-E32 IonicContact NE2-OE1 3.27Å; H11-E32 PolarHBondContact NE2-OE1 2.83Å; V28-E32 HydrophobicContact CG1-CG 4.38Å; V28-E32 PolarHBondContact O-N 2.79Å; E32-I34 VanDerWaalsContact C-N 3.29Å; E32-I34 HydrophobicContact CB-CG1 4.44Å; E32-I34 PolarHBondContact O-N 2.91Å
33	G	91.8	Very high	94.6	Very high	70 Å²	70	46.5 Å²	46.5	72%	0.722	28%	0.277	S	S	*	.			trans	73.4	13.9	178.6	0	0	0	0	0	115.2	A29	A29-G33 VanDerWaalsContact O-CA 3.25Å; A29-G33 WeakPolarHBondContact O-CA 3.44Å; A29-G33 PolarHBondContact O-N 2.9Å
34	I	91.1	Very high	94.5	Very high	35 Å²	35	46.6 Å²	46.6	18%	0.179	29%	0.294	C	S	.	.			trans	-87.6	126.6	173.5	-54.4	175.9	0	0	0	108.7	Q8 A29 E32 D38 Q39	Q8-I34 HydrophobicContact CG-CD1 4.46Å; A29-I34 VanDerWaalsContact CA-O 3.22Å; A29-I34 WeakPolarHBondContact CA-O 3.35Å; A29-I34 WeakPolarHBondContact CB-O 3.35Å; E32-I34 VanDerWaalsContact C-N 3.29Å; E32-I34 HydrophobicContact CB-CG1 4.44Å; E32-I34 PolarHBondContact O-N 2.91Å; I34-D38 HydrophobicContact CG2-CB 4Å; I34-Q39 HydrophobicContact CB-CG 4.12Å; I34-Q39 HydrophobicContact CG2-CG 3.66Å; I34-Q39 PolarHBondContact O-NE2 3.36Å
35	A	92.9	Very high	94.3	Very high	33 Å²	33	49 Å²	49	27%	0.273	32%	0.318	S	S	.	.			trans	-60	142.2	178.4	0	0	0	0	0	111.6	E37 D38 Q39	A35-E37 VanDerWaalsContact C-N 3.26Å; A35-E37 HydrophobicContact CB-CG 4.13Å; A35-E37 PolarHBondContact O-N 3.39Å; A35-D38 WeakPolarHBondContact O-CA 3.49Å; A35-D38 PolarHBondContact O-N 3.07Å; A35-Q39 WeakPolarHBondContact O-CG 3.38Å; A35-Q39 PolarHBondContact O-N 3.36Å
36	P	94.5	Very high	94.3	Very high	51 Å²	51	52.5 Å²	52.5	33%	0.331	34%	0.341	S	S	.	.	G	3₁₀ helix	trans	-55.1	-36.8	-179.3	-27.1	35.4	0	0	0	114.1	K25 A29 D38 Q39	K25-P36 HydrophobicContact CB-CB 4.14Å; A29-P36 HydrophobicContact CB-CG 3.95Å; P36-D38 PolarHBondContact O-N 2.95Å; P36-Q39 PolarHBondContact O-N 2.63Å; P36-Q39 VanDerWaalsContact O-N 3.11Å
37	E	92.2	Very high	94.3	Very high	139 Å²	139	53.9 Å²	53.9	65%	0.65	35%	0.346	S	S	*	.	G	3₁₀ helix	trans	-62.8	-27.7	175.2	55.6	-100.3	-156.9	0	0	114.1	A35 Q39	A35-E37 VanDerWaalsContact C-N 3.26Å; A35-E37 HydrophobicContact CB-CG 4.13Å; A35-E37 PolarHBondContact O-N 3.39Å; E37-Q39 VanDerWaalsContact C-N 3.33Å
38	D	92.6	Very high	94.3	Very high	59 Å²	59	50.2 Å²	50.2	32%	0.316	33%	0.33	S	S	.	.	G	3₁₀ helix	trans	-90.1	0.5	178.3	-70.7	-31.8	0	0	0	111.8	I34 A35 P36 G69 R70	I34-D38 HydrophobicContact CG2-CB 4Å; A35-D38 WeakPolarHBondContact O-CA 3.49Å; A35-D38 PolarHBondContact O-N 3.07Å; P36-D38 PolarHBondContact O-N 2.95Å; D38-G69 CarbonylContact O-C 3.43Å; D38-G69 VanDerWaalsContact O-CA 3.29Å; D38-G69 WeakPolarHBondContact O-CA 3.48Å; D38-R70 PolarHBondContact O-N 2.93Å
39	Q	94.6	Very high	94.4	Very high	0 Å²	0	57.3 Å²	57.3	0%	0	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	141.1	177.9	-65.3	177	28.3	0	0	112.4	K25 A29 I34 A35 P36 E37 V67	K25-Q39 HydrophobicContact CD-CB 4.27Å; K25-Q39 VanDerWaalsContact CE-O 3.22Å; K25-Q39 WeakPolarHBondContact CE-O 3.32Å; K25-Q39 HydrophobicContact CG-CB 4.11Å; K25-Q39 PolarHBondContact NZ-O 2.96Å; K25-Q39 VanDerWaalsContact NZ-O 3.07Å; K25-Q39 PolarHBondContact O-NE2 2.91Å; K25-Q39 PolarHBondContact O-OE1 3.48Å; K25-Q39 VanDerWaalsContact O-OE1 3.11Å; A29-Q39 VanDerWaalsContact N-NE2 3.16Å; I34-Q39 HydrophobicContact CB-CG 4.12Å; I34-Q39 HydrophobicContact CG2-CG 3.66Å; I34-Q39 PolarHBondContact O-NE2 3.36Å; A35-Q39 WeakPolarHBondContact O-CG 3.38Å; A35-Q39 PolarHBondContact O-N 3.36Å; P36-Q39 PolarHBondContact O-N 2.63Å; P36-Q39 VanDerWaalsContact O-N 3.11Å; E37-Q39 VanDerWaalsContact C-N 3.33Å; Q39-V67 HydrophobicContact CB-CG1 3.96Å; Q39-V67 HydrophobicContact CG-CG1 4.09Å
40	V	95.4	Very high	94.4	Very high	31 Å²	31	59.3 Å²	59.3	19%	0.188	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	112.3	167.1	-173.5	0	0	0	0	108	L42 P47 V67 A68 R70	V40-L42 HydrophobicContact CG1-CD1 4.48Å; V40-L42 HydrophobicContact CG1-CD2 4.33Å; V40-L42 HydrophobicContact CG1-CG 4.16Å; V40-P47 HydrophobicContact CG1-CB 3.89Å; V40-V67 WeakPolarHBondContact O-CA 3.25Å; V40-A68 PolarHBondContact N-O 2.89Å; V40-A68 PolarHBondContact O-N 3.35Å; V40-R70 HydrophobicContact CG2-CG 3.74Å
41	V	96.3	Very high	94.4	Very high	1 Å²	1	62.8 Å²	62.8	1%	0.006	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88	130.9	174.8	-176	0	0	0	0	108.3	V21 K25 P47 L48 L65 E66 V67	V21-V41 HydrophobicContact CG1-CB 3.77Å; V21-V41 HydrophobicContact CG1-CG1 4.26Å; V21-V41 HydrophobicContact CG1-CG2 3.9Å; K25-V41 HydrophobicContact CD-CG2 4.35Å; K25-V41 HydrophobicContact CG-CG2 3.51Å; V41-P47 WeakPolarHBondContact O-CA 3.05Å; V41-L48 HydrophobicContact CG1-CD1 4.37Å; V41-L48 PolarHBondContact O-N 3.22Å; V41-L65 HydrophobicContact CG1-CB 4.27Å; V41-L65 HydrophobicContact CG1-CD1 4.18Å; V41-L65 HydrophobicContact CG1-CD2 4.43Å; V41-E66 CarbonylContact C-O 3.51Å; V41-E66 WeakPolarHBondContact CA-O 3.29Å; V41-V67 HydrophobicContact CG1-CG2 4.5Å; V41-V67 HydrophobicContact CG2-CG1 4.44Å; V41-V67 HydrophobicContact CG2-CG2 4.12Å
42	L	97	Very high	94.5	Very high	29 Å²	29	59.5 Å²	59.5	15%	0.152	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	138.3	-173.6	-60.7	134.4	0	0	0	109.9	V40 G45 T46 P47 E66 A68	V40-L42 HydrophobicContact CG1-CD1 4.48Å; V40-L42 HydrophobicContact CG1-CD2 4.33Å; V40-L42 HydrophobicContact CG1-CG 4.16Å; L42-G45 WeakPolarHBondContact CD2-O 3.38Å; L42-T46 CarbonylContact C-O 3.54Å; L42-T46 VanDerWaalsContact CA-O 3.27Å; L42-T46 WeakPolarHBondContact CA-O 3.22Å; L42-P47 HydrophobicContact CD2-CB 4.15Å; L42-E66 HydrophobicContact CB-CB 4.2Å; L42-E66 HydrophobicContact CD1-CB 4.4Å; L42-E66 PolarHBondContact N-O 2.7Å; L42-E66 PolarHBondContact O-N 3.21Å; L42-A68 HydrophobicContact CD1-CB 4.06Å
43	L	96.1	Very high	94.6	Very high	35 Å²	35	59.3 Å²	59.3	18%	0.183	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	119	165.2	-179.6	65.6	0	0	0	108.4	G45 T46 L48 C57 V59 T63 L65	L43-G45 PolarHBondContact O-N 3.22Å; L43-G45 VanDerWaalsContact O-N 3.17Å; L43-T46 PolarHBondContact N-O 3.02Å; L43-T46 WeakPolarHBondContact O-CB 3.46Å; L43-T46 PolarHBondContact O-N 3Å; L43-L48 HydrophobicContact CB-CD1 4.17Å; L43-L48 HydrophobicContact CB-CD2 4.1Å; L43-L48 HydrophobicContact CB-CG 4.33Å; L43-C57 WeakPolarHBondContact CD2-O 3.45Å; L43-V59 HydrophobicContact CD2-CG2 4.06Å; L43-T63 HydrophobicContact CD1-CG2 3.46Å; L43-T63 VanDerWaalsContact CD1-CG2 3.46Å; L43-L65 HydrophobicContact CB-CD2 4.21Å; L43-L65 HydrophobicContact CD1-CD2 4.04Å
44	A	93.6	Very high	94.8	Very high	97 Å²	97	56 Å²	56	80%	0.802	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.6	40.7	-176.8	0	0	0	0	0	113.3	T46	A44-T46 VanDerWaalsContact C-N 3.26Å; A44-T46 PolarHBondContact O-N 3.41Å
45	G	93.1	Very high	94.8	Very high	50 Å²	50	56.5 Å²	56.5	52%	0.515	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	77.5	0	-178.4	0	0	0	0	0	115.5	L42 L43	L42-G45 WeakPolarHBondContact CD2-O 3.38Å; L43-G45 PolarHBondContact O-N 3.22Å; L43-G45 VanDerWaalsContact O-N 3.17Å
46	T	94.8	Very high	94.9	Very high	90 Å²	90	61.9 Å²	61.9	55%	0.552	36%	0.362	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96	123.8	176.2	-54.3	0	0	0	0	110	L42 L43 A44	L42-T46 CarbonylContact C-O 3.54Å; L42-T46 VanDerWaalsContact CA-O 3.27Å; L42-T46 WeakPolarHBondContact CA-O 3.22Å; L43-T46 PolarHBondContact N-O 3.02Å; L43-T46 WeakPolarHBondContact O-CB 3.46Å; L43-T46 PolarHBondContact O-N 3Å; A44-T46 VanDerWaalsContact C-N 3.26Å; A44-T46 PolarHBondContact O-N 3.41Å
47	P	96.2	Very high	94.8	Very high	78 Å²	78	60.8 Å²	60.8	51%	0.506	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	138.9	-179.7	28.6	-34.2	0	0	0	110.3	V40 V41 L42	V40-P47 HydrophobicContact CG1-CB 3.89Å; V41-P47 WeakPolarHBondContact O-CA 3.05Å; L42-P47 HydrophobicContact CD2-CB 4.15Å
48	L	96.1	Very high	94.7	Very high	25 Å²	25	56.5 Å²	56.5	13%	0.131	35%	0.349	C	S	.	.	P	Polyproline II helix	trans	-98.7	147	177.5	-54.2	-179.1	0	0	0	111.1	V21 V41 L43 C57 L65	V21-L48 HydrophobicContact CG1-CB 4.16Å; V21-L48 HydrophobicContact CG2-CB 3.76Å; V21-L48 HydrophobicContact CG2-CD1 4.06Å; V41-L48 HydrophobicContact CG1-CD1 4.37Å; V41-L48 PolarHBondContact O-N 3.22Å; L43-L48 HydrophobicContact CB-CD1 4.17Å; L43-L48 HydrophobicContact CB-CD2 4.1Å; L43-L48 HydrophobicContact CB-CG 4.33Å; L48-C57 HydrophobicContact CD1-CB 3.94Å; L48-C57 HydrophobicContact CD2-CB 3.96Å; L48-L65 HydrophobicContact CD1-CD2 4.27Å
49	E	95.9	Very high	94.8	Very high	150 Å²	150	54.1 Å²	54.1	70%	0.701	34%	0.336	S	S	*	.	P	Polyproline II helix	trans	-83.4	144.9	178.4	-64.9	-64.6	161.3	0	0	111.4	V21 E51 A52	V21-E49 WeakPolarHBondContact CB-O 3.31Å; V21-E49 WeakPolarHBondContact CG2-O 3.39Å; E49-E51 VanDerWaalsContact C-N 3.3Å; E49-E51 PolarHBondContact O-N 2.8Å; E49-A52 PolarHBondContact O-N 2.97Å
50	D	95.6	Very high	94.8	Very high	62 Å²	62	61 Å²	61	33%	0.332	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.5	-33.2	-171.2	-76.5	-15.8	0	0	0	114	A22 K25	A22-D50 HydrophobicContact CB-CB 4.16Å; A22-D50 WeakPolarHBondContact CB-O 3.38Å; A22-D50 PolarHBondContact N-O 2.95Å; A22-D50 VanDerWaalsContact N-O 3.11Å; K25-D50 WeakPolarHBondContact CD-OD1 3.45Å; K25-D50 WeakPolarHBondContact CE-OD1 3.35Å; K25-D50 IonicContact NZ-OD1 2.63Å; K25-D50 PolarHBondContact NZ-OD1 2.67Å; K25-D50 IonicContact NZ-OD2 3.36Å; K25-D50 PolarHBondContact NZ-OD2 2.76Å
51	E	95.6	Very high	94.7	Very high	166 Å²	166	62.4 Å²	62.4	78%	0.776	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.3	-14.2	-178.6	-59.2	-57.5	145.1	0	0	113.5	E49	E49-E51 VanDerWaalsContact C-N 3.3Å; E49-E51 PolarHBondContact O-N 2.8Å
52	A	95.9	Very high	94.5	Very high	19 Å²	19	67.5 Å²	67.5	16%	0.157	41%	0.41	C	S	.	.	S	Bend	trans	-75.7	139.3	-178.5	0	0	0	0	0	110.6	T20 V21 E49 C57	T20-A52 WeakPolarHBondContact CA-O 3.5Å; V21-A52 PolarHBondContact N-O 3.47Å; E49-A52 PolarHBondContact O-N 2.97Å; A52-C57 WeakPolarHBondContact CB-SG 3.17Å
53	T	96	Very high	94.5	Very high	25 Å²	25	67.6 Å²	67.6	15%	0.153	41%	0.412	C	S	.	.	B	Isolated β-bridge	trans	-79.2	154.3	171.6	66.9	0	0	0	0	111	E19 T20 G55 Q56 C57	E19-T53 CarbonylContact O-C 3.6Å; E19-T53 WeakPolarHBondContact O-CA 3.46Å; T20-T53 HydrophobicContact CG2-CG2 4.27Å; T53-G55 PolarHBondContact O-N 3.38Å; T53-Q56 VanDerWaalsContact N-OE1 3.1Å; T53-Q56 WeakPolarHBondContact O-CB 3.09Å; T53-Q56 PolarHBondContact O-N 3.19Å; T53-Q56 VanDerWaalsContact OG1-CG 3.25Å; T53-Q56 WeakPolarHBondContact OG1-CG 3.4Å; T53-Q56 PolarHBondContact OG1-N 3.39Å; T53-C57 PolarHBondContact O-N 2.67Å; T53-C57 PolarHBondContact O-SG 3.21Å; T53-C57 VanDerWaalsContact O-SG 3.39Å
54	L	94.6	Very high	94.5	Very high	1 Å²	1	69.1 Å²	69.1	1%	0.005	42%	0.423	C	S	.	.	T	Hydrogen-bonded Turn	trans	-53.8	-42.3	177.2	-70.7	177	0	0	0	112.2	L3 V15 E19 I24 Q56 C57 G58 V59 L65	L3-L54 HydrophobicContact CD1-CD1 3.87Å; V15-L54 HydrophobicContact CB-CD1 4.23Å; V15-L54 HydrophobicContact CG1-CD1 4.46Å; V15-L54 HydrophobicContact CG2-CD1 3.89Å; E19-L54 HydrophobicContact CB-CD1 4.1Å; E19-L54 WeakPolarHBondContact O-CG 3.49Å; E19-L54 PolarHBondContact O-N 3.27Å; I24-L54 HydrophobicContact CD1-CD1 3.92Å; I24-L54 HydrophobicContact CG1-CD1 4.16Å; I24-L54 HydrophobicContact CG1-CD2 4.1Å; I24-L54 HydrophobicContact CG1-CG 4.39Å; L54-Q56 PolarHBondContact O-N 2.87Å; L54-C57 PolarHBondContact O-N 2.82Å; L54-G58 PolarHBondContact O-N 3.47Å; L54-V59 HydrophobicContact CB-CB 4.13Å; L54-V59 HydrophobicContact CD2-CB 4.23Å; L54-V59 HydrophobicContact CD2-CG1 4.25Å; L54-V59 HydrophobicContact CD2-CG2 4Å; L54-V59 VanDerWaalsContact O-CB 3.31Å; L54-V59 WeakPolarHBondContact O-CB 3.42Å; L54-V59 PolarHBondContact O-N 3.11Å; L54-L65 HydrophobicContact CD2-CD1 4.1Å
55	G	92.3	Very high	94.7	Very high	46 Å²	46	64.5 Å²	64.5	47%	0.474	39%	0.385	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.4	-38.6	175	0	0	0	0	0	113.8	G17 T53 C57 G58	G17-G55 PolarHBondContact O-N 2.87Å; T53-G55 PolarHBondContact O-N 3.38Å; G55-C57 VanDerWaalsContact C-N 3.3Å; G55-C57 PolarHBondContact O-N 3.14Å; G55-G58 PolarHBondContact O-N 3.36Å
56	Q	93.7	Very high	94.9	Very high	146 Å²	146	66.1 Å²	66.1	68%	0.682	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.2	-31.8	176.2	-72.9	168.4	-10	0	0	112.4	T53 L54 G58	T53-Q56 VanDerWaalsContact N-OE1 3.1Å; T53-Q56 WeakPolarHBondContact O-CB 3.09Å; T53-Q56 PolarHBondContact O-N 3.19Å; T53-Q56 VanDerWaalsContact OG1-CG 3.25Å; T53-Q56 WeakPolarHBondContact OG1-CG 3.4Å; T53-Q56 PolarHBondContact OG1-N 3.39Å; L54-Q56 PolarHBondContact O-N 2.87Å; Q56-G58 PolarHBondContact O-N 3.11Å
57	C	92.2	Very high	94.9	Very high	28 Å²	28	62.5 Å²	62.5	19%	0.189	36%	0.357	C	S	.	.	T	Hydrogen-bonded Turn	trans	-76.7	-2.7	176.2	-65.5	0	0	0	0	113.4	L43 L48 A52 T53 L54 G55 V59	L43-C57 WeakPolarHBondContact CD2-O 3.45Å; L48-C57 HydrophobicContact CD1-CB 3.94Å; L48-C57 HydrophobicContact CD2-CB 3.96Å; A52-C57 WeakPolarHBondContact CB-SG 3.17Å; T53-C57 PolarHBondContact O-N 2.67Å; T53-C57 PolarHBondContact O-SG 3.21Å; T53-C57 VanDerWaalsContact O-SG 3.39Å; L54-C57 PolarHBondContact O-N 2.82Å; G55-C57 VanDerWaalsContact C-N 3.3Å; G55-C57 PolarHBondContact O-N 3.14Å; C57-V59 VanDerWaalsContact C-N 3.35Å; C57-V59 HydrophobicContact CB-CG2 3.96Å
58	G	92.1	Very high	94.8	Very high	49 Å²	49	61 Å²	61	51%	0.505	35%	0.35	S	S	.	.	T	Hydrogen-bonded Turn	trans	72.1	28.1	-176.6	0	0	0	0	0	113.2	L54 G55 Q56	L54-G58 PolarHBondContact O-N 3.47Å; G55-G58 PolarHBondContact O-N 3.36Å; Q56-G58 PolarHBondContact O-N 3.11Å
59	V	93.9	Very high	94.5	Very high	8 Å²	8	61.7 Å²	61.7	5%	0.048	36%	0.364	C	S	.	.			trans	-82.9	120.3	177.1	-178.9	0	0	0	0	109.2	M1 L3 L43 L54 C57 T63 L65	M1-V59 HydrophobicContact CE-CG1 4.03Å; L3-V59 HydrophobicContact CD1-CG1 3.77Å; L3-V59 HydrophobicContact CD2-CG1 3.59Å; L3-V59 HydrophobicContact CG-CG1 4.35Å; L43-V59 HydrophobicContact CD2-CG2 4.06Å; L54-V59 HydrophobicContact CB-CB 4.13Å; L54-V59 HydrophobicContact CD2-CB 4.23Å; L54-V59 HydrophobicContact CD2-CG1 4.25Å; L54-V59 HydrophobicContact CD2-CG2 4Å; L54-V59 VanDerWaalsContact O-CB 3.31Å; L54-V59 WeakPolarHBondContact O-CB 3.42Å; L54-V59 PolarHBondContact O-N 3.11Å; C57-V59 VanDerWaalsContact C-N 3.35Å; C57-V59 HydrophobicContact CB-CG2 3.96Å; V59-T63 HydrophobicContact CG1-CG2 4.47Å; V59-L65 HydrophobicContact CG2-CD2 4.01Å
60	E	93.6	Very high	93.9	Very high	144 Å²	144	62.1 Å²	62.1	67%	0.673	36%	0.359	S	S	*	.			trans	-108.1	172.8	-179.7	-63.9	-175.2	173.8	0	0	112	M1 L3 T63	M1-E60 VanDerWaalsContact CE-O 3.27Å; M1-E60 WeakPolarHBondContact CE-O 3.4Å; L3-E60 WeakPolarHBondContact CD2-O 3.48Å; E60-T63 VanDerWaalsContact C-OG1 3.26Å; E60-T63 PolarHBondContact N-OG1 2.78Å; E60-T63 VanDerWaalsContact N-OG1 3.11Å; E60-T63 VanDerWaalsContact O-CB 3.24Å; E60-T63 WeakPolarHBondContact O-CB 3.45Å; E60-T63 PolarHBondContact O-N 3.1Å; E60-T63 PolarHBondContact O-OG1 2.83Å
61	A	93.3	Very high	92.7	Very high	62 Å²	62	67.5 Å²	67.5	51%	0.512	38%	0.384	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.1	141.6	175	0	0	0	0	0	111.4	M1 T63	M1-A61 HydrophobicContact CB-CB 4.16Å; A61-T63 PolarHBondContact O-N 3.04Å
62	L	93.9	Very high	91.3	Very high	107 Å²	107	67.5 Å²	67.5	56%	0.56	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.6	11.6	-178.6	-49.6	175.2	0	0	0	114.7	Q2 F4	Q2-L62 HydrophobicContact CB-CD2 4.28Å; Q2-L62 PolarHBondContact O-N 3.33Å; F4-L62 WeakPolarHBondContact CD2-O 3.49Å; F4-L62 HydrophobicContact CE2-CB 4.15Å; F4-L62 HydrophobicContact CE2-CD2 4.07Å; F4-L62 HydrophobicContact CZ-CD2 4.38Å
63	T	95.6	Very high	89.9	Confident	32 Å²	32	70 Å²	70	20%	0.196	42%	0.416	C	S	.	.	P	Polyproline II helix	trans	-68.3	146.2	173.4	-52	0	0	0	0	110.4	F4 L43 V59 E60 A61	F4-T63 PolarHBondContact N-O 3.31Å; L43-T63 HydrophobicContact CD1-CG2 3.46Å; L43-T63 VanDerWaalsContact CD1-CG2 3.46Å; V59-T63 HydrophobicContact CG1-CG2 4.47Å; E60-T63 VanDerWaalsContact C-OG1 3.26Å; E60-T63 PolarHBondContact N-OG1 2.78Å; E60-T63 VanDerWaalsContact N-OG1 3.11Å; E60-T63 VanDerWaalsContact O-CB 3.24Å; E60-T63 WeakPolarHBondContact O-CB 3.45Å; E60-T63 PolarHBondContact O-N 3.1Å; E60-T63 PolarHBondContact O-OG1 2.83Å; A61-T63 PolarHBondContact O-N 3.04Å
64	T	96.9	Very high	88.4	Confident	67 Å²	67	71.9 Å²	71.9	41%	0.411	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	119.8	172.4	-54.3	0	0	0	0	110.2	F4 R6	F4-T64 HydrophobicContact CB-CG2 4.21Å; F4-T64 CarbonylContact O-C 3.59Å; F4-T64 VanDerWaalsContact O-CA 3.26Å; F4-T64 WeakPolarHBondContact O-CA 3.33Å; R6-T64 HydrophobicContact CB-CG2 4.05Å
65	L	96.8	Very high	86.7	Confident	0 Å²	0	81.4 Å²	81.4	0%	0	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	137	168.1	-65	176.4	0	0	0	109.2	L3 F4 V5 R6 I24 V41 L43 L48 L54 V59	L3-L65 HydrophobicContact CD1-CD1 4.28Å; F4-L65 PolarHBondContact O-N 3.42Å; V5-L65 WeakPolarHBondContact CA-O 3.09Å; R6-L65 PolarHBondContact N-O 3.38Å; I24-L65 HydrophobicContact CG2-CD1 4.36Å; V41-L65 HydrophobicContact CG1-CB 4.27Å; V41-L65 HydrophobicContact CG1-CD1 4.18Å; V41-L65 HydrophobicContact CG1-CD2 4.43Å; L43-L65 HydrophobicContact CB-CD2 4.21Å; L43-L65 HydrophobicContact CD1-CD2 4.04Å; L48-L65 HydrophobicContact CD1-CD2 4.27Å; L54-L65 HydrophobicContact CD2-CD1 4.1Å; V59-L65 HydrophobicContact CG2-CD2 4.01Å
66	E	97.2	Very high	85.2	Confident	83 Å²	83	85.5 Å²	85.5	39%	0.388	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	133.9	172.3	-64	-178.1	160.3	0	0	109.1	R6 V41 L42	R6-E66 CarbonylContact O-C 3.55Å; R6-E66 WeakPolarHBondContact O-CA 3.22Å; V41-E66 CarbonylContact C-O 3.51Å; V41-E66 WeakPolarHBondContact CA-O 3.29Å; L42-E66 HydrophobicContact CB-CB 4.2Å; L42-E66 HydrophobicContact CD1-CB 4.4Å; L42-E66 PolarHBondContact N-O 2.7Å; L42-E66 PolarHBondContact O-N 3.21Å
67	V	96	Very high	83.4	Confident	15 Å²	15	87.6 Å²	87.6	9%	0.091	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	118.3	174.8	-171.2	0	0	0	0	109.1	V5 R6 A7 V28 Q39 V40 V41	V5-V67 HydrophobicContact CG1-CG2 3.58Å; R6-V67 PolarHBondContact O-N 3.38Å; A7-V67 HydrophobicContact CB-CB 3.88Å; V28-V67 HydrophobicContact CG1-CG1 4.18Å; V28-V67 HydrophobicContact CG2-CG2 4.26Å; Q39-V67 HydrophobicContact CB-CG1 3.96Å; Q39-V67 HydrophobicContact CG-CG1 4.09Å; V40-V67 WeakPolarHBondContact O-CA 3.25Å; V41-V67 HydrophobicContact CG1-CG2 4.5Å; V41-V67 HydrophobicContact CG2-CG1 4.44Å; V41-V67 HydrophobicContact CG2-CG2 4.12Å
68	A	92.9	Very high	82.3	Confident	45 Å²	45	89.2 Å²	89.2	37%	0.372	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	135.6	177.2	0	0	0	0	0	110.4	V40 L42	V40-A68 PolarHBondContact N-O 2.89Å; V40-A68 PolarHBondContact O-N 3.35Å; L42-A68 HydrophobicContact CD1-CB 4.06Å
69	G	89.5	Confident	81.3	Confident	40 Å²	40	91.2 Å²	91.2	41%	0.412	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.7	133.1	169	0	0	0	0	0	111.6	D38 M71	D38-G69 CarbonylContact O-C 3.43Å; D38-G69 VanDerWaalsContact O-CA 3.29Å; D38-G69 WeakPolarHBondContact O-CA 3.48Å; G69-M71 PolarHBondContact O-N 3.21Å
70	R	83.5	Confident	80.7	Confident	159 Å²	159	98.1 Å²	98.1	60%	0.6	57%	0.57	S	S	*	*			trans	-70.3	119.4	167.5	-67.1	-175.1	173.1	-167.9	0.1	108	D38 V40	D38-R70 PolarHBondContact O-N 2.93Å; V40-R70 HydrophobicContact CG2-CG 3.74Å
71	M	72	Confident	80.1	Confident	175 Å²	175	95.5 Å²	95.5	86%	0.862	57%	0.574	S	S	*	*			trans	-91.7	115.3	173	-65.8	-171	70.2	0	0	110	G69 G73	G69-M71 PolarHBondContact O-N 3.21Å; M71-G73 PolarHBondContact O-N 3.42Å
72	L	66.3	Low	79.6	Confident	166 Å²	166	101.9 Å²	101.9	87%	0.869	58%	0.584	S	S	*	*	S	Bend	trans	-76.3	115.4	165.7	-67.7	173.5	0	0	0	109.2
73	G	65.1	Low	79.4	Confident	71 Å²	71	100.5 Å²	100.5	73%	0.732	59%	0.589	S	S	*	*			trans	102.2	87.5	172.3	0	0	0	0	0	114.7	M71	M71-G73 PolarHBondContact O-N 3.42Å
74	G	65.3	Low	79.3	Confident	66 Å²	66	101.5 Å²	101.5	68%	0.68	61%	0.605	S	S	*	*			trans	-85.5	145.3	160.1	0	0	0	0	0	110.9	V76	G74-V76 PolarHBondContact O-N 2.97Å
75	K	58.6	Low	79.2	Confident	201 Å²	201	104 Å²	104	87%	0.874	61%	0.611	S	S	*	*			trans	-61.8	97.3	172.4	-162.8	177.5	-169.9	175.3	0	108.9	H77	K75-H77 PolarHBondContact O-N 2.88Å
76	V	60.8	Low	79.1	Confident	131 Å²	131	109.1 Å²	109.1	79%	0.794	64%	0.641	S	S	*	*			trans	-60.4	110	174.3	-179.6	0	0	0	0	107.8	G74 G78	G74-V76 PolarHBondContact O-N 2.97Å; V76-G78 PolarHBondContact O-N 3.06Å
77	H	56.3	Low	78.9	Confident	191 Å²	191	115.7 Å²	115.7	88%	0.884	66%	0.663	S	S	*	*	S	Bend	trans	-74.2	101.9	-176.9	-150.9	-83.5	0	0	0	108.8	K75	K75-H77 PolarHBondContact O-N 2.88Å
78	G	68.1	Low	78.7	Confident	61 Å²	61	118.2 Å²	118.2	63%	0.629	69%	0.692	S	S	*	*			trans	140.8	43.9	-177.1	0	0	0	0	0	114.2	V76	V76-G78 PolarHBondContact O-N 3.06Å
79	S	72.6	Confident	78.9	Confident	92 Å²	92	122.5 Å²	122.5	64%	0.643	70%	0.704	S	S	*	*			trans	-62.4	140.2	-179.2	66.8	0	0	0	0	111.9	A81	S79-A81 PolarHBondContact O-N 3.09Å; S79-A81 VanDerWaalsContact O-N 3.09Å
80	L	79.8	Confident	79.1	Confident	152 Å²	152	124.4 Å²	124.4	80%	0.796	71%	0.707	S	S	*	*	G	3₁₀ helix	trans	-73.5	7.2	176.3	-65.8	175.5	0	0	0	113.4	R82 A83	L80-R82 PolarHBondContact O-N 3.25Å; L80-A83 VanDerWaalsContact O-CB 3.28Å; L80-A83 WeakPolarHBondContact O-CB 3.28Å; L80-A83 PolarHBondContact O-N 3.26Å
81	A	80.9	Confident	79.7	Confident	90 Å²	90	122.2 Å²	122.2	74%	0.744	71%	0.714	S	S	*	*	G	3₁₀ helix	trans	-58.4	-19.1	-175.1	0	0	0	0	0	114.3	S79	S79-A81 PolarHBondContact O-N 3.09Å; S79-A81 VanDerWaalsContact O-N 3.09Å
82	R	84.2	Confident	80.8	Confident	195 Å²	195	123.7 Å²	123.7	74%	0.736	72%	0.716	S	S	*	*	G	3₁₀ helix	trans	-104.9	4.3	179.3	-62.5	-170.1	-67.7	-123	1.5	114	L80 G84 K85	L80-R82 PolarHBondContact O-N 3.25Å; R82-G84 PolarHBondContact O-N 3.25Å; R82-K85 WeakPolarHBondContact O-CB 3.48Å; R82-K85 PolarHBondContact O-N 2.97Å
83	A	89.7	Confident	82.2	Confident	79 Å²	79	121.7 Å²	121.7	65%	0.653	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.3	124.5	179.8	0	0	0	0	0	110.5	L80 K85	L80-A83 VanDerWaalsContact O-CB 3.28Å; L80-A83 WeakPolarHBondContact O-CB 3.28Å; L80-A83 PolarHBondContact O-N 3.26Å; A83-K85 VanDerWaalsContact C-N 3.27Å; A83-K85 PolarHBondContact O-N 2.97Å
84	G	92.2	Very high	83.6	Confident	52 Å²	52	122.3 Å²	122.3	54%	0.536	71%	0.708	S	S	.	*	T	Hydrogen-bonded Turn	trans	76.6	-0.4	177.3	0	0	0	0	0	116.4	R82 V86 R87 G88	R82-G84 PolarHBondContact O-N 3.25Å; G84-V86 PolarHBondContact O-N 3.23Å; G84-R87 PolarHBondContact O-N 3.13Å; G84-R87 VanDerWaalsContact O-N 3.13Å; G84-G88 PolarHBondContact O-N 3.02Å
85	K	94.8	Very high	85	Confident	121 Å²	121	129.1 Å²	129.1	53%	0.526	72%	0.719	S	S	.	*	H	α-helix	trans	-51.9	-50.2	-177.2	-177.4	175.1	179.6	177	0	112.7	R82 A83 G88 Q89	R82-K85 WeakPolarHBondContact O-CB 3.48Å; R82-K85 PolarHBondContact O-N 2.97Å; A83-K85 VanDerWaalsContact C-N 3.27Å; A83-K85 PolarHBondContact O-N 2.97Å; K85-G88 PolarHBondContact O-N 3.23Å; K85-Q89 VanDerWaalsContact CE-NE2 3.33Å; K85-Q89 WeakPolarHBondContact O-CB 3.33Å; K85-Q89 VanDerWaalsContact O-CG 3.3Å; K85-Q89 WeakPolarHBondContact O-CG 3.4Å; K85-Q89 PolarHBondContact O-N 3.4Å
86	V	94.4	Very high	86.7	Confident	106 Å²	106	127.3 Å²	127.3	64%	0.642	71%	0.714	S	S	*	*	H	α-helix	trans	-65.9	-43.3	-179	179.8	0	0	0	0	111.2	G84 G88 Q89 T90	G84-V86 PolarHBondContact O-N 3.23Å; V86-G88 VanDerWaalsContact C-N 3.28Å; V86-G88 PolarHBondContact O-N 3.29Å; V86-Q89 PolarHBondContact O-N 3.32Å; V86-T90 HydrophobicContact CG1-CG2 4.21Å; V86-T90 WeakPolarHBondContact O-CG2 3.48Å; V86-T90 PolarHBondContact O-N 3.4Å; V86-T90 PolarHBondContact O-OG1 3.01Å
87	R	92.9	Very high	88.2	Confident	222 Å²	222	130.5 Å²	130.5	84%	0.838	72%	0.72	S	S	*	*	H	α-helix	trans	-61.7	-35.2	179.7	-178.7	179.2	172.9	-172.6	-2.3	112.4	G84 T90	G84-R87 PolarHBondContact O-N 3.13Å; G84-R87 VanDerWaalsContact O-N 3.13Å; R87-T90 PolarHBondContact O-OG1 3.07Å
88	G	92.8	Very high	90	Very high	68 Å²	68	129.3 Å²	129.3	70%	0.701	71%	0.712	S	S	*	*	H	α-helix	trans	-77.9	-32.4	177	0	0	0	0	0	113.8	G84 K85 V86	G84-G88 PolarHBondContact O-N 3.02Å; K85-G88 PolarHBondContact O-N 3.23Å; V86-G88 VanDerWaalsContact C-N 3.28Å; V86-G88 PolarHBondContact O-N 3.29Å
89	Q	96.4	Very high	91.2	Very high	135 Å²	135	136.2 Å²	136.2	63%	0.631	73%	0.725	S	S	*	*	H	α-helix	trans	-78.5	-30	179.8	-74	-179.2	-16.6	0	0	113.4	K85 V86	K85-Q89 VanDerWaalsContact CE-NE2 3.33Å; K85-Q89 WeakPolarHBondContact O-CB 3.33Å; K85-Q89 VanDerWaalsContact O-CG 3.3Å; K85-Q89 WeakPolarHBondContact O-CG 3.4Å; K85-Q89 PolarHBondContact O-N 3.4Å; V86-Q89 PolarHBondContact O-N 3.32Å
90	T	95.1	Very high	92.2	Very high	79 Å²	79	141.3 Å²	141.3	49%	0.485	74%	0.735	S	S	.	*	S	Bend	trans	-67	128.2	-179.1	49.5	0	0	0	0	111.3	V86 R87 K92	V86-T90 HydrophobicContact CG1-CG2 4.21Å; V86-T90 WeakPolarHBondContact O-CG2 3.48Å; V86-T90 PolarHBondContact O-N 3.4Å; V86-T90 PolarHBondContact O-OG1 3.01Å; R87-T90 PolarHBondContact O-OG1 3.07Å; T90-K92 PolarHBondContact O-N 3.28Å
91	P	95.8	Very high	92.8	Very high	113 Å²	113	142.7 Å²	142.7	73%	0.734	74%	0.735	S	S	*	*			trans	-62.2	137.6	178.4	25.8	-34.1	0	0	0	110.7	V93	P91-V93 PolarHBondContact O-N 3.17Å; P91-V93 VanDerWaalsContact O-N 3.07Å
92	K	95.3	Very high	93.6	Very high	207 Å²	207	144.8 Å²	144.8	90%	0.9	73%	0.727	S	S	*	*			trans	-81.7	91.9	-178.5	-167.5	66.8	174.7	-176.2	0	110.7	T90 A94	T90-K92 PolarHBondContact O-N 3.28Å; K92-A94 PolarHBondContact O-N 2.78Å
93	V	95.4	Very high	94.1	Very high	124 Å²	124	141 Å²	141	75%	0.752	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-71.7	120	174.7	-175.5	0	0	0	0	110	P91	P91-V93 PolarHBondContact O-N 3.17Å; P91-V93 VanDerWaalsContact O-N 3.07Å
94	A	94.6	Very high	94.5	Very high	84 Å²	84	139.9 Å²	139.9	69%	0.694	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-66	145.9	175.3	0	0	0	0	0	111.1	K92 Q96	K92-A94 PolarHBondContact O-N 2.78Å; A94-Q96 PolarHBondContact O-N 2.83Å
95	K	95	Very high	94.7	Very high	209 Å²	209	148.4 Å²	148.4	91%	0.909	74%	0.738	S	S	*	*	P	Polyproline II helix	trans	-73.4	121.4	175.7	-69.9	-179.7	-179.2	174.2	0	109
96	Q	94.2	Very high	94.8	Very high	163 Å²	163	145.1 Å²	145.1	76%	0.762	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-69.1	141.1	169	-66.1	173.9	-3.1	0	0	110.3	A94 K98	A94-Q96 PolarHBondContact O-N 2.83Å; Q96-K98 PolarHBondContact O-N 3.48Å
97	E	91.8	Very high	94.9	Very high	197 Å²	197	145.3 Å²	145.3	92%	0.921	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-68	125.4	172.7	-167.1	175.5	177.4	0	0	109.8
98	K	93.4	Very high	95.1	Very high	167 Å²	167	143 Å²	143	73%	0.726	72%	0.717	S	S	*	*			trans	-120	145.5	176.6	-67.1	-174.6	-179.7	-177.5	0	108.9	Q96 K100	Q96-K98 PolarHBondContact O-N 3.48Å; K98-K100 PolarHBondContact O-N 3.22Å
99	K	93.9	Very high	95.3	Very high	206 Å²	206	148.7 Å²	148.7	90%	0.896	72%	0.717	S	S	*	*	P	Polyproline II helix	trans	-49.6	129.7	175.5	-173.3	170.7	-174.9	166.3	0	110.7	K101	K99-K101 PolarHBondContact O-N 3.12Å
100	K	93.4	Very high	95.3	Very high	198 Å²	198	147.1 Å²	147.1	86%	0.861	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-55	126.8	178.2	-68.2	-178.8	-178.5	175.4	0	109.8	K98	K98-K100 PolarHBondContact O-N 3.22Å
101	K	93.4	Very high	95.3	Very high	181 Å²	181	146 Å²	146	79%	0.787	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-72.1	134.4	177.8	-65.5	179.6	-178.2	175.6	0	108.9	K99	K99-K101 PolarHBondContact O-N 3.12Å
102	K	96.3	Very high	95.3	Very high	134 Å²	134	147.1 Å²	147.1	58%	0.583	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-58.4	147.8	170	-62.8	-170	-179.9	-175.5	0	109.7	A106 K107 M110	K102-A106 HydrophobicContact CB-CB 4.39Å; K102-A106 HydrophobicContact CD-CB 4.27Å; K102-K107 WeakPolarHBondContact O-CB 3.14Å; K102-K107 WeakPolarHBondContact O-CD 3.42Å; K102-K107 WeakPolarHBondContact O-CG 3.36Å; K102-M110 HydrophobicContact CD-CE 4.02Å
103	T	96.1	Very high	95.3	Very high	115 Å²	115	139.9 Å²	139.9	71%	0.706	66%	0.663	S	S	*	*			trans	-120.1	175	179.7	55.4	0	0	0	0	111.2	K107	T103-K107 PolarHBondContact O-N 2.94Å
104	G	96.9	Very high	95.1	Very high	56 Å²	56	143.2 Å²	143.2	58%	0.577	66%	0.662	S	S	*	*	H	α-helix	trans	59.6	-143.2	174.8	0	0	0	0	0	115	A106 K107 R108	G104-A106 VanDerWaalsContact C-N 3.27Å; G104-A106 PolarHBondContact O-N 3.18Å; G104-K107 WeakPolarHBondContact O-CB 3.22Å; G104-K107 PolarHBondContact O-N 3.35Å; G104-K107 VanDerWaalsContact O-N 3.13Å; G104-R108 PolarHBondContact O-N 3.06Å
105	R	97.3	Very high	95	Very high	231 Å²	231	146 Å²	146	87%	0.872	65%	0.654	S	S	*	*	H	α-helix	trans	-57.2	-38.9	-178.1	-173.1	177.5	179.2	-128.4	1.9	112.6	K107 R108 R109	R105-K107 VanDerWaalsContact C-N 3.34Å; R105-K107 PolarHBondContact O-N 2.82Å; R105-R108 PolarHBondContact O-N 3.12Å; R105-R109 PolarHBondContact O-N 3.38Å
106	A	96.8	Very high	94.8	Very high	53 Å²	53	142.6 Å²	142.6	44%	0.438	64%	0.64	S	S	.	*	H	α-helix	trans	-62.5	-39.8	178.6	0	0	0	0	0	112.3	K102 G104 M110	K102-A106 HydrophobicContact CB-CB 4.39Å; K102-A106 HydrophobicContact CD-CB 4.27Å; G104-A106 VanDerWaalsContact C-N 3.27Å; G104-A106 PolarHBondContact O-N 3.18Å; A106-M110 PolarHBondContact O-N 3.28Å
107	K	97.4	Very high	94.7	Very high	110 Å²	110	139 Å²	139	48%	0.478	63%	0.628	S	S	.	*	H	α-helix	trans	-65.3	-42.5	174.4	-168.4	-176.8	178.2	-177.9	0	111.8	K102 T103 G104 R105 M110 Q111	K102-K107 WeakPolarHBondContact O-CB 3.14Å; K102-K107 WeakPolarHBondContact O-CD 3.42Å; K102-K107 WeakPolarHBondContact O-CG 3.36Å; T103-K107 PolarHBondContact O-N 2.94Å; G104-K107 WeakPolarHBondContact O-CB 3.22Å; G104-K107 PolarHBondContact O-N 3.35Å; G104-K107 VanDerWaalsContact O-N 3.13Å; R105-K107 VanDerWaalsContact C-N 3.34Å; R105-K107 PolarHBondContact O-N 2.82Å; K107-M110 PolarHBondContact O-N 3.47Å; K107-Q111 PolarHBondContact O-N 3.03Å
108	R	97.1	Very high	94.5	Very high	173 Å²	173	135.4 Å²	135.4	65%	0.653	62%	0.616	S	S	*	*	H	α-helix	trans	-64.6	-43.5	179.5	-67.4	-62	-172	180	6.8	112.1	G104 R105 M110 Q111 Y112	G104-R108 PolarHBondContact O-N 3.06Å; R105-R108 PolarHBondContact O-N 3.12Å; R108-M110 VanDerWaalsContact C-N 3.35Å; R108-M110 PolarHBondContact O-N 3.06Å; R108-Q111 PolarHBondContact O-N 3.34Å; R108-Y112 PolarHBondContact O-N 3.43Å
109	R	96.9	Very high	94	Very high	187 Å²	187	130.2 Å²	130.2	71%	0.706	60%	0.598	S	S	*	*	H	α-helix	trans	-58.5	-45.5	173.9	-173.1	177.5	-179.7	-173.7	0.1	111.7	R105 Q111 Y112 N113	R105-R109 PolarHBondContact O-N 3.38Å; R109-Q111 VanDerWaalsContact C-N 3.33Å; R109-Q111 PolarHBondContact O-N 2.93Å; R109-Y112 PolarHBondContact O-N 3.19Å; R109-N113 PolarHBondContact O-N 2.99Å; R109-N113 PolarHBondContact O-OD1 3.17Å
110	M	94.9	Very high	93.4	Very high	102 Å²	102	126 Å²	126	50%	0.502	59%	0.589	S	S	.	*	H	α-helix	trans	-62	-39.8	177.1	-172.7	-175.2	-69.7	0	0	112.3	K102 A106 K107 R108 R114	K102-M110 HydrophobicContact CD-CE 4.02Å; A106-M110 PolarHBondContact O-N 3.28Å; K107-M110 PolarHBondContact O-N 3.47Å; R108-M110 VanDerWaalsContact C-N 3.35Å; R108-M110 PolarHBondContact O-N 3.06Å; M110-R114 WeakPolarHBondContact O-CB 3.3Å; M110-R114 PolarHBondContact O-N 3.48Å
111	Q	94.6	Very high	92.7	Very high	57 Å²	57	122.2 Å²	122.2	27%	0.266	59%	0.585	S	S	.	*	H	α-helix	trans	-66.9	-41.6	177.6	-173	178.1	12.9	0	0	112.2	K107 R108 R109 R114 R115	K107-Q111 PolarHBondContact O-N 3.03Å; R108-Q111 PolarHBondContact O-N 3.34Å; R109-Q111 VanDerWaalsContact C-N 3.33Å; R109-Q111 PolarHBondContact O-N 2.93Å; Q111-R114 PolarHBondContact O-N 3.44Å; Q111-R115 VanDerWaalsContact NE2-NH2 3.12Å; Q111-R115 WeakPolarHBondContact O-CB 3.48Å; Q111-R115 WeakPolarHBondContact O-CG 3.39Å; Q111-R115 PolarHBondContact O-N 3.36Å; Q111-R115 VanDerWaalsContact O-N 3.12Å
112	Y	96.4	Very high	92	Very high	135 Å²	135	118.7 Å²	118.7	53%	0.529	58%	0.579	S	S	.	*	H	α-helix	trans	-61.4	-52.4	176.2	178	-94.5	0	0	0	111	R108 R109 R114 R115 F116 V117	R108-Y112 PolarHBondContact O-N 3.43Å; R109-Y112 PolarHBondContact O-N 3.19Å; Y112-R114 VanDerWaalsContact C-N 3.28Å; Y112-R114 PolarHBondContact O-N 3.19Å; Y112-R115 PolarHBondContact O-N 2.94Å; Y112-F116 AromaticContact CD2-CD2 3.5Å; Y112-F116 HydrophobicContact CD2-CD2 3.5Å; Y112-F116 HydrophobicContact CD2-CE2 4.08Å; Y112-F116 HydrophobicContact CD2-CG 4.39Å; Y112-F116 HydrophobicContact CE2-CB 4.24Å; Y112-F116 AromaticContact CE2-CD2 3.71Å; Y112-F116 HydrophobicContact CE2-CD2 3.71Å; Y112-F116 HydrophobicContact CE2-CE2 4.41Å; Y112-F116 HydrophobicContact CE2-CG 4.21Å; Y112-F116 HydrophobicContact CG-CD2 4.19Å; Y112-F116 PolarHBondContact O-N 3.17Å; Y112-V117 HydrophobicContact CD1-CG2 3.96Å; Y112-V117 HydrophobicContact CE1-CG2 3.57Å
113	N	95.4	Very high	91.3	Very high	56 Å²	56	122.6 Å²	122.6	30%	0.299	60%	0.596	S	S	.	*	I	π-helix	trans	-57.2	-43.8	179	-70.2	10.4	0	0	0	111.3	R109 R115 V117 N118	R109-N113 PolarHBondContact O-N 2.99Å; R109-N113 PolarHBondContact O-OD1 3.17Å; N113-R115 VanDerWaalsContact C-N 3.3Å; N113-R115 PolarHBondContact O-N 3.22Å; N113-V117 PolarHBondContact O-N 3.3Å; N113-N118 WeakPolarHBondContact O-CB 3.35Å; N113-N118 PolarHBondContact O-N 3.43Å
114	R	92.4	Very high	90.7	Very high	193 Å²	193	120.5 Å²	120.5	73%	0.728	60%	0.597	S	S	*	*	I	π-helix	trans	-66.9	-26.3	179.5	-166.4	174.4	-164	155.2	4.6	114.1	M110 Q111 Y112 V119	M110-R114 WeakPolarHBondContact O-CB 3.3Å; M110-R114 PolarHBondContact O-N 3.48Å; Q111-R114 PolarHBondContact O-N 3.44Å; Y112-R114 VanDerWaalsContact C-N 3.28Å; Y112-R114 PolarHBondContact O-N 3.19Å; R114-V119 WeakPolarHBondContact O-CG2 3.4Å
115	R	91.6	Very high	90.1	Very high	142 Å²	142	127.6 Å²	127.6	54%	0.536	61%	0.612	S	S	.	*	I	π-helix	trans	-97.2	-29.8	-174.6	-75.7	-178.1	175.7	-167.5	-4.1	114.2	Q111 Y112 N113 V119	Q111-R115 VanDerWaalsContact NE2-NH2 3.12Å; Q111-R115 WeakPolarHBondContact O-CB 3.48Å; Q111-R115 WeakPolarHBondContact O-CG 3.39Å; Q111-R115 PolarHBondContact O-N 3.36Å; Q111-R115 VanDerWaalsContact O-N 3.12Å; Y112-R115 PolarHBondContact O-N 2.94Å; N113-R115 VanDerWaalsContact C-N 3.3Å; N113-R115 PolarHBondContact O-N 3.22Å; R115-V119 VanDerWaalsContact C-CG2 3.48Å; R115-V119 VanDerWaalsContact O-CG2 3.22Å; R115-V119 WeakPolarHBondContact O-CG2 3.45Å
116	F	90.1	Very high	89.4	Confident	138 Å²	138	124.5 Å²	124.5	61%	0.605	61%	0.605	S	S	*	*	I	π-helix	trans	-125.2	-40.9	-169.1	-59.8	-70.8	0	0	0	112.9	Y112	Y112-F116 AromaticContact CD2-CD2 3.5Å; Y112-F116 HydrophobicContact CD2-CD2 3.5Å; Y112-F116 HydrophobicContact CD2-CE2 4.08Å; Y112-F116 HydrophobicContact CD2-CG 4.39Å; Y112-F116 HydrophobicContact CE2-CB 4.24Å; Y112-F116 AromaticContact CE2-CD2 3.71Å; Y112-F116 HydrophobicContact CE2-CD2 3.71Å; Y112-F116 HydrophobicContact CE2-CE2 4.41Å; Y112-F116 HydrophobicContact CE2-CG 4.21Å; Y112-F116 HydrophobicContact CG-CD2 4.19Å; Y112-F116 PolarHBondContact O-N 3.17Å
117	V	92.4	Very high	88.9	Confident	87 Å²	87	128.8 Å²	128.8	53%	0.527	61%	0.613	S	S	.	*	I	π-helix	trans	-84.9	-48.8	-174.9	-176.2	0	0	0	0	111.4	Y112 N113 V119	Y112-V117 HydrophobicContact CD1-CG2 3.96Å; Y112-V117 HydrophobicContact CE1-CG2 3.57Å; N113-V117 PolarHBondContact O-N 3.3Å; V117-V119 VanDerWaalsContact C-N 3.33Å; V117-V119 PolarHBondContact O-N 3.13Å
118	N	87.6	Confident	88.4	Confident	122 Å²	122	125.7 Å²	125.7	65%	0.652	61%	0.613	S	S	*	*	S	Bend	trans	-88.9	1.5	-173.7	-63.4	9.7	0	0	0	113	N113	N113-N118 WeakPolarHBondContact O-CB 3.35Å; N113-N118 PolarHBondContact O-N 3.43Å
119	V	84.3	Confident	88	Confident	59 Å²	59	124 Å²	124	36%	0.358	63%	0.625	S	S	.	*			trans	-88.7	117.1	-179.3	176.8	0	0	0	0	108.6	R114 R115 V117	R114-V119 WeakPolarHBondContact O-CG2 3.4Å; R115-V119 VanDerWaalsContact C-CG2 3.48Å; R115-V119 VanDerWaalsContact O-CG2 3.22Å; R115-V119 WeakPolarHBondContact O-CG2 3.45Å; V117-V119 VanDerWaalsContact C-N 3.33Å; V117-V119 PolarHBondContact O-N 3.13Å
120	V	79.8	Confident	87.8	Confident	116 Å²	116	121.9 Å²	121.9	70%	0.703	63%	0.627	S	S	*	*			trans	-88.5	127.5	168.6	-179	0	0	0	0	108.5	T122	V120-T122 PolarHBondContact O-N 3.35Å
121	P	78.6	Confident	87.6	Confident	120 Å²	120	119.5 Å²	119.5	78%	0.779	62%	0.623	S	S	*	*			trans	-63.9	115.4	174.2	-18.1	30.6	0	0	0	110.1
122	T	79.1	Confident	87.4	Confident	106 Å²	106	124.5 Å²	124.5	65%	0.65	65%	0.652	S	S	*	*			trans	-100.3	145.8	172.4	56.6	0	0	0	0	109.5	V120	V120-T122 PolarHBondContact O-N 3.35Å
123	F	82.1	Confident	86.4	Confident	217 Å²	217	124.6 Å²	124.6	95%	0.952	67%	0.672	S	S	*	*	S	Bend	trans	-64.3	143.1	171.9	-71.7	-88.7	0	0	0	110.9
124	G	83	Confident	85.9	Confident	70 Å²	70	128 Å²	128	72%	0.722	69%	0.691	S	S	*	*	S	Bend	trans	95.4	-167.4	-179	0	0	0	0	0	114.7	K126	G124-K126 PolarHBondContact O-N 3.34Å
125	K	84.3	Confident	85.6	Confident	205 Å²	205	124.6 Å²	124.6	89%	0.891	69%	0.689	S	S	*	*	S	Bend	trans	-70.9	125.1	-173	-168.7	174.5	-177.8	175.3	0	110.9	K127	K125-K127 PolarHBondContact O-N 3.35Å
126	K	83.1	Confident	85.2	Confident	166 Å²	166	123.6 Å²	123.6	72%	0.722	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-58.6	121.6	178.9	-169.4	170.6	-174.3	168.4	0	111.2	G124	G124-K126 PolarHBondContact O-N 3.34Å
127	K	85.8	Confident	84.9	Confident	143 Å²	143	122.8 Å²	122.8	62%	0.622	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-67.7	138.4	174.9	-77.1	-166.6	175	-167.8	0	111.2	K125 S133	K125-K127 PolarHBondContact O-N 3.35Å; K127-S133 PolarHBondContact NZ-O 3.37Å; K127-S133 PolarHBondContact NZ-OXT 3.07Å
128	G	87.4	Confident	84.5	Confident	45 Å²	45	125 Å²	125	46%	0.464	71%	0.714	S	S	.	*	P	Polyproline II helix	trans	-75.2	155.6	178	0	0	0	0	0	112.6	N130 A131	G128-N130 PolarHBondContact O-N 3.26Å; G128-N130 VanDerWaalsContact O-N 3.12Å; G128-A131 WeakPolarHBondContact O-CB 3.34Å; G128-A131 PolarHBondContact O-N 3.27Å
129	P	88.2	Confident	84.3	Confident	139 Å²	139	125.2 Å²	125.2	90%	0.903	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.7	-8.8	-176.7	27.4	-35.5	0	0	0	115.3
130	N	92.2	Very high	84.3	Confident	142 Å²	142	129.9 Å²	129.9	76%	0.759	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128.5	29.4	177.4	-160.5	57	0	0	0	111.1	G128	G128-N130 PolarHBondContact O-N 3.26Å; G128-N130 VanDerWaalsContact O-N 3.12Å
131	A	90.8	Very high	84.6	Confident	51 Å²	51	131 Å²	131	42%	0.421	75%	0.747	S	S	.	*			trans	-70.9	131	169.9	0	0	0	0	0	108.9	G128 S133	G128-A131 WeakPolarHBondContact O-CB 3.34Å; G128-A131 PolarHBondContact O-N 3.27Å; A131-S133 VanDerWaalsContact C-N 3.31Å
132	N	90.3	Very high	85.1	Confident	163 Å²	163	131.9 Å²	131.9	87%	0.872	74%	0.744	S	S	*	*			trans	-89.7	1.1	179.4	-65.4	-23.6	0	0	0	112.6
133	S	75.2	Confident	85.7	Confident	136 Å²	136	134.3 Å²	134.3	95%	0.951	75%	0.753	S	S	*	*			trans	-126.1	0	-178.2	57.3	0	0	0	0	113.1	K127 A131	K127-S133 PolarHBondContact NZ-O 3.37Å; K127-S133 PolarHBondContact NZ-OXT 3.07Å; A131-S133 VanDerWaalsContact C-N 3.31Å

Retrieved 133 of 133 residues in 21.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).