A0A096MTD7_PAPAN Loading...

Single-stranded DNA-binding protein

Binds preferentially and cooperatively to pyrimidine rich single-stranded DNA (ss-DNA). In vitro, required to maintain the copy number of mitochondrial DNA (mtDNA) and plays a crucial role during mtDNA replication by stimulating the activity of the replisome components POLG and TWNK at the replication fork. Promotes the activity of the gamma complex polymerase POLG, largely by organizing the template DNA and eliminating secondary structures to favor ss-DNA conformations that facilitate POLG activity. In addition it is able to promote the 5'-3' unwinding activity of the mtDNA helicase TWNK. May also function in mtDNA repair.

AlphaFold DB , UniProt , Accession A0A096MTD7, Species PAPAN (Papio anubis, Olive baboon), Gene SSBP1, Length 148 aa.

						>A0A096MTD7_PAPAN|A0A096MTD7|SSBP1
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVQLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQMGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.6	Very low	47.1	Very low	238 Å²	238	182.3 Å²	182.3	100%	1.172	86%	0.862	S	S	*	*				0	82.4	0	-159.1	172.3	-169.8	0	0	107.8
2	F	46.9	Very low	46.7	Very low	208 Å²	208	180.3 Å²	180.3	91%	0.912	85%	0.852	S	S	*	*			trans	-141.9	120.9	179	-86.8	-83	0	0	0	106.2
3	R	42.5	Very low	46.5	Very low	256 Å²	256	179.2 Å²	179.2	97%	0.966	84%	0.842	S	S	*	*			trans	-124.3	122.7	175.2	-76.3	-163.4	172.5	-155.6	0.2	110.6
4	R	44.6	Very low	46.8	Very low	238 Å²	238	173.7 Å²	173.7	90%	0.898	83%	0.826	S	S	*	*			trans	-60.5	-176.5	173	-62.1	171.2	158.8	177.6	-6.4	112.7
5	P	49.3	Very low	46.6	Very low	119 Å²	119	176.5 Å²	176.5	77%	0.773	83%	0.825	S	S	*	*			cis	-129.4	164.8	-11.8	19.1	5.5	0	0	0	114.6
6	V	53.4	Low	46.4	Very low	136 Å²	136	175.9 Å²	175.9	82%	0.824	82%	0.822	S	S	*	*			trans	-73.9	126.1	162.8	173.4	0	0	0	0	109.2
7	L	48.2	Very low	46.8	Very low	154 Å²	154	174.6 Å²	174.6	81%	0.806	82%	0.816	S	S	*	*			trans	-178.9	114.8	152.9	-102.9	147.1	0	0	0	108
8	Q	47	Very low	46.7	Very low	183 Å²	183	169.8 Å²	169.8	86%	0.855	81%	0.805	S	S	*	*				-174.7	107.3	126.3	-100.2	169.2	-1.9	0	0	111.7
9	V	53.8	Low	47.2	Very low	111 Å²	111	169.1 Å²	169.1	67%	0.673	80%	0.801	S	S	*	*			trans	67.6	93.3	133.7	-169.2	0	0	0	0	117	R11	V9-R11 VanDerWaalsContact C-N 3.33Å; V9-R11 HydrophobicContact CG1-CG 4.26Å; V9-R11 PolarHBondContact O-N 2.88Å
10	L	46.9	Very low	47.5	Very low	161 Å²	161	166.4 Å²	166.4	84%	0.843	80%	0.796	S	S	*	*			trans	-53.1	91.7	150	-149.7	98.4	0	0	0	109.1	Q12	L10-Q12 PolarHBondContact O-N 2.84Å
11	R	43.3	Very low	47.9	Very low	201 Å²	201	164.3 Å²	164.3	76%	0.758	79%	0.794	S	S	*	*			trans	-76.7	88.3	162.3	-97.9	-171.5	178.8	-170.5	0.3	107.4	V9 F13	V9-R11 VanDerWaalsContact C-N 3.33Å; V9-R11 HydrophobicContact CG1-CG 4.26Å; V9-R11 PolarHBondContact O-N 2.88Å; R11-F13 HydrophobicContact CB-CD2 4.47Å; R11-F13 PolarHBondContact O-N 3.04Å
12	Q	42.1	Very low	48.7	Very low	158 Å²	158	157.8 Å²	157.8	74%	0.738	77%	0.768	S	S	*	*			trans	-56.8	90.5	156.4	-136.7	174.7	-5.9	0	0	106.5	L10 V14	L10-Q12 PolarHBondContact O-N 2.84Å; Q12-V14 HydrophobicContact CB-CG2 4.44Å; Q12-V14 HydrophobicContact CG-CG2 4.02Å; Q12-V14 PolarHBondContact O-N 2.94Å
13	F	44.2	Very low	49.3	Very low	167 Å²	167	152.3 Å²	152.3	73%	0.732	76%	0.755	S	S	*	*			trans	-70	79.6	154.5	-89.8	-82.7	0	0	0	105.5	R11 R15	R11-F13 HydrophobicContact CB-CD2 4.47Å; R11-F13 PolarHBondContact O-N 3.04Å; F13-R15 PolarHBondContact O-N 2.8Å
14	V	50.8	Low	50.3	Low	102 Å²	102	147.6 Å²	147.6	62%	0.618	75%	0.749	S	S	*	*			trans	-59.6	95.5	149.1	175.6	0	0	0	0	103.2	Q12 H16	Q12-V14 HydrophobicContact CB-CG2 4.44Å; Q12-V14 HydrophobicContact CG-CG2 4.02Å; Q12-V14 PolarHBondContact O-N 2.94Å; V14-H16 PolarHBondContact O-N 3.34Å
15	R	44.2	Very low	51.5	Low	215 Å²	215	142.2 Å²	142.2	81%	0.811	74%	0.742	S	S	*	*			trans	-54.3	105.7	155.2	-80.1	-178.2	173.4	179.9	-2.1	103.4	F13 E17	F13-R15 PolarHBondContact O-N 2.8Å; R15-E17 PolarHBondContact O-N 2.87Å
16	H	42.8	Very low	53	Low	167 Å²	167	143.6 Å²	143.6	77%	0.773	74%	0.742	S	S	*	*			trans	-63.4	90.6	157.1	-148	-52	0	0	0	103.2	V14 S18	V14-H16 PolarHBondContact O-N 3.34Å; H16-S18 PolarHBondContact O-N 2.83Å
17	E	53.1	Low	54.6	Low	154 Å²	154	145.4 Å²	145.4	72%	0.72	74%	0.741	S	S	*	*			trans	-58.4	98.3	154.1	-83.7	178.4	161.4	0	0	103.3	R15 E19	R15-E17 PolarHBondContact O-N 2.87Å; E17-E19 PolarHBondContact O-N 2.87Å
18	S	45.2	Very low	56.7	Low	88 Å²	88	149.5 Å²	149.5	62%	0.615	75%	0.746	S	S	*	*			trans	-63.6	91.2	157.1	58.3	0	0	0	0	104.2	H16 T20	H16-S18 PolarHBondContact O-N 2.83Å; S18-T20 PolarHBondContact O-N 2.75Å
19	E	55.7	Low	58.9	Low	157 Å²	157	146.2 Å²	146.2	73%	0.734	74%	0.744	S	S	*	*			trans	-59.7	81.6	152.9	-74.5	-175.9	158.6	0	0	106	E17 T21	E17-E19 PolarHBondContact O-N 2.87Å; E19-T21 PolarHBondContact O-N 2.89Å; E19-T21 PolarHBondContact O-OG1 2.88Å
20	T	53.3	Low	61	Low	114 Å²	114	148.2 Å²	148.2	70%	0.699	75%	0.75	S	S	*	*			trans	-65.7	76.1	151.3	21.2	0	0	0	0	105.5	S18 T22	S18-T20 PolarHBondContact O-N 2.75Å; T20-T22 PolarHBondContact O-N 2.83Å; T20-T22 PolarHBondContact O-OG1 2.82Å
21	T	55.3	Low	63.3	Low	123 Å²	123	144.4 Å²	144.4	76%	0.755	73%	0.73	S	S	*	*			trans	-59.3	76.8	149.6	21.5	0	0	0	0	105.2	E19 S23	E19-T21 PolarHBondContact O-N 2.89Å; E19-T21 PolarHBondContact O-OG1 2.88Å; T21-S23 PolarHBondContact O-N 2.73Å
22	T	60.6	Low	65.9	Low	101 Å²	101	141.7 Å²	141.7	62%	0.62	72%	0.72	S	S	*	*			trans	-60.5	101.5	167.5	-48.8	0	0	0	0	102.8	T20 L24	T20-T22 PolarHBondContact O-N 2.83Å; T20-T22 PolarHBondContact O-OG1 2.82Å; T22-L24 VanDerWaalsContact C-N 3.34Å; T22-L24 PolarHBondContact O-N 3.35Å
23	S	59.9	Low	68.6	Low	93 Å²	93	135.6 Å²	135.6	65%	0.65	69%	0.693	S	S	*	*			trans	-49.9	106.2	172.3	53.8	0	0	0	0	106	T21 V25	T21-S23 PolarHBondContact O-N 2.73Å; S23-V25 PolarHBondContact O-N 2.76Å
24	L	63	Low	71.1	Confident	158 Å²	158	132.8 Å²	132.8	83%	0.827	68%	0.682	S	S	*	*			trans	-73.7	53.3	175.1	-65.8	173.5	0	0	0	108.4	T22 L26	T22-L24 VanDerWaalsContact C-N 3.34Å; T22-L24 PolarHBondContact O-N 3.35Å; L24-L26 PolarHBondContact O-N 3.33Å
25	V	69.5	Low	73.4	Confident	125 Å²	125	129 Å²	129	76%	0.758	66%	0.659	S	S	*	*			trans	-73.9	84.4	158.6	-177	0	0	0	0	104	S23 E27	S23-V25 PolarHBondContact O-N 2.76Å; V25-E27 PolarHBondContact O-N 2.95Å
26	L	80.3	Confident	75.9	Confident	148 Å²	148	122.8 Å²	122.8	78%	0.775	64%	0.641	S	S	*	*			trans	-56.4	130.8	173.5	-151.2	91.5	0	0	0	107.5	L24 R28	L24-L26 PolarHBondContact O-N 3.33Å; L26-R28 PolarHBondContact O-N 3.4Å
27	E	88.4	Confident	78.5	Confident	173 Å²	173	115.2 Å²	115.2	81%	0.808	61%	0.608	S	S	*	*			trans	-56	135.3	176.9	-174.8	-176	169.1	0	0	110.2	V25 S29	V25-E27 PolarHBondContact O-N 2.95Å; E27-S29 PolarHBondContact O-N 3.28Å
28	R	90.9	Very high	80.6	Confident	240 Å²	240	114.5 Å²	114.5	91%	0.906	60%	0.599	S	S	*	*			trans	-78.6	110.2	176.2	-62.2	-169.7	72.6	120.5	2.6	109.2	L26	L26-R28 PolarHBondContact O-N 3.4Å
29	S	94.8	Very high	83	Confident	115 Å²	115	110.5 Å²	110.5	80%	0.804	57%	0.571	S	S	*	*			trans	-95.3	162.8	173	62	0	0	0	0	112.4	E27	E27-S29 PolarHBondContact O-N 3.28Å
30	L	96.2	Very high	84.9	Confident	153 Å²	153	103.7 Å²	103.7	80%	0.801	54%	0.543	S	S	*	.			trans	-115.3	121.9	178.5	-173.4	148.7	0	0	0	110.3	R32	L30-R32 HydrophobicContact CD2-CB 3.79Å
31	N	96.8	Very high	86.9	Confident	80 Å²	80	104.9 Å²	104.9	43%	0.428	54%	0.54	S	S	.	.			trans	-124.9	107.2	168.4	175.8	-9	0	0	0	107.4	K113 I114	N31-K113 HydrophobicContact CB-CB 4.49Å; N31-I114 PolarHBondContact ND2-O 3.28Å; N31-I114 PolarHBondContact OD1-N 3.29Å
32	R	97.2	Very high	88.9	Confident	145 Å²	145	103.3 Å²	103.3	55%	0.547	53%	0.527	S	S	.	.			trans	-137.4	131.9	-179.8	-170.1	175.1	-173.3	157.3	1.3	109.5	L30 E111 G112	L30-R32 HydrophobicContact CD2-CB 3.79Å; R32-E111 IonicContact CZ-OE1 3.6Å; R32-E111 IonicContact NE-OE1 3.37Å; R32-E111 PolarHBondContact NE-OE1 2.76Å; R32-E111 VanDerWaalsContact NH2-CD 3.32Å; R32-E111 IonicContact NH2-OE1 2.74Å; R32-E111 PolarHBondContact NH2-OE1 2.9Å; R32-E111 IonicContact NH2-OE2 2.9Å; R32-E111 PolarHBondContact NH2-OE2 3.37Å; R32-G112 CarbonylContact C-O 3.57Å; R32-G112 WeakPolarHBondContact CA-O 3.31Å
33	V	98.1	Very high	90.6	Very high	29 Å²	29	99 Å²	99	18%	0.176	50%	0.501	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	133.1	175.3	178.6	0	0	0	0	107.9	L35 E111 G112 I114 I132	V33-L35 HydrophobicContact CG1-CD1 4.32Å; V33-L35 HydrophobicContact CG1-CD2 4.27Å; V33-L35 HydrophobicContact CG1-CG 3.9Å; V33-E111 VanDerWaalsContact O-CA 3.32Å; V33-E111 WeakPolarHBondContact O-CA 3.32Å; V33-G112 PolarHBondContact N-O 3.38Å; V33-G112 PolarHBondContact O-N 3.25Å; V33-I114 HydrophobicContact CG2-CB 4.03Å; V33-I132 HydrophobicContact CB-CG2 4.35Å; V33-I132 HydrophobicContact CG1-CD1 3.89Å; V33-I132 HydrophobicContact CG1-CG1 4.41Å; V33-I132 HydrophobicContact CG1-CG2 4.28Å
34	Q	98	Very high	92.3	Very high	108 Å²	108	99 Å²	99	51%	0.505	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	125.7	173.3	-64.9	178.5	-23	0	0	107.8	Y109 L110 E111	Q34-Y109 HydrophobicContact CB-CE2 4.34Å; Q34-Y109 PolarHBondContact NE2-OH 3.48Å; Q34-L110 WeakPolarHBondContact CA-O 3.02Å; Q34-E111 HydrophobicContact CG-CG 4.16Å; Q34-E111 PolarHBondContact NE2-OE1 2.74Å
35	L	97.7	Very high	93.9	Very high	24 Å²	24	94.7 Å²	94.7	13%	0.126	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	142.5	177.7	-60.9	176.5	0	0	0	110.3	V33 L59 T61 H85 I87 Y109 L110 I132	V33-L35 HydrophobicContact CG1-CD1 4.32Å; V33-L35 HydrophobicContact CG1-CD2 4.27Å; V33-L35 HydrophobicContact CG1-CG 3.9Å; L35-L59 HydrophobicContact CB-CD2 3.78Å; L35-L59 HydrophobicContact CD1-CD2 3.95Å; L35-L59 HydrophobicContact CG-CD2 4.48Å; L35-T61 HydrophobicContact CD2-CG2 4.29Å; L35-H85 HydrophobicContact CD1-CB 3.93Å; L35-I87 HydrophobicContact CD1-CD1 4.22Å; L35-Y109 CarbonylContact O-C 3.59Å; L35-Y109 VanDerWaalsContact O-CA 3.32Å; L35-Y109 WeakPolarHBondContact O-CA 3.22Å; L35-L110 HydrophobicContact CB-CD1 4.17Å; L35-L110 HydrophobicContact CB-CD2 4.44Å; L35-L110 HydrophobicContact CB-CG 4.03Å; L35-L110 HydrophobicContact CD1-CD1 4.32Å; L35-L110 HydrophobicContact CG-CD1 4.38Å; L35-L110 PolarHBondContact N-O 2.91Å; L35-L110 PolarHBondContact O-N 3.49Å; L35-I132 HydrophobicContact CD1-CD1 3.44Å; L35-I132 VanDerWaalsContact CD1-CD1 3.44Å; L35-I132 HydrophobicContact CG-CD1 4.45Å
36	L	97.6	Very high	95	Very high	84 Å²	84	95.8 Å²	95.8	44%	0.44	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	119.3	167.8	-170.6	157.9	0	0	0	107.4	I108 Y109 L140	L36-I108 WeakPolarHBondContact CA-O 3.42Å; L36-Y109 HydrophobicContact CB-CD2 4.37Å; L36-L140 HydrophobicContact CD1-CD1 3.78Å; L36-L140 HydrophobicContact CG-CD1 3.96Å
37	G	96.8	Very high	95.5	Very high	7 Å²	7	96 Å²	96	7%	0.072	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.2	-168.9	-173.6	0	0	0	0	0	113.2	A60 R107 I108	G37-A60 VanDerWaalsContact CA-O 3.22Å; G37-A60 WeakPolarHBondContact CA-O 3.28Å; G37-R107 WeakPolarHBondContact O-CA 3.37Å; G37-I108 PolarHBondContact N-O 3.22Å; G37-I108 VanDerWaalsContact N-O 3.07Å; G37-I108 PolarHBondContact O-N 2.99Å
38	R	96.7	Very high	95.4	Very high	140 Å²	140	90.7 Å²	90.7	53%	0.528	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	140.8	176.6	-69.8	-173.5	178.3	-85.9	4.8	110.8	L59 A60 G105 S106	R38-L59 WeakPolarHBondContact O-CA 3.43Å; R38-A60 PolarHBondContact N-O 2.7Å; R38-A60 VanDerWaalsContact N-O 3.09Å; R38-A60 PolarHBondContact O-N 2.93Å; R38-G105 PolarHBondContact NH1-O 3.41Å; R38-S106 WeakPolarHBondContact CA-O 3.26Å
39	V	97.3	Very high	95	Very high	4 Å²	4	88.5 Å²	88.5	2%	0.024	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	129.6	179.2	174.2	0	0	0	0	109.7	Q41 F57 S58 V102 G105 S106 I108	V39-Q41 WeakPolarHBondContact CG1-O 3.2Å; V39-F57 HydrophobicContact CG2-CD2 4.29Å; V39-F57 HydrophobicContact CG2-CE2 4.49Å; V39-S58 CarbonylContact C-O 3.6Å; V39-S58 WeakPolarHBondContact CA-O 3.29Å; V39-V102 HydrophobicContact CB-CG1 4.16Å; V39-V102 HydrophobicContact CG1-CG1 3.78Å; V39-V102 HydrophobicContact CG2-CG1 3.56Å; V39-G105 PolarHBondContact O-N 2.88Å; V39-S106 PolarHBondContact N-O 3.13Å; V39-I108 HydrophobicContact CG2-CD1 3.59Å; V39-I108 HydrophobicContact CG2-CG1 4Å
40	G	95.6	Very high	94.4	Very high	14 Å²	14	87.3 Å²	87.3	14%	0.144	45%	0.447	C	S	.	.			trans	-81.9	-35.2	-176.6	0	0	0	0	0	114.7	S58 K104	G40-S58 PolarHBondContact N-O 3.32Å; G40-K104 WeakPolarHBondContact O-CG 3.4Å
41	Q	95	Very high	93.8	Very high	139 Å²	139	87.4 Å²	87.4	65%	0.65	44%	0.441	S	S	*	.	S	Bend	trans	-144.9	156.1	-175.5	-66.5	-173.1	-25.5	0	0	109.8	V39	V39-Q41 WeakPolarHBondContact CG1-O 3.2Å
42	D	95.7	Very high	93.5	Very high	90 Å²	90	89.8 Å²	89.8	48%	0.481	45%	0.454	S	S	.	.			trans	-59.4	145.6	177.4	-66.1	-44.8	0	0	0	111.6	K104	D42-K104 PolarHBondContact OD1-N 2.86Å
43	P	96.7	Very high	93.3	Very high	10 Å²	10	84.3 Å²	84.3	7%	0.065	44%	0.437	C	S	.	.			trans	-66.2	137.5	-178.2	29.4	-37	0	0	0	111.5	T55 I56 F57 Y99 V102	P43-T55 HydrophobicContact CB-CG2 3.65Å; P43-I56 WeakPolarHBondContact CA-O 3.05Å; P43-F57 HydrophobicContact CB-CB 4.26Å; P43-F57 HydrophobicContact CB-CD1 4.36Å; P43-Y99 HydrophobicContact CB-CD2 4.41Å; P43-Y99 HydrophobicContact CG-CD2 4.27Å; P43-Y99 WeakPolarHBondContact O-CE2 3.49Å; P43-V102 WeakPolarHBondContact CD-O 3.31Å; P43-V102 HydrophobicContact CG-CB 4.07Å; P43-V102 HydrophobicContact CG-CG1 4.44Å; P43-V102 WeakPolarHBondContact CG-O 3.49Å
44	V	96.4	Very high	93.2	Very high	94 Å²	94	83.8 Å²	83.8	57%	0.57	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.3	120.9	176.5	-178.7	0	0	0	0	109.1	R46 T55 I56	V44-R46 PolarHBondContact O-N 3.41Å; V44-T55 WeakPolarHBondContact O-CA 3.31Å; V44-I56 PolarHBondContact N-O 3.18Å; V44-I56 PolarHBondContact O-N 2.8Å
45	L	95.5	Very high	93.1	Very high	67 Å²	67	78.6 Å²	78.6	35%	0.351	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	111.3	169.9	-175.8	67.4	0	0	0	109	P53 R95 Y99	L45-P53 HydrophobicContact CD1-CB 4.12Å; L45-R95 HydrophobicContact CD1-CG 4.09Å; L45-Y99 HydrophobicContact CB-CD2 3.88Å; L45-Y99 HydrophobicContact CB-CE2 3.93Å; L45-Y99 HydrophobicContact CB-CG 4.24Å
46	R	93	Very high	93.1	Very high	148 Å²	148	78.9 Å²	78.9	56%	0.558	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.2	117.9	176.3	-171.6	176.8	178.9	170.6	-0.5	109.6	V44 V48 V54 I56	V44-R46 PolarHBondContact O-N 3.41Å; R46-V48 HydrophobicContact CG-CG2 4.1Å; R46-V54 PolarHBondContact N-O 2.88Å; R46-V54 PolarHBondContact O-N 3.33Å; R46-I56 HydrophobicContact CB-CD1 4.09Å
47	Q	91.1	Very high	93	Very high	151 Å²	151	75.3 Å²	75.3	71%	0.706	39%	0.392	S	S	*	.			trans	-107.6	122.2	168.8	-172.6	170.1	-25.3	0	0	108.3	P53	Q47-P53 HydrophobicContact CB-CB 4.39Å; Q47-P53 HydrophobicContact CG-CB 4.49Å
48	V	86.2	Confident	93.1	Very high	62 Å²	62	76.3 Å²	76.3	38%	0.376	40%	0.398	S	S	.	.			trans	-109.3	135.6	174.5	-179.2	0	0	0	0	106.8	R46 G50 K51	R46-V48 HydrophobicContact CG-CG2 4.1Å; V48-G50 PolarHBondContact O-N 2.83Å; V48-K51 HydrophobicContact CB-CB 4.29Å; V48-K51 PolarHBondContact O-N 3.47Å; V48-K51 VanDerWaalsContact O-O 3.11Å
49	E	83	Confident	93.1	Very high	194 Å²	194	69.7 Å²	69.7	91%	0.907	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.8	129.1	177.7	-65.2	179.3	176.6	0	0	110.7	K51	E49-K51 VanDerWaalsContact C-N 3.27Å; E49-K51 PolarHBondContact O-N 3.1Å
50	G	82.1	Confident	93.2	Very high	91 Å²	91	70.2 Å²	70.2	94%	0.938	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.8	0.5	-177.3	0	0	0	0	0	116.1	V48	V48-G50 PolarHBondContact O-N 2.83Å
51	K	83.9	Confident	93.2	Very high	155 Å²	155	71 Å²	71	67%	0.674	38%	0.38	S	S	*	.	S	Bend	trans	-119.8	149.4	174.4	-64.4	-172.2	179.1	-175.6	0	111.9	V48 E49	V48-K51 HydrophobicContact CB-CB 4.29Å; V48-K51 PolarHBondContact O-N 3.47Å; V48-K51 VanDerWaalsContact O-O 3.11Å; E49-K51 VanDerWaalsContact C-N 3.27Å; E49-K51 PolarHBondContact O-N 3.1Å
52	N	89.4	Confident	93.2	Very high	130 Å²	130	68.9 Å²	68.9	70%	0.695	37%	0.373	S	S	*	.			trans	-58.3	140.2	172.5	-68.9	-30	0	0	0	110.2	V54	N52-V54 WeakPolarHBondContact O-CG2 3.47Å
53	P	94	Very high	93.1	Very high	29 Å²	29	70.1 Å²	70.1	19%	0.188	38%	0.376	C	S	.	.			trans	-60.6	150	177.3	2.2	-0.7	0	0	0	111	L45 Q47 R95	L45-P53 HydrophobicContact CD1-CB 4.12Å; Q47-P53 HydrophobicContact CB-CB 4.39Å; Q47-P53 HydrophobicContact CG-CB 4.49Å; P53-R95 VanDerWaalsContact C-CD 3.45Å; P53-R95 WeakPolarHBondContact O-CD 3.41Å; P53-R95 PolarHBondContact O-NH1 3.17Å
54	V	95.2	Very high	92.7	Very high	18 Å²	18	75.7 Å²	75.7	11%	0.109	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.1	130.5	-177.9	-172.9	0	0	0	0	109.8	R46 N52 I56 F90	R46-V54 PolarHBondContact N-O 2.88Å; R46-V54 PolarHBondContact O-N 3.33Å; N52-V54 WeakPolarHBondContact O-CG2 3.47Å; V54-I56 HydrophobicContact CG1-CD1 4.43Å; V54-I56 HydrophobicContact CG1-CG1 3.89Å; V54-F90 HydrophobicContact CB-CD1 4.46Å; V54-F90 HydrophobicContact CB-CE1 4.29Å; V54-F90 HydrophobicContact CG1-CD1 4.3Å; V54-F90 HydrophobicContact CG1-CD2 4.36Å; V54-F90 HydrophobicContact CG1-CE1 4.09Å; V54-F90 HydrophobicContact CG1-CE2 4.14Å; V54-F90 HydrophobicContact CG1-CG 4.44Å; V54-F90 HydrophobicContact CG1-CZ 4Å; V54-F90 HydrophobicContact CG2-CD1 3.42Å; V54-F90 VanDerWaalsContact CG2-CD1 3.42Å; V54-F90 HydrophobicContact CG2-CE1 3.18Å; V54-F90 HydrophobicContact CG2-CG 4.28Å; V54-F90 HydrophobicContact CG2-CZ 3.88Å
55	T	96.9	Very high	92.2	Very high	0 Å²	0	77.4 Å²	77.4	0%	0	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	127.6	169.8	-65.1	0	0	0	0	108.9	P43 V44 F57 V89 R95 A98	P43-T55 HydrophobicContact CB-CG2 3.65Å; V44-T55 WeakPolarHBondContact O-CA 3.31Å; T55-F57 HydrophobicContact CG2-CD1 4.4Å; T55-V89 PolarHBondContact N-O 2.9Å; T55-V89 PolarHBondContact O-N 2.8Å; T55-R95 WeakPolarHBondContact OG1-CG 3.45Å; T55-R95 PolarHBondContact OG1-O 3.13Å; T55-A98 HydrophobicContact CG2-CB 4.14Å
56	I	96.6	Very high	91.4	Very high	30 Å²	30	84.3 Å²	84.3	15%	0.154	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	134.5	-176.4	-59.1	157.9	0	0	0	109.2	P43 V44 R46 V54 R86 I87	P43-I56 WeakPolarHBondContact CA-O 3.05Å; V44-I56 PolarHBondContact N-O 3.18Å; V44-I56 PolarHBondContact O-N 2.8Å; R46-I56 HydrophobicContact CB-CD1 4.09Å; V54-I56 HydrophobicContact CG1-CD1 4.43Å; V54-I56 HydrophobicContact CG1-CG1 3.89Å; I56-R86 HydrophobicContact CG2-CG 4.38Å; I56-I87 WeakPolarHBondContact CA-O 3.45Å
57	F	97.1	Very high	90.2	Very high	8 Å²	8	79 Å²	79	4%	0.035	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.4	167.6	172.6	57.9	-92.3	0	0	0	111.2	V39 P43 T55 I87 V89 A98 I108 I137	V39-F57 HydrophobicContact CG2-CD2 4.29Å; V39-F57 HydrophobicContact CG2-CE2 4.49Å; P43-F57 HydrophobicContact CB-CB 4.26Å; P43-F57 HydrophobicContact CB-CD1 4.36Å; T55-F57 HydrophobicContact CG2-CD1 4.4Å; F57-I87 HydrophobicContact CD2-CB 3.99Å; F57-I87 HydrophobicContact CD2-CG1 4.07Å; F57-I87 HydrophobicContact CE1-CB 4.23Å; F57-I87 HydrophobicContact CE1-CG2 4.02Å; F57-I87 HydrophobicContact CE2-CB 3.6Å; F57-I87 HydrophobicContact CE2-CG1 3.61Å; F57-I87 HydrophobicContact CE2-CG2 3.88Å; F57-I87 HydrophobicContact CG-CB 4.44Å; F57-I87 HydrophobicContact CZ-CB 3.75Å; F57-I87 HydrophobicContact CZ-CG1 4.19Å; F57-I87 HydrophobicContact CZ-CG2 3.52Å; F57-I87 PolarHBondContact N-O 3.17Å; F57-I87 VanDerWaalsContact N-O 3.16Å; F57-I87 PolarHBondContact O-N 2.83Å; F57-V89 HydrophobicContact CE1-CG2 3.86Å; F57-A98 HydrophobicContact CE1-CB 4.42Å; F57-I108 HydrophobicContact CD2-CD1 4.47Å; F57-I108 HydrophobicContact CE2-CD1 3.53Å; F57-I108 HydrophobicContact CZ-CD1 3.87Å; F57-I137 HydrophobicContact CE1-CD1 4.48Å; F57-I137 HydrophobicContact CZ-CD1 4.26Å
58	S	97.4	Very high	88.9	Confident	29 Å²	29	74.4 Å²	74.4	20%	0.203	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	142	175.9	62.5	0	0	0	0	111.6	V39 G40 H85	V39-S58 CarbonylContact C-O 3.6Å; V39-S58 WeakPolarHBondContact CA-O 3.29Å; G40-S58 PolarHBondContact N-O 3.32Å; S58-H85 CarbonylContact C-O 3.57Å; S58-H85 VanDerWaalsContact CA-O 3.31Å; S58-H85 WeakPolarHBondContact CA-O 3.46Å
59	L	97.7	Very high	87.7	Confident	0 Å²	0	80 Å²	80	0%	0	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	123.6	176.5	-174.3	121.8	0	0	0	110.7	L35 R38 T61 H85 I87 I108 L110	L35-L59 HydrophobicContact CB-CD2 3.78Å; L35-L59 HydrophobicContact CD1-CD2 3.95Å; L35-L59 HydrophobicContact CG-CD2 4.48Å; R38-L59 WeakPolarHBondContact O-CA 3.43Å; L59-T61 HydrophobicContact CD2-CG2 3.82Å; L59-H85 HydrophobicContact CB-CB 4.46Å; L59-H85 PolarHBondContact N-O 2.96Å; L59-H85 PolarHBondContact O-N 2.91Å; L59-H85 PolarHBondContact O-ND1 2.8Å; L59-I87 HydrophobicContact CB-CD1 4.44Å; L59-I87 HydrophobicContact CB-CG1 4.05Å; L59-I108 HydrophobicContact CD1-CD1 3.58Å; L59-I108 HydrophobicContact CD1-CG1 3.33Å; L59-L110 HydrophobicContact CD1-CD2 4.01Å
60	A	97.9	Very high	86.3	Confident	15 Å²	15	74.3 Å²	74.3	12%	0.124	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.1	132	173.9	0	0	0	0	0	110.9	G37 R38 T82 T83 W84	G37-A60 VanDerWaalsContact CA-O 3.22Å; G37-A60 WeakPolarHBondContact CA-O 3.28Å; R38-A60 PolarHBondContact N-O 2.7Å; R38-A60 VanDerWaalsContact N-O 3.09Å; R38-A60 PolarHBondContact O-N 2.93Å; A60-T82 HydrophobicContact CB-CG2 3.92Å; A60-T83 WeakPolarHBondContact CA-O 3.45Å; A60-W84 HydrophobicContact CB-CD2 4.33Å; A60-W84 HydrophobicContact CB-CE3 3.92Å; A60-W84 HydrophobicContact CB-CH2 3.87Å; A60-W84 HydrophobicContact CB-CZ2 4.27Å; A60-W84 HydrophobicContact CB-CZ3 3.65Å
61	T	97.1	Very high	85.2	Confident	32 Å²	32	79 Å²	79	20%	0.196	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	138	163.1	63.8	0	0	0	0	109	L35 L59 T82 T83 H85	L35-T61 HydrophobicContact CD2-CG2 4.29Å; L59-T61 HydrophobicContact CD2-CG2 3.82Å; T61-T82 WeakPolarHBondContact O-CA 3.4Å; T61-T83 PolarHBondContact N-O 2.92Å; T61-T83 PolarHBondContact O-N 3.38Å; T61-H85 PolarHBondContact OG1-CE1 2.96Å
62	N	95.1	Very high	83.8	Confident	94 Å²	94	76.4 Å²	76.4	50%	0.503	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	132.8	178.6	-60.3	-34.2	0	0	0	109.4	Q80 K81 T82	N62-Q80 HydrophobicContact CB-CG 4.47Å; N62-K81 CarbonylContact C-O 3.6Å; N62-K81 WeakPolarHBondContact CA-O 2.99Å; N62-T82 WeakPolarHBondContact OD1-CB 3.39Å; N62-T82 WeakPolarHBondContact OD1-CG2 3.32Å; N62-T82 PolarHBondContact OD1-OG1 3.29Å
63	E	92.4	Very high	82.1	Confident	116 Å²	116	81.1 Å²	81.1	54%	0.542	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	126.1	170.3	-175.2	178	-177.8	0	0	107.7	Q80 K81	E63-Q80 CarbonylContact O-C 3.58Å; E63-Q80 WeakPolarHBondContact O-CA 3.32Å; E63-K81 PolarHBondContact N-O 3Å; E63-K81 PolarHBondContact O-N 2.79Å
64	M	88.6	Confident	80.4	Confident	127 Å²	127	86.4 Å²	86.4	63%	0.626	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.3	129.8	177.6	-64.4	172.9	-178.5	0	0	108.1	S79 Q80	M64-S79 WeakPolarHBondContact CA-O 3.34Å; M64-Q80 HydrophobicContact CG-CB 4.38Å; M64-Q80 HydrophobicContact CG-CG 4.11Å
65	W	85.4	Confident	78.5	Confident	130 Å²	130	95.1 Å²	95.1	49%	0.492	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.4	149.6	178.4	60.7	-82.5	0	0	0	109.7	S67 S79	W65-S67 WeakPolarHBondContact CH2-OG 3.49Å; W65-S67 WeakPolarHBondContact CZ2-OG 3.23Å; W65-S67 WeakPolarHBondContact CZ3-OG 3.36Å; W65-S79 PolarHBondContact N-O 3.39Å; W65-S79 PolarHBondContact O-N 2.8Å
66	R	79.1	Confident	76.9	Confident	211 Å²	211	98.2 Å²	98.2	80%	0.796	51%	0.508	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.6	128.6	177	-64.7	-174	179.6	114	-1.2	108.9	D77 V78	R66-D77 CarbonylContact C-O 3.51Å; R66-D77 VanDerWaalsContact CA-O 3.27Å; R66-D77 WeakPolarHBondContact CA-O 3.03Å; R66-V78 HydrophobicContact CG-CG2 4.41Å
67	S	67.6	Low	75.6	Confident	38 Å²	38	99.8 Å²	99.8	27%	0.266	52%	0.517	S	S	.	.			trans	-104.8	77.5	-177.2	-48.1	0	0	0	0	109.5	W65 D77 S79	W65-S67 WeakPolarHBondContact CH2-OG 3.49Å; W65-S67 WeakPolarHBondContact CZ2-OG 3.23Å; W65-S67 WeakPolarHBondContact CZ3-OG 3.36Å; S67-D77 PolarHBondContact N-O 3.31Å; S67-S79 WeakPolarHBondContact OG-CB 3.42Å; S67-S79 PolarHBondContact OG-OG 2.94Å
68	G	64.9	Low	74.6	Confident	53 Å²	53	103.7 Å²	103.7	55%	0.546	54%	0.541	S	S	.	.			trans	-175.4	137	175	0	0	0	0	0	113.1	S70	G68-S70 VanDerWaalsContact C-N 3.27Å
69	D	59.7	Low	74	Confident	180 Å²	180	104.4 Å²	104.4	96%	0.963	55%	0.546	S	S	*	.			trans	-83.5	0.9	172.3	-100.6	-15.5	0	0	0	112.5
70	S	55.4	Low	73.6	Confident	74 Å²	74	109.7 Å²	109.7	52%	0.517	57%	0.571	S	S	.	*			trans	-87.4	125.1	-173.4	45.1	0	0	0	0	112	G68 V72	G68-S70 VanDerWaalsContact C-N 3.27Å; S70-V72 PolarHBondContact O-N 3.02Å
71	E	57	Low	73.4	Confident	189 Å²	189	115 Å²	115	88%	0.883	59%	0.591	S	S	*	*	S	Bend	trans	-60.6	2.7	168.1	-67.3	-176.8	150.6	0	0	113.9
72	V	55.9	Low	73.3	Confident	102 Å²	102	116.1 Å²	116.1	62%	0.618	60%	0.598	S	S	*	*	S	Bend	trans	-112.7	110.6	-177	-176.4	0	0	0	0	109.8	S70 Q74	S70-V72 PolarHBondContact O-N 3.02Å; V72-Q74 PolarHBondContact O-N 2.97Å
73	Y	53.9	Low	73.4	Confident	228 Å²	228	114 Å²	114	89%	0.894	59%	0.589	S	S	*	*			trans	-61.8	97.1	-179.6	-51.1	-81.2	0	0	0	112.3
74	Q	56.9	Low	73.6	Confident	140 Å²	140	116 Å²	116	65%	0.654	59%	0.592	S	S	*	*			trans	-100.5	130.9	162.7	-67	-169.1	1.8	0	0	109.8	V72 G76	V72-Q74 PolarHBondContact O-N 2.97Å; Q74-G76 PolarHBondContact O-N 2.91Å
75	M	56	Low	74	Confident	202 Å²	202	111.9 Å²	111.9	100%	0.995	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.6	3.4	-174.5	-169.1	159.6	122.9	0	0	114.1
76	G	63.1	Low	74.6	Confident	65 Å²	65	110.6 Å²	110.6	67%	0.67	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.8	-11.6	-176.2	0	0	0	0	0	115.9	Q74 V78	Q74-G76 PolarHBondContact O-N 2.91Å; G76-V78 PolarHBondContact O-N 2.86Å
77	D	68.9	Low	75.4	Confident	63 Å²	63	100.5 Å²	100.5	34%	0.337	53%	0.528	S	S	.	.			trans	-99.5	34.9	-167.8	-66.3	-19.8	0	0	0	113.7	R66 S67	R66-D77 CarbonylContact C-O 3.51Å; R66-D77 VanDerWaalsContact CA-O 3.27Å; R66-D77 WeakPolarHBondContact CA-O 3.03Å; S67-D77 PolarHBondContact N-O 3.31Å
78	V	76.4	Confident	76.8	Confident	89 Å²	89	98.9 Å²	98.9	54%	0.539	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	108.1	175.5	-174.1	0	0	0	0	109.9	R66 G76	R66-V78 HydrophobicContact CG-CG2 4.41Å; G76-V78 PolarHBondContact O-N 2.86Å
79	S	84.6	Confident	78.3	Confident	44 Å²	44	96.3 Å²	96.3	31%	0.308	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	141.1	174.4	-72.2	0	0	0	0	111	M64 W65 S67	M64-S79 WeakPolarHBondContact CA-O 3.34Å; W65-S79 PolarHBondContact N-O 3.39Å; W65-S79 PolarHBondContact O-N 2.8Å; S67-S79 WeakPolarHBondContact OG-CB 3.42Å; S67-S79 PolarHBondContact OG-OG 2.94Å
80	Q	89.4	Confident	80	Confident	112 Å²	112	92 Å²	92	52%	0.523	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	132	176.7	-176.5	-177.8	-45.3	0	0	110.9	N62 E63 M64	N62-Q80 HydrophobicContact CB-CG 4.47Å; E63-Q80 CarbonylContact O-C 3.58Å; E63-Q80 WeakPolarHBondContact O-CA 3.32Å; M64-Q80 HydrophobicContact CG-CB 4.38Å; M64-Q80 HydrophobicContact CG-CG 4.11Å
81	K	93.1	Very high	81.9	Confident	125 Å²	125	95.9 Å²	95.9	54%	0.543	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	128.7	172.6	-176.4	178.4	177.7	-176.6	0	110.1	N62 E63	N62-K81 CarbonylContact C-O 3.6Å; N62-K81 WeakPolarHBondContact CA-O 2.99Å; E63-K81 PolarHBondContact N-O 3Å; E63-K81 PolarHBondContact O-N 2.79Å
82	T	95.4	Very high	83.5	Confident	56 Å²	56	90.8 Å²	90.8	34%	0.344	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	124.9	174.2	-60.1	0	0	0	0	110.1	A60 T61 N62 W84	A60-T82 HydrophobicContact CB-CG2 3.92Å; T61-T82 WeakPolarHBondContact O-CA 3.4Å; N62-T82 WeakPolarHBondContact OD1-CB 3.39Å; N62-T82 WeakPolarHBondContact OD1-CG2 3.32Å; N62-T82 PolarHBondContact OD1-OG1 3.29Å; T82-W84 HydrophobicContact CG2-CZ2 4.43Å
83	T	97.3	Very high	85.3	Confident	51 Å²	51	88.3 Å²	88.3	31%	0.313	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	127.8	175.1	-56.5	0	0	0	0	109.9	A60 T61 H85	A60-T83 WeakPolarHBondContact CA-O 3.45Å; T61-T83 PolarHBondContact N-O 2.92Å; T61-T83 PolarHBondContact O-N 3.38Å; T83-H85 VanDerWaalsContact CG2-CE1 3.44Å; T83-H85 WeakPolarHBondContact CG2-CE1 3.05Å; T83-H85 PolarHBondContact O-ND1 2.94Å
84	W	97.1	Very high	87.2	Confident	157 Å²	157	78.5 Å²	78.5	60%	0.595	41%	0.408	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.1	120.5	-179.9	-70.2	98.6	0	0	0	111	A60 T82	A60-W84 HydrophobicContact CB-CD2 4.33Å; A60-W84 HydrophobicContact CB-CE3 3.92Å; A60-W84 HydrophobicContact CB-CH2 3.87Å; A60-W84 HydrophobicContact CB-CZ2 4.27Å; A60-W84 HydrophobicContact CB-CZ3 3.65Å; T82-W84 HydrophobicContact CG2-CZ2 4.43Å
85	H	97.4	Very high	89.1	Confident	40 Å²	40	73 Å²	73	19%	0.185	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	133.5	-179.2	-58.5	82.8	0	0	0	110.2	L35 S58 L59 T61 T83 I87 I132	L35-H85 HydrophobicContact CD1-CB 3.93Å; S58-H85 CarbonylContact C-O 3.57Å; S58-H85 VanDerWaalsContact CA-O 3.31Å; S58-H85 WeakPolarHBondContact CA-O 3.46Å; L59-H85 HydrophobicContact CB-CB 4.46Å; L59-H85 PolarHBondContact N-O 2.96Å; L59-H85 PolarHBondContact O-N 2.91Å; L59-H85 PolarHBondContact O-ND1 2.8Å; T61-H85 PolarHBondContact OG1-CE1 2.96Å; T83-H85 VanDerWaalsContact CG2-CE1 3.44Å; T83-H85 WeakPolarHBondContact CG2-CE1 3.05Å; T83-H85 PolarHBondContact O-ND1 2.94Å; H85-I87 HydrophobicContact CB-CD1 3.95Å; H85-I132 HydrophobicContact CB-CD1 4.11Å
86	R	96.8	Very high	90.9	Very high	103 Å²	103	66.8 Å²	66.8	39%	0.389	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	118.2	171.4	-173.9	179.8	-176.3	-77.9	-2.6	109.4	I56 S88 T131 I132	I56-R86 HydrophobicContact CG2-CG 4.38Å; R86-S88 PolarHBondContact NH1-OG 2.85Å; R86-T131 PolarHBondContact NH1-OG1 3Å; R86-T131 VanDerWaalsContact NH1-OG1 3.13Å; R86-T131 PolarHBondContact O-OG1 2.98Å; R86-I132 PolarHBondContact O-N 3.04Å
87	I	97.5	Very high	92.4	Very high	0 Å²	0	66.2 Å²	66.2	0%	0	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	133.3	-179.4	-46.8	-55.5	0	0	0	109.2	L35 I56 F57 L59 H85 V89 L110 I132 A134	L35-I87 HydrophobicContact CD1-CD1 4.22Å; I56-I87 WeakPolarHBondContact CA-O 3.45Å; F57-I87 HydrophobicContact CD2-CB 3.99Å; F57-I87 HydrophobicContact CD2-CG1 4.07Å; F57-I87 HydrophobicContact CE1-CB 4.23Å; F57-I87 HydrophobicContact CE1-CG2 4.02Å; F57-I87 HydrophobicContact CE2-CB 3.6Å; F57-I87 HydrophobicContact CE2-CG1 3.61Å; F57-I87 HydrophobicContact CE2-CG2 3.88Å; F57-I87 HydrophobicContact CG-CB 4.44Å; F57-I87 HydrophobicContact CZ-CB 3.75Å; F57-I87 HydrophobicContact CZ-CG1 4.19Å; F57-I87 HydrophobicContact CZ-CG2 3.52Å; F57-I87 PolarHBondContact N-O 3.17Å; F57-I87 VanDerWaalsContact N-O 3.16Å; F57-I87 PolarHBondContact O-N 2.83Å; L59-I87 HydrophobicContact CB-CD1 4.44Å; L59-I87 HydrophobicContact CB-CG1 4.05Å; H85-I87 HydrophobicContact CB-CD1 3.95Å; I87-V89 HydrophobicContact CG2-CG2 4.5Å; I87-L110 HydrophobicContact CD1-CD1 4.37Å; I87-L110 HydrophobicContact CD1-CD2 3.73Å; I87-L110 HydrophobicContact CG1-CD2 3.84Å; I87-L110 HydrophobicContact CG2-CD2 4.18Å; I87-I132 CarbonylContact C-O 3.56Å; I87-I132 WeakPolarHBondContact CA-O 3.37Å; I87-I132 HydrophobicContact CD1-CB 3.83Å; I87-I132 HydrophobicContact CD1-CD1 4.01Å; I87-I132 HydrophobicContact CD1-CG1 4.47Å; I87-I132 HydrophobicContact CD1-CG2 4.27Å; I87-A134 HydrophobicContact CG2-CB 3.81Å
88	S	96.6	Very high	93.6	Very high	3 Å²	3	63.2 Å²	63.2	2%	0.021	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	128.6	174.2	-60.1	0	0	0	0	109.9	R86 T131 I132 I133 A134	R86-S88 PolarHBondContact NH1-OG 2.85Å; S88-T131 PolarHBondContact OG-OG1 3.22Å; S88-I132 PolarHBondContact N-O 2.87Å; S88-I133 WeakPolarHBondContact O-CA 3.35Å; S88-A134 PolarHBondContact O-N 2.82Å
89	V	96.9	Very high	94.5	Very high	0 Å²	0	64.2 Å²	64.2	0%	0	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	111.8	179.6	-167.3	0	0	0	0	109.3	T55 F57 I87 L94 R95 A98 A134 I137	T55-V89 PolarHBondContact N-O 2.9Å; T55-V89 PolarHBondContact O-N 2.8Å; F57-V89 HydrophobicContact CE1-CG2 3.86Å; I87-V89 HydrophobicContact CG2-CG2 4.5Å; V89-L94 HydrophobicContact CG1-CB 3.92Å; V89-L94 HydrophobicContact CG1-CD2 3.93Å; V89-L94 HydrophobicContact CG1-CG 3.77Å; V89-R95 HydrophobicContact CB-CB 4.43Å; V89-R95 HydrophobicContact CG1-CB 4.09Å; V89-A98 HydrophobicContact CG2-CB 4.22Å; V89-A134 HydrophobicContact CG2-CB 4.29Å; V89-I137 HydrophobicContact CG2-CD1 4.1Å
90	F	94.9	Very high	94.9	Very high	89 Å²	89	67.9 Å²	67.9	39%	0.39	33%	0.326	S	S	.	.			trans	-100.4	-28.9	-179.3	-69.7	-93.2	0	0	0	112.9	V54 P92 I133	V54-F90 HydrophobicContact CB-CD1 4.46Å; V54-F90 HydrophobicContact CB-CE1 4.29Å; V54-F90 HydrophobicContact CG1-CD1 4.3Å; V54-F90 HydrophobicContact CG1-CD2 4.36Å; V54-F90 HydrophobicContact CG1-CE1 4.09Å; V54-F90 HydrophobicContact CG1-CE2 4.14Å; V54-F90 HydrophobicContact CG1-CG 4.44Å; V54-F90 HydrophobicContact CG1-CZ 4Å; V54-F90 HydrophobicContact CG2-CD1 3.42Å; V54-F90 VanDerWaalsContact CG2-CD1 3.42Å; V54-F90 HydrophobicContact CG2-CE1 3.18Å; V54-F90 HydrophobicContact CG2-CG 4.28Å; V54-F90 HydrophobicContact CG2-CZ 3.88Å; F90-P92 WeakPolarHBondContact O-CD 3.48Å; F90-I133 HydrophobicContact CD2-CG1 4.34Å; F90-I133 HydrophobicContact CD2-CG2 3.99Å; F90-I133 HydrophobicContact CE2-CD1 4.25Å; F90-I133 HydrophobicContact CE2-CG1 4.06Å
91	R	94.4	Very high	95	Very high	155 Å²	155	68.7 Å²	68.7	59%	0.585	33%	0.325	S	S	*	.	S	Bend	trans	-59.7	118.8	-177.3	180	176	175.3	172.4	1.2	109.5	G93 L94 R95 D135	R91-G93 PolarHBondContact O-N 2.93Å; R91-L94 HydrophobicContact CB-CB 4.07Å; R91-L94 HydrophobicContact CG-CB 4.18Å; R91-L94 PolarHBondContact O-N 3.3Å; R91-L94 VanDerWaalsContact O-N 3.1Å; R91-R95 VanDerWaalsContact O-CB 3.29Å; R91-R95 WeakPolarHBondContact O-CB 3.43Å; R91-R95 PolarHBondContact O-N 3.42Å; R91-D135 PolarHBondContact NH1-O 3.06Å
92	P	90.9	Very high	95.1	Very high	82 Å²	82	62.8 Å²	62.8	53%	0.532	30%	0.299	S	S	.	.	H	α-helix	trans	-51.3	-53.6	-167.4	-30.9	35.2	0	0	0	114.5	F90 L94 R95 D96	F90-P92 WeakPolarHBondContact O-CD 3.48Å; P92-L94 PolarHBondContact O-N 2.82Å; P92-R95 PolarHBondContact O-N 2.59Å; P92-D96 VanDerWaalsContact O-CG 3.26Å; P92-D96 PolarHBondContact O-N 2.83Å
93	G	93	Very high	95	Very high	50 Å²	50	64.9 Å²	64.9	52%	0.515	30%	0.304	S	S	.	.	H	α-helix	trans	-66.7	-38	-180	0	0	0	0	0	114	R91 V97	R91-G93 PolarHBondContact O-N 2.93Å; G93-V97 VanDerWaalsContact O-CG2 3.28Å; G93-V97 WeakPolarHBondContact O-CG2 3.11Å; G93-V97 PolarHBondContact O-N 3.34Å
94	L	94.9	Very high	94.9	Very high	23 Å²	23	69.3 Å²	69.3	12%	0.12	32%	0.319	C	S	.	.	H	α-helix	trans	-72.3	-33.8	179.7	-170.8	64.3	0	0	0	111.8	V89 R91 P92 A98 D135 I137	V89-L94 HydrophobicContact CG1-CB 3.92Å; V89-L94 HydrophobicContact CG1-CD2 3.93Å; V89-L94 HydrophobicContact CG1-CG 3.77Å; R91-L94 HydrophobicContact CB-CB 4.07Å; R91-L94 HydrophobicContact CG-CB 4.18Å; R91-L94 PolarHBondContact O-N 3.3Å; R91-L94 VanDerWaalsContact O-N 3.1Å; P92-L94 PolarHBondContact O-N 2.82Å; L94-A98 WeakPolarHBondContact O-CB 3.41Å; L94-A98 PolarHBondContact O-N 2.71Å; L94-D135 WeakPolarHBondContact CD2-O 3.41Å; L94-I137 HydrophobicContact CD1-CB 4.12Å; L94-I137 HydrophobicContact CD1-CD1 4.27Å; L94-I137 HydrophobicContact CD1-CG1 4.28Å; L94-I137 HydrophobicContact CD2-CD1 4.25Å; L94-I137 HydrophobicContact CD2-CG1 4.19Å; L94-I137 HydrophobicContact CG-CD1 4.17Å; L94-I137 HydrophobicContact CG-CG1 4.45Å
95	R	95.8	Very high	94.8	Very high	25 Å²	25	63.4 Å²	63.4	9%	0.094	31%	0.306	C	S	.	.	H	α-helix	trans	-62.1	-45.7	178.5	177.2	-170.3	65.9	-139.5	-9	111.5	L45 P53 T55 V89 R91 P92 A98 Y99	L45-R95 HydrophobicContact CD1-CG 4.09Å; P53-R95 VanDerWaalsContact C-CD 3.45Å; P53-R95 WeakPolarHBondContact O-CD 3.41Å; P53-R95 PolarHBondContact O-NH1 3.17Å; T55-R95 WeakPolarHBondContact OG1-CG 3.45Å; T55-R95 PolarHBondContact OG1-O 3.13Å; V89-R95 HydrophobicContact CB-CB 4.43Å; V89-R95 HydrophobicContact CG1-CB 4.09Å; R91-R95 VanDerWaalsContact O-CB 3.29Å; R91-R95 WeakPolarHBondContact O-CB 3.43Å; R91-R95 PolarHBondContact O-N 3.42Å; P92-R95 PolarHBondContact O-N 2.59Å; R95-A98 PolarHBondContact O-N 3.09Å; R95-Y99 PolarHBondContact O-N 3.07Å
96	D	94.2	Very high	94.6	Very high	70 Å²	70	61.7 Å²	61.7	37%	0.374	30%	0.299	S	S	.	.	H	α-helix	trans	-71.7	-40.9	-176.7	-56	-17.4	0	0	0	110	P92 Y99 Q100	P92-D96 VanDerWaalsContact O-CG 3.26Å; P92-D96 PolarHBondContact O-N 2.83Å; D96-Y99 PolarHBondContact O-N 3.07Å; D96-Q100 WeakPolarHBondContact O-CG 3.45Å; D96-Q100 PolarHBondContact O-N 3.16Å
97	V	94.6	Very high	94.6	Very high	53 Å²	53	62.3 Å²	62.3	32%	0.321	30%	0.301	S	S	.	.	H	α-helix	trans	-60.4	-45.9	170.7	170.8	0	0	0	0	111.1	G93 Y99 Q100 Y101 F139	G93-V97 VanDerWaalsContact O-CG2 3.28Å; G93-V97 WeakPolarHBondContact O-CG2 3.11Å; G93-V97 PolarHBondContact O-N 3.34Å; V97-Y99 VanDerWaalsContact C-N 3.3Å; V97-Y99 PolarHBondContact O-N 2.86Å; V97-Q100 PolarHBondContact O-N 2.84Å; V97-Y101 HydrophobicContact CB-CD2 4.37Å; V97-Y101 HydrophobicContact CG1-CD2 3.8Å; V97-Y101 HydrophobicContact CG1-CE2 4.39Å; V97-Y101 WeakPolarHBondContact O-CB 3.33Å; V97-Y101 VanDerWaalsContact O-CD2 3.31Å; V97-Y101 WeakPolarHBondContact O-CD2 3.44Å; V97-Y101 PolarHBondContact O-N 2.91Å; V97-F139 HydrophobicContact CG1-CE2 3.75Å; V97-F139 HydrophobicContact CG1-CZ 3.86Å
98	A	94.7	Very high	94.6	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	30%	0.301	C	S	.	.	H	α-helix	trans	-60.7	-42.1	178	0	0	0	0	0	111.2	T55 F57 V89 L94 R95 V102 I137	T55-A98 HydrophobicContact CG2-CB 4.14Å; F57-A98 HydrophobicContact CE1-CB 4.42Å; V89-A98 HydrophobicContact CG2-CB 4.22Å; L94-A98 WeakPolarHBondContact O-CB 3.41Å; L94-A98 PolarHBondContact O-N 2.71Å; R95-A98 PolarHBondContact O-N 3.09Å; A98-V102 HydrophobicContact CB-CG2 4.18Å; A98-V102 WeakPolarHBondContact O-CA 3.49Å; A98-V102 WeakPolarHBondContact O-CB 3.03Å; A98-V102 VanDerWaalsContact O-CG2 3.23Å; A98-V102 WeakPolarHBondContact O-CG2 3.19Å; A98-V102 PolarHBondContact O-N 3.42Å; A98-I137 HydrophobicContact CB-CD1 4.18Å
99	Y	95.3	Very high	94.6	Very high	110 Å²	110	64.7 Å²	64.7	43%	0.431	31%	0.31	S	S	.	.	H	α-helix	trans	-66.4	-38.8	178.8	-178.6	-115.4	0	0	0	113.2	P43 L45 R95 D96 V97	P43-Y99 HydrophobicContact CB-CD2 4.41Å; P43-Y99 HydrophobicContact CG-CD2 4.27Å; P43-Y99 WeakPolarHBondContact O-CE2 3.49Å; L45-Y99 HydrophobicContact CB-CD2 3.88Å; L45-Y99 HydrophobicContact CB-CE2 3.93Å; L45-Y99 HydrophobicContact CB-CG 4.24Å; R95-Y99 PolarHBondContact O-N 3.07Å; D96-Y99 PolarHBondContact O-N 3.07Å; V97-Y99 VanDerWaalsContact C-N 3.3Å; V97-Y99 PolarHBondContact O-N 2.86Å
100	Q	93.1	Very high	94.6	Very high	121 Å²	121	64.7 Å²	64.7	57%	0.565	31%	0.31	S	S	*	.	H	α-helix	trans	-75.7	-46.6	-178.4	-71.2	177.8	-5.1	0	0	112.8	D96 V97	D96-Q100 WeakPolarHBondContact O-CG 3.45Å; D96-Q100 PolarHBondContact O-N 3.16Å; V97-Q100 PolarHBondContact O-N 2.84Å
101	Y	92.1	Very high	94.8	Very high	130 Å²	130	62 Å²	62	51%	0.51	30%	0.298	S	S	.	.	H	α-helix	trans	-100.4	-23.9	-168	-64.9	-83.1	0	0	0	114.1	V97 K103	V97-Y101 HydrophobicContact CB-CD2 4.37Å; V97-Y101 HydrophobicContact CG1-CD2 3.8Å; V97-Y101 HydrophobicContact CG1-CE2 4.39Å; V97-Y101 WeakPolarHBondContact O-CB 3.33Å; V97-Y101 VanDerWaalsContact O-CD2 3.31Å; V97-Y101 WeakPolarHBondContact O-CD2 3.44Å; V97-Y101 PolarHBondContact O-N 2.91Å; Y101-K103 PolarHBondContact O-N 3.29Å
102	V	94	Very high	94.9	Very high	0 Å²	0	54.9 Å²	54.9	0%	0	27%	0.274	C	S	.	.			trans	-74.8	126.7	174.3	-179.9	0	0	0	0	108.9	V39 P43 A98 F139	V39-V102 HydrophobicContact CB-CG1 4.16Å; V39-V102 HydrophobicContact CG1-CG1 3.78Å; V39-V102 HydrophobicContact CG2-CG1 3.56Å; P43-V102 WeakPolarHBondContact CD-O 3.31Å; P43-V102 HydrophobicContact CG-CB 4.07Å; P43-V102 HydrophobicContact CG-CG1 4.44Å; P43-V102 WeakPolarHBondContact CG-O 3.49Å; A98-V102 HydrophobicContact CB-CG2 4.18Å; A98-V102 WeakPolarHBondContact O-CA 3.49Å; A98-V102 WeakPolarHBondContact O-CB 3.03Å; A98-V102 VanDerWaalsContact O-CG2 3.23Å; A98-V102 WeakPolarHBondContact O-CG2 3.19Å; A98-V102 PolarHBondContact O-N 3.42Å; V102-F139 HydrophobicContact CG2-CE1 3.62Å; V102-F139 HydrophobicContact CG2-CZ 4.2Å
103	K	94.3	Very high	95.2	Very high	101 Å²	101	55.3 Å²	55.3	44%	0.439	27%	0.267	S	S	.	.			trans	-127	158.4	171.3	-59	-63.4	175.4	-167.6	0	110.5	Y101 G105 S106	Y101-K103 PolarHBondContact O-N 3.29Å; K103-G105 PolarHBondContact O-N 3.46Å; K103-S106 PolarHBondContact N-OG 3.43Å; K103-S106 VanDerWaalsContact N-OG 3.09Å; K103-S106 WeakPolarHBondContact O-CB 3.5Å; K103-S106 PolarHBondContact O-N 2.81Å; K103-S106 PolarHBondContact O-OG 2.85Å
104	K	95.3	Very high	95.4	Very high	144 Å²	144	55.3 Å²	55.3	63%	0.626	26%	0.255	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47.8	133.5	169.3	179.4	176	178.9	-171.2	0	110.8	G40 D42 S106	G40-K104 WeakPolarHBondContact O-CG 3.4Å; D42-K104 PolarHBondContact OD1-N 2.86Å; K104-S106 VanDerWaalsContact C-N 3.25Å; K104-S106 PolarHBondContact O-N 2.76Å
105	G	93.9	Very high	95.5	Very high	32 Å²	32	57.6 Å²	57.6	33%	0.33	27%	0.267	S	S	.	.	T	Hydrogen-bonded Turn	trans	83	-11.5	-178.9	0	0	0	0	0	115.3	R38 V39 K103 R107	R38-G105 PolarHBondContact NH1-O 3.41Å; V39-G105 PolarHBondContact O-N 2.88Å; K103-G105 PolarHBondContact O-N 3.46Å; G105-R107 PolarHBondContact O-N 2.95Å
106	S	94.4	Very high	95.5	Very high	4 Å²	4	62.2 Å²	62.2	3%	0.028	29%	0.285	C	S	.	.			trans	-56.7	132.7	177.8	-61.7	0	0	0	0	110.6	R38 V39 K103 K104	R38-S106 WeakPolarHBondContact CA-O 3.26Å; V39-S106 PolarHBondContact N-O 3.13Å; K103-S106 PolarHBondContact N-OG 3.43Å; K103-S106 VanDerWaalsContact N-OG 3.09Å; K103-S106 WeakPolarHBondContact O-CB 3.5Å; K103-S106 PolarHBondContact O-N 2.81Å; K103-S106 PolarHBondContact O-OG 2.85Å; K104-S106 VanDerWaalsContact C-N 3.25Å; K104-S106 PolarHBondContact O-N 2.76Å
107	R	96	Very high	95.2	Very high	117 Å²	117	60.1 Å²	60.1	44%	0.442	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.5	118.6	173.7	-164.3	179.5	-169.8	-166.9	0.8	107.9	G37 G105 L140 S141	G37-R107 WeakPolarHBondContact O-CA 3.37Å; G105-R107 PolarHBondContact O-N 2.95Å; R107-L140 HydrophobicContact CB-CB 4.32Å; R107-L140 HydrophobicContact CG-CB 4.26Å; R107-L140 HydrophobicContact CG-CD1 4.36Å; R107-L140 WeakPolarHBondContact O-CB 2.92Å; R107-L140 PolarHBondContact O-N 2.91Å; R107-S141 PolarHBondContact N-OG 2.82Å; R107-S141 PolarHBondContact O-N 3.38Å
108	I	96.7	Very high	94.9	Very high	0 Å²	0	62.6 Å²	62.6	0%	0	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	145.3	-177.2	62.7	174.6	0	0	0	110	L36 G37 V39 F57 L59 L110 I137 I138 F139	L36-I108 WeakPolarHBondContact CA-O 3.42Å; G37-I108 PolarHBondContact N-O 3.22Å; G37-I108 VanDerWaalsContact N-O 3.07Å; G37-I108 PolarHBondContact O-N 2.99Å; V39-I108 HydrophobicContact CG2-CD1 3.59Å; V39-I108 HydrophobicContact CG2-CG1 4Å; F57-I108 HydrophobicContact CD2-CD1 4.47Å; F57-I108 HydrophobicContact CE2-CD1 3.53Å; F57-I108 HydrophobicContact CZ-CD1 3.87Å; L59-I108 HydrophobicContact CD1-CD1 3.58Å; L59-I108 HydrophobicContact CD1-CG1 3.33Å; I108-L110 HydrophobicContact CD1-CD2 4.47Å; I108-I137 HydrophobicContact CB-CG2 4.36Å; I108-I138 WeakPolarHBondContact CA-O 3.48Å; I108-F139 HydrophobicContact CG2-CD1 4.01Å; I108-F139 HydrophobicContact CG2-CE1 4.44Å
109	Y	97.7	Very high	94.5	Very high	53 Å²	53	68.4 Å²	68.4	21%	0.208	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	139	161.3	168.5	-92.9	0	0	0	108.1	Q34 L35 L36 E111 I137 I138	Q34-Y109 HydrophobicContact CB-CE2 4.34Å; Q34-Y109 PolarHBondContact NE2-OH 3.48Å; L35-Y109 CarbonylContact O-C 3.59Å; L35-Y109 VanDerWaalsContact O-CA 3.32Å; L35-Y109 WeakPolarHBondContact O-CA 3.22Å; L36-Y109 HydrophobicContact CB-CD2 4.37Å; Y109-E111 HydrophobicContact CD1-CG 4.48Å; Y109-E111 HydrophobicContact CE1-CG 3.44Å; Y109-E111 VanDerWaalsContact CE1-CG 3.44Å; Y109-E111 VanDerWaalsContact OH-CD 3.24Å; Y109-E111 VanDerWaalsContact OH-CG 3.26Å; Y109-E111 WeakPolarHBondContact OH-CG 3.44Å; Y109-E111 PolarHBondContact OH-OE1 2.74Å; Y109-I137 CarbonylContact O-C 3.58Å; Y109-I137 WeakPolarHBondContact O-CA 2.76Å; Y109-I138 HydrophobicContact CD1-CB 4.07Å; Y109-I138 HydrophobicContact CD1-CD1 3.7Å; Y109-I138 HydrophobicContact CD1-CG1 3.93Å; Y109-I138 HydrophobicContact CE1-CD1 4.05Å; Y109-I138 PolarHBondContact N-O 2.82Å; Y109-I138 PolarHBondContact O-N 2.94Å
110	L	96.6	Very high	94.1	Very high	0 Å²	0	68.4 Å²	68.4	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	149.5	175.7	68.9	89.9	0	0	0	111	Q34 L35 L59 I87 I108 I132 N136 I137	Q34-L110 WeakPolarHBondContact CA-O 3.02Å; L35-L110 HydrophobicContact CB-CD1 4.17Å; L35-L110 HydrophobicContact CB-CD2 4.44Å; L35-L110 HydrophobicContact CB-CG 4.03Å; L35-L110 HydrophobicContact CD1-CD1 4.32Å; L35-L110 HydrophobicContact CG-CD1 4.38Å; L35-L110 PolarHBondContact N-O 2.91Å; L35-L110 PolarHBondContact O-N 3.49Å; L59-L110 HydrophobicContact CD1-CD2 4.01Å; I87-L110 HydrophobicContact CD1-CD1 4.37Å; I87-L110 HydrophobicContact CD1-CD2 3.73Å; I87-L110 HydrophobicContact CG1-CD2 3.84Å; I87-L110 HydrophobicContact CG2-CD2 4.18Å; I108-L110 HydrophobicContact CD1-CD2 4.47Å; L110-I132 HydrophobicContact CD1-CG2 4.09Å; L110-N136 WeakPolarHBondContact CA-O 3.38Å; L110-I137 HydrophobicContact CB-CG1 4.16Å
111	E	98.1	Very high	93.8	Very high	31 Å²	31	65.7 Å²	65.7	15%	0.145	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	145.6	167.6	-50.3	-166.7	108.5	0	0	110	R32 V33 Q34 Y109 D135 N136	R32-E111 IonicContact CZ-OE1 3.6Å; R32-E111 IonicContact NE-OE1 3.37Å; R32-E111 PolarHBondContact NE-OE1 2.76Å; R32-E111 VanDerWaalsContact NH2-CD 3.32Å; R32-E111 IonicContact NH2-OE1 2.74Å; R32-E111 PolarHBondContact NH2-OE1 2.9Å; R32-E111 IonicContact NH2-OE2 2.9Å; R32-E111 PolarHBondContact NH2-OE2 3.37Å; V33-E111 VanDerWaalsContact O-CA 3.32Å; V33-E111 WeakPolarHBondContact O-CA 3.32Å; Q34-E111 HydrophobicContact CG-CG 4.16Å; Q34-E111 PolarHBondContact NE2-OE1 2.74Å; Y109-E111 HydrophobicContact CD1-CG 4.48Å; Y109-E111 HydrophobicContact CE1-CG 3.44Å; Y109-E111 VanDerWaalsContact CE1-CG 3.44Å; Y109-E111 VanDerWaalsContact OH-CD 3.24Å; Y109-E111 VanDerWaalsContact OH-CG 3.26Å; Y109-E111 WeakPolarHBondContact OH-CG 3.44Å; Y109-E111 PolarHBondContact OH-OE1 2.74Å; E111-D135 PolarHBondContact O-N 2.73Å; E111-N136 HydrophobicContact CB-CB 4.24Å; E111-N136 PolarHBondContact N-O 2.86Å; E111-N136 PolarHBondContact O-N 2.85Å
112	G	97.5	Very high	93.5	Very high	6 Å²	6	69.1 Å²	69.1	6%	0.062	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-175	-154.8	-179.5	0	0	0	0	0	112.2	R32 V33 I133	R32-G112 CarbonylContact C-O 3.57Å; R32-G112 WeakPolarHBondContact CA-O 3.31Å; V33-G112 PolarHBondContact N-O 3.38Å; V33-G112 PolarHBondContact O-N 3.25Å; G112-I133 CarbonylContact C-O 3.54Å; G112-I133 WeakPolarHBondContact CA-O 3.27Å
113	K	97.5	Very high	93.4	Very high	92 Å²	92	75.5 Å²	75.5	40%	0.4	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	149.1	177.1	62	-173.8	178.6	-178	0	110.3	N31 I132 I133	N31-K113 HydrophobicContact CB-CB 4.49Å; K113-I132 CarbonylContact O-C 3.52Å; K113-I132 WeakPolarHBondContact O-CA 3.44Å; K113-I133 HydrophobicContact CG-CB 4.05Å; K113-I133 PolarHBondContact N-O 3.04Å; K113-I133 PolarHBondContact O-N 3.46Å
114	I	97.3	Very high	93	Very high	50 Å²	50	77.1 Å²	77.1	26%	0.256	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	134.7	172.3	-166.6	161.3	0	0	0	109.8	N31 V33 Y116 T130	N31-I114 PolarHBondContact ND2-O 3.28Å; N31-I114 PolarHBondContact OD1-N 3.29Å; V33-I114 HydrophobicContact CG2-CB 4.03Å; I114-Y116 HydrophobicContact CD1-CE1 4.24Å; I114-Y116 HydrophobicContact CD1-CE2 4.28Å; I114-Y116 WeakPolarHBondContact CD1-OH 3.49Å; I114-Y116 HydrophobicContact CG1-CE2 4.16Å; I114-Y116 HydrophobicContact CG2-CE2 4.25Å; I114-T130 HydrophobicContact CD1-CG2 3.72Å; I114-T130 HydrophobicContact CG1-CG2 3.87Å
115	D	96.2	Very high	92.9	Very high	70 Å²	70	73.4 Å²	73.4	37%	0.374	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	132	176.1	-174.3	-98.4	0	0	0	109.3	G117 T131 I133	D115-G117 PolarHBondContact OD1-N 2.98Å; D115-T131 HydrophobicContact CB-CG2 4.14Å; D115-T131 PolarHBondContact N-O 3.35Å; D115-T131 PolarHBondContact O-N 2.73Å; D115-T131 VanDerWaalsContact O-O 3.05Å; D115-I133 HydrophobicContact CB-CD1 3.65Å; D115-I133 HydrophobicContact CB-CG1 4.01Å
116	Y	95.1	Very high	92.6	Very high	122 Å²	122	79.2 Å²	79.2	48%	0.478	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	81.3	177.9	-63.7	-80.8	0	0	0	108.5	I114 E118 Q128 T130	I114-Y116 HydrophobicContact CD1-CE1 4.24Å; I114-Y116 HydrophobicContact CD1-CE2 4.28Å; I114-Y116 WeakPolarHBondContact CD1-OH 3.49Å; I114-Y116 HydrophobicContact CG1-CE2 4.16Å; I114-Y116 HydrophobicContact CG2-CE2 4.25Å; Y116-E118 PolarHBondContact O-N 2.99Å; Y116-Q128 HydrophobicContact CD1-CG 4.2Å; Y116-T130 HydrophobicContact CD1-CG2 3.78Å; Y116-T130 VanDerWaalsContact CD1-OG1 3.31Å; Y116-T130 WeakPolarHBondContact CD1-OG1 3.45Å; Y116-T130 HydrophobicContact CE1-CG2 3.55Å; Y116-T130 WeakPolarHBondContact CE1-OG1 3.45Å
117	G	89.3	Confident	92.4	Very high	26 Å²	26	85.3 Å²	85.3	27%	0.268	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	131.1	179.8	0	0	0	0	0	111	D115 Q128 A129	D115-G117 PolarHBondContact OD1-N 2.98Å; G117-Q128 CarbonylContact O-C 3.6Å; G117-A129 PolarHBondContact N-O 3.36Å; G117-A129 PolarHBondContact O-N 2.94Å
118	E	88.7	Confident	92.1	Very high	105 Å²	105	85.5 Å²	85.5	49%	0.491	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	135.8	174.1	-62.9	179.2	132.3	0	0	110.2	Y116 R126 R127	Y116-E118 PolarHBondContact O-N 2.99Å; E118-R126 HydrophobicContact CB-CG 4.4Å; E118-R126 IonicContact OE1-CZ 2.7Å; E118-R126 VanDerWaalsContact OE1-CZ 3.26Å; E118-R126 IonicContact OE1-NE 2.76Å; E118-R126 IonicContact OE1-NH1 2.76Å; E118-R126 PolarHBondContact OE1-NH1 2.99Å; E118-R126 IonicContact OE2-CZ 3.22Å; E118-R126 IonicContact OE2-NE 3.26Å; E118-R126 PolarHBondContact OE2-NE 3.19Å; E118-R126 IonicContact OE2-NH1 3.45Å; E118-R126 PolarHBondContact OE2-NH1 3.29Å; E118-R126 IonicContact OE2-NH2 3.41Å; E118-R126 PolarHBondContact OE2-NH2 2.84Å; E118-R127 WeakPolarHBondContact CA-O 3.43Å
119	Y	85.6	Confident	91.7	Very high	122 Å²	122	87.1 Å²	87.1	48%	0.478	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	151	172.9	71.1	-80.6	0	0	0	110.4	R127 A129	Y119-R127 HydrophobicContact CD1-CB 4.19Å; Y119-R127 HydrophobicContact CE1-CB 3.67Å; Y119-R127 HydrophobicContact CE2-CB 4.08Å; Y119-R127 PolarHBondContact N-O 3.35Å; Y119-R127 PolarHBondContact O-N 2.82Å; Y119-A129 HydrophobicContact CD1-CB 3.96Å; Y119-A129 HydrophobicContact CE1-CB 3.81Å
120	M	87.8	Confident	91.6	Very high	110 Å²	110	87.7 Å²	87.7	54%	0.542	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	128.6	173.2	-64.1	-59.8	178.6	0	0	109	R126	M120-R126 HydrophobicContact CE-CB 3.96Å; M120-R126 HydrophobicContact CE-CG 3.96Å; M120-R126 VanDerWaalsContact SD-CA 3.54Å; M120-R126 HydrophobicContact SD-CB 3.77Å; M120-R126 HydrophobicContact SD-CG 4.14Å
121	D	85.6	Confident	91.5	Very high	64 Å²	64	88.2 Å²	88.2	34%	0.342	43%	0.426	S	S	.	.			trans	-76.8	169.4	171.8	-160	-2	0	0	0	110.8	N123 N124 V125 R127	D121-N123 PolarHBondContact O-N 3.09Å; D121-N124 WeakPolarHBondContact O-CA 3.47Å; D121-N124 PolarHBondContact O-N 2.97Å; D121-V125 PolarHBondContact N-O 2.79Å; D121-R127 HydrophobicContact CB-CG 4.22Å
122	K	86.9	Confident	91.5	Very high	203 Å²	203	87.2 Å²	87.2	88%	0.883	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.9	-26	179.2	-65.1	-177.6	180	-178.9	0	113.4	N124	K122-N124 VanDerWaalsContact C-N 3.26Å; K122-N124 PolarHBondContact O-N 3.34Å
123	N	90.5	Very high	91.5	Very high	133 Å²	133	88 Å²	88	71%	0.711	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.8	14.1	177.9	-59.4	-19	0	0	0	113	D121 V125	D121-N123 PolarHBondContact O-N 3.09Å; N123-V125 HydrophobicContact CB-CG2 4.36Å; N123-V125 PolarHBondContact O-N 2.8Å
124	N	87.1	Confident	91.5	Very high	135 Å²	135	83.7 Å²	83.7	72%	0.722	41%	0.406	S	S	*	.	S	Bend	trans	58.8	26.7	-177.4	-153.4	29.2	0	0	0	114.4	D121 K122	D121-N124 WeakPolarHBondContact O-CA 3.47Å; D121-N124 PolarHBondContact O-N 2.97Å; K122-N124 VanDerWaalsContact C-N 3.26Å; K122-N124 PolarHBondContact O-N 3.34Å
125	V	91.8	Very high	91.4	Very high	67 Å²	67	84.8 Å²	84.8	41%	0.406	41%	0.412	S	S	.	.			trans	-94.9	128.9	175.2	178.7	0	0	0	0	109	D121 N123 R127	D121-V125 PolarHBondContact N-O 2.79Å; N123-V125 HydrophobicContact CB-CG2 4.36Å; N123-V125 PolarHBondContact O-N 2.8Å; V125-R127 PolarHBondContact O-N 2.9Å
126	R	88.3	Confident	91.5	Very high	154 Å²	154	84.7 Å²	84.7	58%	0.581	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.9	120.3	174.6	-163.4	-178.4	-128.6	-154.8	1.5	109.8	E118 M120	E118-R126 HydrophobicContact CB-CG 4.4Å; E118-R126 IonicContact OE1-CZ 2.7Å; E118-R126 VanDerWaalsContact OE1-CZ 3.26Å; E118-R126 IonicContact OE1-NE 2.76Å; E118-R126 IonicContact OE1-NH1 2.76Å; E118-R126 PolarHBondContact OE1-NH1 2.99Å; E118-R126 IonicContact OE2-CZ 3.22Å; E118-R126 IonicContact OE2-NE 3.26Å; E118-R126 PolarHBondContact OE2-NE 3.19Å; E118-R126 IonicContact OE2-NH1 3.45Å; E118-R126 PolarHBondContact OE2-NH1 3.29Å; E118-R126 IonicContact OE2-NH2 3.41Å; E118-R126 PolarHBondContact OE2-NH2 2.84Å; M120-R126 HydrophobicContact CE-CB 3.96Å; M120-R126 HydrophobicContact CE-CG 3.96Å; M120-R126 VanDerWaalsContact SD-CA 3.54Å; M120-R126 HydrophobicContact SD-CB 3.77Å; M120-R126 HydrophobicContact SD-CG 4.14Å
127	R	90.2	Very high	91.5	Very high	131 Å²	131	79.4 Å²	79.4	49%	0.494	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	144.5	175.3	-64.1	-63.8	-171.5	177.1	-0.8	109.6	E118 Y119 D121 V125	E118-R127 WeakPolarHBondContact CA-O 3.43Å; Y119-R127 HydrophobicContact CD1-CB 4.19Å; Y119-R127 HydrophobicContact CE1-CB 3.67Å; Y119-R127 HydrophobicContact CE2-CB 4.08Å; Y119-R127 PolarHBondContact N-O 3.35Å; Y119-R127 PolarHBondContact O-N 2.82Å; D121-R127 HydrophobicContact CB-CG 4.22Å; V125-R127 PolarHBondContact O-N 2.9Å
128	Q	89.1	Confident	91.8	Very high	121 Å²	121	82 Å²	82	57%	0.565	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.9	130.4	173.9	-171.1	-179.4	71.3	0	0	109.1	Y116 G117	Y116-Q128 HydrophobicContact CD1-CG 4.2Å; G117-Q128 CarbonylContact O-C 3.6Å
129	A	89.3	Confident	92.1	Very high	35 Å²	35	80.6 Å²	80.6	29%	0.289	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	101.1	171.7	0	0	0	0	0	108.9	G117 Y119 T131	G117-A129 PolarHBondContact N-O 3.36Å; G117-A129 PolarHBondContact O-N 2.94Å; Y119-A129 HydrophobicContact CD1-CB 3.96Å; Y119-A129 HydrophobicContact CE1-CB 3.81Å; A129-T131 PolarHBondContact O-N 2.83Å
130	T	94.9	Very high	92.4	Very high	65 Å²	65	78.7 Å²	78.7	40%	0.399	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	125.1	172.7	-48.2	0	0	0	0	109.8	I114 Y116	I114-T130 HydrophobicContact CD1-CG2 3.72Å; I114-T130 HydrophobicContact CG1-CG2 3.87Å; Y116-T130 HydrophobicContact CD1-CG2 3.78Å; Y116-T130 VanDerWaalsContact CD1-OG1 3.31Å; Y116-T130 WeakPolarHBondContact CD1-OG1 3.45Å; Y116-T130 HydrophobicContact CE1-CG2 3.55Å; Y116-T130 WeakPolarHBondContact CE1-OG1 3.45Å
131	T	95.9	Very high	92.2	Very high	11 Å²	11	75.1 Å²	75.1	7%	0.067	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	147.4	174.1	-167.8	0	0	0	0	109.9	R86 S88 D115 A129 I133	R86-T131 PolarHBondContact NH1-OG1 3Å; R86-T131 VanDerWaalsContact NH1-OG1 3.13Å; R86-T131 PolarHBondContact O-OG1 2.98Å; S88-T131 PolarHBondContact OG-OG1 3.22Å; D115-T131 HydrophobicContact CB-CG2 4.14Å; D115-T131 PolarHBondContact N-O 3.35Å; D115-T131 PolarHBondContact O-N 2.73Å; D115-T131 VanDerWaalsContact O-O 3.05Å; A129-T131 PolarHBondContact O-N 2.83Å; T131-I133 HydrophobicContact CG2-CG1 4.34Å
132	I	97.6	Very high	91.4	Very high	9 Å²	9	78.8 Å²	78.8	5%	0.046	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.9	122.4	168.3	-62.9	165.6	0	0	0	107.1	V33 L35 H85 R86 I87 S88 L110 K113	V33-I132 HydrophobicContact CB-CG2 4.35Å; V33-I132 HydrophobicContact CG1-CD1 3.89Å; V33-I132 HydrophobicContact CG1-CG1 4.41Å; V33-I132 HydrophobicContact CG1-CG2 4.28Å; L35-I132 HydrophobicContact CD1-CD1 3.44Å; L35-I132 VanDerWaalsContact CD1-CD1 3.44Å; L35-I132 HydrophobicContact CG-CD1 4.45Å; H85-I132 HydrophobicContact CB-CD1 4.11Å; R86-I132 PolarHBondContact O-N 3.04Å; I87-I132 CarbonylContact C-O 3.56Å; I87-I132 WeakPolarHBondContact CA-O 3.37Å; I87-I132 HydrophobicContact CD1-CB 3.83Å; I87-I132 HydrophobicContact CD1-CD1 4.01Å; I87-I132 HydrophobicContact CD1-CG1 4.47Å; I87-I132 HydrophobicContact CD1-CG2 4.27Å; S88-I132 PolarHBondContact N-O 2.87Å; L110-I132 HydrophobicContact CD1-CG2 4.09Å; K113-I132 CarbonylContact O-C 3.52Å; K113-I132 WeakPolarHBondContact O-CA 3.44Å
133	I	97.1	Very high	90	Very high	24 Å²	24	74.8 Å²	74.8	12%	0.123	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	110.7	173.8	-61.9	177.2	0	0	0	107	S88 F90 G112 K113 D115 T131	S88-I133 WeakPolarHBondContact O-CA 3.35Å; F90-I133 HydrophobicContact CD2-CG1 4.34Å; F90-I133 HydrophobicContact CD2-CG2 3.99Å; F90-I133 HydrophobicContact CE2-CD1 4.25Å; F90-I133 HydrophobicContact CE2-CG1 4.06Å; G112-I133 CarbonylContact C-O 3.54Å; G112-I133 WeakPolarHBondContact CA-O 3.27Å; K113-I133 HydrophobicContact CG-CB 4.05Å; K113-I133 PolarHBondContact N-O 3.04Å; K113-I133 PolarHBondContact O-N 3.46Å; D115-I133 HydrophobicContact CB-CD1 3.65Å; D115-I133 HydrophobicContact CB-CG1 4.01Å; T131-I133 HydrophobicContact CG2-CG1 4.34Å
134	A	97.4	Very high	88	Confident	0 Å²	0	73.5 Å²	73.5	0%	0	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	130.9	-178.8	0	0	0	0	0	111.3	I87 S88 V89 I137	I87-A134 HydrophobicContact CG2-CB 3.81Å; S88-A134 PolarHBondContact O-N 2.82Å; V89-A134 HydrophobicContact CG2-CB 4.29Å; A134-I137 HydrophobicContact CB-CD1 4.46Å; A134-I137 HydrophobicContact CB-CG1 4.39Å
135	D	96	Very high	86.3	Confident	74 Å²	74	76.2 Å²	76.2	40%	0.396	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	-23.1	178.9	-66.9	-40.3	0	0	0	112.1	R91 L94 E111	R91-D135 PolarHBondContact NH1-O 3.06Å; L94-D135 WeakPolarHBondContact CD2-O 3.41Å; E111-D135 PolarHBondContact O-N 2.73Å
136	N	96.6	Very high	84.2	Confident	67 Å²	67	81.9 Å²	81.9	36%	0.358	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.6	140.6	178.3	-171.1	20.8	0	0	0	111	L110 E111	L110-N136 WeakPolarHBondContact CA-O 3.38Å; E111-N136 HydrophobicContact CB-CB 4.24Å; E111-N136 PolarHBondContact N-O 2.86Å; E111-N136 PolarHBondContact O-N 2.85Å
137	I	96.2	Very high	81.9	Confident	12 Å²	12	84.8 Å²	84.8	6%	0.062	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	132.3	176.8	-61.6	170.9	0	0	0	108.5	F57 V89 L94 A98 I108 Y109 L110 A134 F139	F57-I137 HydrophobicContact CE1-CD1 4.48Å; F57-I137 HydrophobicContact CZ-CD1 4.26Å; V89-I137 HydrophobicContact CG2-CD1 4.1Å; L94-I137 HydrophobicContact CD1-CB 4.12Å; L94-I137 HydrophobicContact CD1-CD1 4.27Å; L94-I137 HydrophobicContact CD1-CG1 4.28Å; L94-I137 HydrophobicContact CD2-CD1 4.25Å; L94-I137 HydrophobicContact CD2-CG1 4.19Å; L94-I137 HydrophobicContact CG-CD1 4.17Å; L94-I137 HydrophobicContact CG-CG1 4.45Å; A98-I137 HydrophobicContact CB-CD1 4.18Å; I108-I137 HydrophobicContact CB-CG2 4.36Å; Y109-I137 CarbonylContact O-C 3.58Å; Y109-I137 WeakPolarHBondContact O-CA 2.76Å; L110-I137 HydrophobicContact CB-CG1 4.16Å; A134-I137 HydrophobicContact CB-CD1 4.46Å; A134-I137 HydrophobicContact CB-CG1 4.39Å; I137-F139 HydrophobicContact CG2-CE1 4.36Å; I137-F139 HydrophobicContact CG2-CE2 4.23Å; I137-F139 HydrophobicContact CG2-CZ 4.1Å
138	I	96.1	Very high	79.5	Confident	81 Å²	81	91.3 Å²	91.3	42%	0.415	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	124.5	172	-57.5	176.7	0	0	0	108.1	I108 Y109 L140	I108-I138 WeakPolarHBondContact CA-O 3.48Å; Y109-I138 HydrophobicContact CD1-CB 4.07Å; Y109-I138 HydrophobicContact CD1-CD1 3.7Å; Y109-I138 HydrophobicContact CD1-CG1 3.93Å; Y109-I138 HydrophobicContact CE1-CD1 4.05Å; Y109-I138 PolarHBondContact N-O 2.82Å; Y109-I138 PolarHBondContact O-N 2.94Å; I138-L140 HydrophobicContact CG2-CD2 4.15Å
139	F	94.3	Very high	79	Confident	75 Å²	75	89.9 Å²	89.9	33%	0.329	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	122.7	176	-60.1	-87.2	0	0	0	109.3	V97 V102 I108 I137	V97-F139 HydrophobicContact CG1-CE2 3.75Å; V97-F139 HydrophobicContact CG1-CZ 3.86Å; V102-F139 HydrophobicContact CG2-CE1 3.62Å; V102-F139 HydrophobicContact CG2-CZ 4.2Å; I108-F139 HydrophobicContact CG2-CD1 4.01Å; I108-F139 HydrophobicContact CG2-CE1 4.44Å; I137-F139 HydrophobicContact CG2-CE1 4.36Å; I137-F139 HydrophobicContact CG2-CE2 4.23Å; I137-F139 HydrophobicContact CG2-CZ 4.1Å
140	L	92.3	Very high	78.5	Confident	82 Å²	82	92.7 Å²	92.7	43%	0.429	46%	0.459	S	S	.	.			trans	-108	-7.7	-179.6	-59.4	169.1	0	0	0	112.1	L36 R107 I138	L36-L140 HydrophobicContact CD1-CD1 3.78Å; L36-L140 HydrophobicContact CG-CD1 3.96Å; R107-L140 HydrophobicContact CB-CB 4.32Å; R107-L140 HydrophobicContact CG-CB 4.26Å; R107-L140 HydrophobicContact CG-CD1 4.36Å; R107-L140 WeakPolarHBondContact O-CB 2.92Å; R107-L140 PolarHBondContact O-N 2.91Å; I138-L140 HydrophobicContact CG2-CD2 4.15Å
141	S	83.8	Confident	77.6	Confident	35 Å²	35	94.3 Å²	94.3	25%	0.245	46%	0.462	C	S	.	.	S	Bend	trans	-81.8	131.4	175.7	-80	0	0	0	0	110.7	R107 Q143	R107-S141 PolarHBondContact N-OG 2.82Å; R107-S141 PolarHBondContact O-N 3.38Å; S141-Q143 PolarHBondContact O-N 2.78Å
142	D	68.4	Low	76.5	Confident	140 Å²	140	99.2 Å²	99.2	75%	0.749	49%	0.486	S	S	*	.			trans	-74.3	99.7	171.6	-162.6	6.1	0	0	0	109	T144	D142-T144 PolarHBondContact O-N 3.03Å; D142-T144 VanDerWaalsContact O-N 3.13Å; D142-T144 WeakPolarHBondContact OD1-CB 3.35Å; D142-T144 PolarHBondContact OD1-OG1 2.94Å
143	Q	57.9	Low	75.2	Confident	119 Å²	119	104.8 Å²	104.8	56%	0.556	51%	0.513	S	S	*	.			trans	-85.6	48.7	178.1	-63.8	-70.3	-23.3	0	0	110.2	S141	S141-Q143 PolarHBondContact O-N 2.78Å
144	T	48.7	Very low	73.7	Confident	106 Å²	106	110.2 Å²	110.2	65%	0.65	54%	0.539	S	S	*	.			trans	-94.9	18.5	-174.9	-60.9	0	0	0	0	113.5	D142	D142-T144 PolarHBondContact O-N 3.03Å; D142-T144 VanDerWaalsContact O-N 3.13Å; D142-T144 WeakPolarHBondContact OD1-CB 3.35Å; D142-T144 PolarHBondContact OD1-OG1 2.94Å
145	K	50.9	Low	72	Confident	193 Å²	193	118.1 Å²	118.1	84%	0.839	58%	0.577	S	S	*	*			trans	-135.5	141.4	175	-74	-165.5	172.6	-169.3	0	114.3
146	E	46.8	Very low	70.1	Confident	186 Å²	186	121.5 Å²	121.5	87%	0.869	59%	0.591	S	S	*	*			trans	92.7	60.9	170.8	-59.4	175.1	-171.1	0	0	117.1
147	K	40.9	Very low	67.9	Low	215 Å²	215	126 Å²	126	94%	0.935	61%	0.611	S	S	*	*			trans	-114.8	82.5	130.4	-75.8	-173.5	179.5	-178.5	0	107.8
148	E	39.1	Very low	65.4	Low	268 Å²	268	136.4 Å²	136.4	100%	1.252	66%	0.661	S	S	*	*			trans	-117.1	0	155.5	-85.9	-174.2	164.7	0	0	107.9

Retrieved 148 of 148 residues in 764.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).