A0A096MTY7_PAPAN Loading...

TPD52 like 3

AlphaFold DB , UniProt , Accession A0A096MTY7, Species PAPAN (Papio anubis, Olive baboon), Gene TPD52L3, Length 131 aa.

						>A0A096MTY7_PAPAN|A0A096MTY7|TPD52L3
MPHARTETSVGTYESHSTSELEDLTEPEQRELKAKLTKLEAEIVTLRHVLAAKDRRCGKLKRKLGFTALVGLRQNLSKSWLDVQVSNTYVEQKMSAALSTMGTALCRKLGGIKKSATFRSFEGNPKEGSRI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37	Very low	47.4	Very low	238 Å²	238	144.8 Å²	144.8	100%	1.172	82%	0.815	S	S	*	*				0	130.7	0	-63.5	-58.3	-179.9	0	0	108.5
2	P	55.3	Low	47.2	Very low	122 Å²	122	142 Å²	142	79%	0.792	80%	0.804	S	S	*	*				-115.4	157.6	-63.5	34.3	-23.7	0	0	0	113.1
3	H	46.2	Very low	47.6	Very low	188 Å²	188	145.4 Å²	145.4	87%	0.87	80%	0.798	S	S	*	*			trans	-69.7	136.2	160.8	-99.8	-103.6	0	0	0	109.8
4	A	48.7	Very low	47.2	Very low	95 Å²	95	144.4 Å²	144.4	79%	0.785	79%	0.785	S	S	*	*			trans	-150.6	84.5	163.2	0	0	0	0	0	109.7
5	R	46.6	Very low	47.2	Very low	224 Å²	224	140.4 Å²	140.4	85%	0.845	77%	0.772	S	S	*	*			trans	-84	111.4	156.6	-82.5	-177	176.3	154.1	-0.5	106.3	E7	R5-E7 VanDerWaalsContact C-N 3.31Å; R5-E7 PolarHBondContact O-N 2.93Å
6	T	54	Low	46.7	Very low	136 Å²	136	139.8 Å²	139.8	83%	0.834	76%	0.762	S	S	*	*			trans	-65.4	93.1	162.3	18.7	0	0	0	0	107.7	T8	T6-T8 PolarHBondContact O-N 2.8Å
7	E	40.9	Very low	46.8	Very low	180 Å²	180	136.1 Å²	136.1	84%	0.841	75%	0.749	S	S	*	*			trans	-70.6	112.3	158.9	-67.5	-164.9	142.7	0	0	107	R5 S9	R5-E7 VanDerWaalsContact C-N 3.31Å; R5-E7 PolarHBondContact O-N 2.93Å; E7-S9 PolarHBondContact O-N 2.7Å; E7-S9 VanDerWaalsContact O-N 3.08Å
8	T	43.8	Very low	46.4	Very low	124 Å²	124	135.4 Å²	135.4	76%	0.761	75%	0.749	S	S	*	*			trans	-51.3	113.4	171.5	-51.8	0	0	0	0	108	T6 V10	T6-T8 PolarHBondContact O-N 2.8Å; T8-V10 PolarHBondContact O-N 3.39Å
9	S	50.4	Low	46.5	Very low	113 Å²	113	134.1 Å²	134.1	79%	0.79	75%	0.75	S	S	*	*			trans	-57.8	92.3	167	176.4	0	0	0	0	107.8	E7 G11	E7-S9 PolarHBondContact O-N 2.7Å; E7-S9 VanDerWaalsContact O-N 3.08Å; S9-G11 PolarHBondContact O-N 2.77Å
10	V	54.8	Low	46.4	Very low	120 Å²	120	133.9 Å²	133.9	73%	0.727	74%	0.743	S	S	*	*			trans	-60.3	118	162.3	169.2	0	0	0	0	105.1	T8 T12	T8-V10 PolarHBondContact O-N 3.39Å; V10-T12 PolarHBondContact O-N 2.96Å; V10-T12 VanDerWaalsContact O-N 3.07Å
11	G	43.3	Very low	46.7	Very low	53 Å²	53	131.6 Å²	131.6	55%	0.546	73%	0.729	S	S	.	*			trans	-53.4	117.3	-179.2	0	0	0	0	0	110.1	S9 Y13	S9-G11 PolarHBondContact O-N 2.77Å; G11-Y13 WeakPolarHBondContact O-CD1 3.44Å; G11-Y13 PolarHBondContact O-N 3.48Å
12	T	45.9	Very low	47.3	Very low	111 Å²	111	128.9 Å²	128.9	68%	0.681	71%	0.713	S	S	*	*			trans	-60.8	87.5	162.8	-50.7	0	0	0	0	107.8	V10 E14	V10-T12 PolarHBondContact O-N 2.96Å; V10-T12 VanDerWaalsContact O-N 3.07Å; T12-E14 HydrophobicContact CG2-CG 4.01Å; T12-E14 WeakPolarHBondContact CG2-OE1 3.35Å; T12-E14 PolarHBondContact O-N 3.35Å
13	Y	51.3	Low	47.3	Very low	186 Å²	186	130.7 Å²	130.7	73%	0.729	72%	0.716	S	S	*	*			trans	-77.2	102.6	147.1	61.3	-82.6	0	0	0	104	G11 S15	G11-Y13 WeakPolarHBondContact O-CD1 3.44Å; G11-Y13 PolarHBondContact O-N 3.48Å; Y13-S15 VanDerWaalsContact C-N 3.34Å; Y13-S15 WeakPolarHBondContact CD2-OG 3.44Å; Y13-S15 VanDerWaalsContact CE2-OG 3.24Å; Y13-S15 WeakPolarHBondContact CE2-OG 3.46Å; Y13-S15 PolarHBondContact O-N 3.47Å
14	E	42	Very low	48	Very low	132 Å²	132	124.9 Å²	124.9	62%	0.617	69%	0.692	S	S	*	*			trans	-49	100.3	173	-72.5	-80.7	114.5	0	0	108.5	T12 H16	T12-E14 HydrophobicContact CG2-CG 4.01Å; T12-E14 WeakPolarHBondContact CG2-OE1 3.35Å; T12-E14 PolarHBondContact O-N 3.35Å; E14-H16 VanDerWaalsContact CD-CD2 3.45Å; E14-H16 PolarHBondContact O-N 3.09Å; E14-H16 VanDerWaalsContact O-N 3.14Å; E14-H16 IonicContact OE1-CD2 3.5Å; E14-H16 IonicContact OE1-NE2 2.7Å; E14-H16 IonicContact OE2-CD2 2.65Å; E14-H16 PolarHBondContact OE2-CD2 2.99Å; E14-H16 IonicContact OE2-CG 3.93Å; E14-H16 IonicContact OE2-NE2 3.85Å
15	S	47.5	Very low	49.2	Very low	84 Å²	84	124.5 Å²	124.5	59%	0.587	68%	0.68	S	S	*	*			trans	-83	63.7	164	-65.1	0	0	0	0	107.2	Y13	Y13-S15 VanDerWaalsContact C-N 3.34Å; Y13-S15 WeakPolarHBondContact CD2-OG 3.44Å; Y13-S15 VanDerWaalsContact CE2-OG 3.24Å; Y13-S15 WeakPolarHBondContact CE2-OG 3.46Å; Y13-S15 PolarHBondContact O-N 3.47Å
16	H	39.7	Very low	50.6	Low	131 Å²	131	118.7 Å²	118.7	61%	0.606	66%	0.662	S	S	*	*			trans	-112.9	142.4	166.3	-64.5	-83.7	0	0	0	106.4	E14	E14-H16 VanDerWaalsContact CD-CD2 3.45Å; E14-H16 PolarHBondContact O-N 3.09Å; E14-H16 VanDerWaalsContact O-N 3.14Å; E14-H16 IonicContact OE1-CD2 3.5Å; E14-H16 IonicContact OE1-NE2 2.7Å; E14-H16 IonicContact OE2-CD2 2.65Å; E14-H16 PolarHBondContact OE2-CD2 2.99Å; E14-H16 IonicContact OE2-CG 3.93Å; E14-H16 IonicContact OE2-NE2 3.85Å
17	S	48.5	Very low	51.9	Low	77 Å²	77	116 Å²	116	54%	0.538	65%	0.647	S	S	.	*	S	Bend	trans	92.5	19.2	176.6	-44.6	0	0	0	0	119.2
18	T	39.7	Very low	54.1	Low	124 Å²	124	111.6 Å²	111.6	76%	0.761	63%	0.626	S	S	*	*	S	Bend	trans	-81.3	-25.7	162.2	-31.2	0	0	0	0	112.4
19	S	48	Very low	56.1	Low	109 Å²	109	108.4 Å²	108.4	76%	0.762	60%	0.603	S	S	*	*	S	Bend	trans	-92.4	-7.6	179.4	79.1	0	0	0	0	114.8
20	E	44.7	Very low	57.9	Low	130 Å²	130	110.5 Å²	110.5	61%	0.607	59%	0.593	S	S	*	*	S	Bend	trans	-96.7	-11.1	-179.5	-152.3	-177.7	167.9	0	0	112	E22	E20-E22 VanDerWaalsContact C-N 3.32Å
21	L	51.9	Low	59.6	Low	86 Å²	86	109.6 Å²	109.6	45%	0.45	58%	0.581	S	S	.	*	G	3₁₀ helix	trans	-75.9	-21	-179.2	-166.9	73.2	0	0	0	112.7	D23 L24	L21-D23 VanDerWaalsContact C-N 3.34Å; L21-L24 HydrophobicContact CD1-CD1 4.08Å
22	E	50	Low	61.9	Low	181 Å²	181	111.5 Å²	111.5	85%	0.846	58%	0.578	S	S	*	*	G	3₁₀ helix	trans	-79.9	-10	-176.5	-76.8	-175.8	147.2	0	0	114.1	E20	E20-E22 VanDerWaalsContact C-N 3.32Å
23	D	56.2	Low	64.2	Low	160 Å²	160	111.7 Å²	111.7	86%	0.856	57%	0.57	S	S	*	*	G	3₁₀ helix	trans	-120.6	13.6	-176.9	-115.2	-9.4	0	0	0	114.3	L21	L21-D23 VanDerWaalsContact C-N 3.34Å
24	L	60.7	Low	66.3	Low	67 Å²	67	105.8 Å²	105.8	35%	0.351	56%	0.559	S	S	.	*	S	Bend	trans	-82.6	139.5	176	-72	163.2	0	0	0	111.4	L21 E26	L21-L24 HydrophobicContact CD1-CD1 4.08Å; L24-E26 PolarHBondContact O-N 3.26Å
25	T	73.3	Confident	68.9	Low	87 Å²	87	104.7 Å²	104.7	53%	0.534	55%	0.552	S	S	.	*			trans	-61.3	137.1	179.7	-34.3	0	0	0	0	109.1	P27 E28 Q29	T25-P27 VanDerWaalsContact C-N 3.28Å; T25-P27 HydrophobicContact CG2-CG 4.01Å; T25-P27 WeakPolarHBondContact O-CD 3.45Å; T25-E28 WeakPolarHBondContact CB-OE2 3.41Å; T25-E28 PolarHBondContact N-OE2 3.25Å; T25-E28 WeakPolarHBondContact O-CB 3.33Å; T25-E28 PolarHBondContact O-N 3.44Å; T25-E28 PolarHBondContact OG1-OE2 3.26Å; T25-Q29 PolarHBondContact O-N 2.93Å
26	E	76.4	Confident	71.3	Confident	101 Å²	101	105.4 Å²	105.4	47%	0.472	55%	0.549	S	S	.	.	H	α-helix	trans	-39.6	-42.5	-179.8	-135.2	-82	173.4	0	0	115.5	L24 R30	L24-E26 PolarHBondContact O-N 3.26Å; E26-R30 WeakPolarHBondContact O-CG 3.45Å; E26-R30 PolarHBondContact O-N 2.82Å; E26-R30 IonicContact OE1-CZ 2.94Å; E26-R30 IonicContact OE1-NE 3.91Å; E26-R30 PolarHBondContact OE1-NE 3.42Å; E26-R30 IonicContact OE1-NH2 2.93Å; E26-R30 PolarHBondContact OE1-NH2 3.08Å; E26-R30 IonicContact OE2-CZ 3.58Å; E26-R30 IonicContact OE2-NE 2.89Å; E26-R30 PolarHBondContact OE2-NE 2.97Å; E26-R30 IonicContact OE2-NH1 3.39Å; E26-R30 IonicContact OE2-NH2 2.8Å; E26-R30 PolarHBondContact OE2-NH2 3.49Å
27	P	81.9	Confident	74	Confident	80 Å²	80	103.3 Å²	103.3	52%	0.519	55%	0.546	S	S	.	.	H	α-helix	trans	-66	-37.9	173.9	26	-36.9	0	0	0	115.1	T25 Q29 R30 E31	T25-P27 VanDerWaalsContact C-N 3.28Å; T25-P27 HydrophobicContact CG2-CG 4.01Å; T25-P27 WeakPolarHBondContact O-CD 3.45Å; P27-Q29 VanDerWaalsContact C-N 3.34Å; P27-R30 PolarHBondContact O-N 3.01Å; P27-E31 PolarHBondContact O-N 3.29Å
28	E	85.3	Confident	76.4	Confident	88 Å²	88	107 Å²	107	41%	0.411	55%	0.552	S	S	.	*	H	α-helix	trans	-67.3	-39.9	-178.8	-62.2	172.4	135.9	0	0	110.2	T25 R30 E31 L32	T25-E28 WeakPolarHBondContact CB-OE2 3.41Å; T25-E28 PolarHBondContact N-OE2 3.25Å; T25-E28 WeakPolarHBondContact O-CB 3.33Å; T25-E28 PolarHBondContact O-N 3.44Å; T25-E28 PolarHBondContact OG1-OE2 3.26Å; E28-R30 VanDerWaalsContact C-N 3.32Å; E28-R30 PolarHBondContact O-N 3.27Å; E28-E31 PolarHBondContact O-N 2.89Å; E28-L32 PolarHBondContact O-N 3.42Å
29	Q	87.7	Confident	79.2	Confident	57 Å²	57	105.7 Å²	105.7	27%	0.266	54%	0.54	S	S	.	.	H	α-helix	trans	-62.8	-39.3	174.9	-159.7	-165.7	31	0	0	111.7	T25 P27 K33	T25-Q29 PolarHBondContact O-N 2.93Å; P27-Q29 VanDerWaalsContact C-N 3.34Å; Q29-K33 WeakPolarHBondContact O-CG 3.36Å; Q29-K33 PolarHBondContact O-N 3.22Å; Q29-K33 VanDerWaalsContact O-N 3.09Å
30	R	86.8	Confident	81.6	Confident	156 Å²	156	105.5 Å²	105.5	59%	0.589	53%	0.527	S	S	*	.	H	α-helix	trans	-65	-42.7	175.1	-72.2	-179.9	-172.1	-179.6	6.8	111.9	E26 P27 E28 K33 A34	E26-R30 WeakPolarHBondContact O-CG 3.45Å; E26-R30 PolarHBondContact O-N 2.82Å; E26-R30 IonicContact OE1-CZ 2.94Å; E26-R30 IonicContact OE1-NE 3.91Å; E26-R30 PolarHBondContact OE1-NE 3.42Å; E26-R30 IonicContact OE1-NH2 2.93Å; E26-R30 PolarHBondContact OE1-NH2 3.08Å; E26-R30 IonicContact OE2-CZ 3.58Å; E26-R30 IonicContact OE2-NE 2.89Å; E26-R30 PolarHBondContact OE2-NE 2.97Å; E26-R30 IonicContact OE2-NH1 3.39Å; E26-R30 IonicContact OE2-NH2 2.8Å; E26-R30 PolarHBondContact OE2-NH2 3.49Å; P27-R30 PolarHBondContact O-N 3.01Å; E28-R30 VanDerWaalsContact C-N 3.32Å; E28-R30 PolarHBondContact O-N 3.27Å; R30-K33 PolarHBondContact O-N 2.96Å; R30-A34 PolarHBondContact O-N 3.3Å
31	E	90.1	Very high	84.1	Confident	102 Å²	102	102 Å²	102	48%	0.477	52%	0.52	S	S	.	.	H	α-helix	trans	-64.2	-42.5	178.1	-168.1	-174.6	160.7	0	0	111.7	P27 E28 K33 A34 K35	P27-E31 PolarHBondContact O-N 3.29Å; E28-E31 PolarHBondContact O-N 2.89Å; E31-K33 PolarHBondContact O-N 3.27Å; E31-A34 PolarHBondContact O-N 3.02Å; E31-K35 HydrophobicContact CG-CD 4.45Å; E31-K35 WeakPolarHBondContact O-CG 3.01Å; E31-K35 PolarHBondContact O-N 3.01Å; E31-K35 WeakPolarHBondContact OE1-CE 3.37Å; E31-K35 IonicContact OE1-NZ 3.89Å; E31-K35 PolarHBondContact OE1-NZ 3.41Å
32	L	93.2	Very high	86.4	Confident	92 Å²	92	102.7 Å²	102.7	48%	0.482	52%	0.521	S	S	.	.	H	α-helix	trans	-59.7	-45.6	175.1	-109	74.4	0	0	0	111.7	E28 A34 K35 L36	E28-L32 PolarHBondContact O-N 3.42Å; L32-A34 VanDerWaalsContact C-N 3.31Å; L32-A34 PolarHBondContact O-N 3.37Å; L32-K35 PolarHBondContact O-N 3.37Å; L32-L36 WeakPolarHBondContact O-CB 3.48Å; L32-L36 PolarHBondContact O-N 2.86Å
33	K	93.9	Very high	88.7	Confident	115 Å²	115	97.7 Å²	97.7	50%	0.5	50%	0.499	S	S	.	.	H	α-helix	trans	-61.2	-39.3	176.3	-73.6	172.8	-179.1	168.3	0	112	Q29 R30 E31 L36 T37	Q29-K33 WeakPolarHBondContact O-CG 3.36Å; Q29-K33 PolarHBondContact O-N 3.22Å; Q29-K33 VanDerWaalsContact O-N 3.09Å; R30-K33 PolarHBondContact O-N 2.96Å; E31-K33 PolarHBondContact O-N 3.27Å; K33-L36 PolarHBondContact O-N 3.01Å; K33-T37 WeakPolarHBondContact O-CB 3.38Å; K33-T37 PolarHBondContact O-N 2.65Å; K33-T37 PolarHBondContact O-OG1 3.45Å
34	A	95.6	Very high	90.7	Very high	62 Å²	62	94.2 Å²	94.2	51%	0.512	48%	0.484	S	S	.	.	H	α-helix	trans	-66.8	-43.2	176.2	0	0	0	0	0	112.3	R30 E31 L32 T37 K38	R30-A34 PolarHBondContact O-N 3.3Å; E31-A34 PolarHBondContact O-N 3.02Å; L32-A34 VanDerWaalsContact C-N 3.31Å; L32-A34 PolarHBondContact O-N 3.37Å; A34-T37 PolarHBondContact O-N 3.42Å; A34-K38 WeakPolarHBondContact O-CB 3.47Å; A34-K38 PolarHBondContact O-N 3.3Å
35	K	96.9	Very high	92.5	Very high	109 Å²	109	94.9 Å²	94.9	47%	0.474	49%	0.491	S	S	.	.	H	α-helix	trans	-62	-43.5	174.6	-74.8	174.9	-178.2	164	0	111.6	E31 L32 K38 L39	E31-K35 HydrophobicContact CG-CD 4.45Å; E31-K35 WeakPolarHBondContact O-CG 3.01Å; E31-K35 PolarHBondContact O-N 3.01Å; E31-K35 WeakPolarHBondContact OE1-CE 3.37Å; E31-K35 IonicContact OE1-NZ 3.89Å; E31-K35 PolarHBondContact OE1-NZ 3.41Å; L32-K35 PolarHBondContact O-N 3.37Å; K35-K38 PolarHBondContact O-N 2.88Å; K35-L39 WeakPolarHBondContact O-CG 3.23Å; K35-L39 PolarHBondContact O-N 3.24Å
36	L	96.6	Very high	93.7	Very high	99 Å²	99	95.5 Å²	95.5	52%	0.518	49%	0.491	S	S	.	.	H	α-helix	trans	-59	-51.7	176	-174.9	68.9	0	0	0	110.7	L32 K33 K38 L39 E40	L32-L36 WeakPolarHBondContact O-CB 3.48Å; L32-L36 PolarHBondContact O-N 2.86Å; K33-L36 PolarHBondContact O-N 3.01Å; L36-K38 VanDerWaalsContact C-N 3.26Å; L36-K38 PolarHBondContact O-N 2.85Å; L36-L39 PolarHBondContact O-N 3.11Å; L36-L39 VanDerWaalsContact O-N 3.11Å; L36-E40 WeakPolarHBondContact O-CG 3.35Å; L36-E40 PolarHBondContact O-N 2.87Å
37	T	97.4	Very high	94.8	Very high	87 Å²	87	98.8 Å²	98.8	53%	0.534	50%	0.499	S	S	.	.	H	α-helix	trans	-57.3	-40.9	178.5	-54.1	0	0	0	0	111.7	K33 A34 E40 A41	K33-T37 WeakPolarHBondContact O-CB 3.38Å; K33-T37 PolarHBondContact O-N 2.65Å; K33-T37 PolarHBondContact O-OG1 3.45Å; A34-T37 PolarHBondContact O-N 3.42Å; T37-E40 PolarHBondContact O-N 2.97Å; T37-A41 PolarHBondContact O-N 3.35Å; T37-A41 VanDerWaalsContact O-N 3.08Å
38	K	98.3	Very high	95.6	Very high	155 Å²	155	101.7 Å²	101.7	67%	0.674	51%	0.505	S	S	*	.	H	α-helix	trans	-64.9	-45.4	176.7	-176.5	-178	175.9	-175.3	0	112	A34 K35 L36 E40 A41 E42	A34-K38 WeakPolarHBondContact O-CB 3.47Å; A34-K38 PolarHBondContact O-N 3.3Å; K35-K38 PolarHBondContact O-N 2.88Å; L36-K38 VanDerWaalsContact C-N 3.26Å; L36-K38 PolarHBondContact O-N 2.85Å; K38-E40 VanDerWaalsContact C-N 3.34Å; K38-A41 PolarHBondContact O-N 3.43Å; K38-E42 PolarHBondContact O-N 3.47Å
39	L	98.5	Very high	96.2	Very high	96 Å²	96	100.7 Å²	100.7	50%	0.503	51%	0.505	S	S	.	.	H	α-helix	trans	-63.9	-40.1	177.4	-76.1	175.2	0	0	0	111.6	K35 L36 A41 E42 I43	K35-L39 WeakPolarHBondContact O-CG 3.23Å; K35-L39 PolarHBondContact O-N 3.24Å; L36-L39 PolarHBondContact O-N 3.11Å; L36-L39 VanDerWaalsContact O-N 3.11Å; L39-A41 VanDerWaalsContact C-N 3.33Å; L39-A41 PolarHBondContact O-N 3.09Å; L39-E42 PolarHBondContact O-N 2.93Å; L39-I43 WeakPolarHBondContact O-CB 3.48Å; L39-I43 VanDerWaalsContact O-CG1 3.23Å; L39-I43 WeakPolarHBondContact O-CG1 3.49Å; L39-I43 PolarHBondContact O-N 2.86Å
40	E	98.4	Very high	96.7	Very high	105 Å²	105	102.9 Å²	102.9	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-59.3	-44.3	174.5	-72.4	176.5	159	0	0	111.6	L36 T37 K38 I43 V44	L36-E40 WeakPolarHBondContact O-CG 3.35Å; L36-E40 PolarHBondContact O-N 2.87Å; T37-E40 PolarHBondContact O-N 2.97Å; K38-E40 VanDerWaalsContact C-N 3.34Å; E40-I43 PolarHBondContact O-N 3.07Å; E40-V44 WeakPolarHBondContact O-CG2 3.34Å; E40-V44 PolarHBondContact O-N 2.93Å
41	A	98.3	Very high	97.3	Very high	57 Å²	57	97.4 Å²	97.4	47%	0.471	51%	0.506	S	S	.	.	H	α-helix	trans	-64	-39.8	175.6	0	0	0	0	0	112.7	T37 K38 L39 V44 T45	T37-A41 PolarHBondContact O-N 3.35Å; T37-A41 VanDerWaalsContact O-N 3.08Å; K38-A41 PolarHBondContact O-N 3.43Å; L39-A41 VanDerWaalsContact C-N 3.33Å; L39-A41 PolarHBondContact O-N 3.09Å; A41-V44 PolarHBondContact O-N 3.28Å; A41-T45 WeakPolarHBondContact O-CB 3.41Å; A41-T45 PolarHBondContact O-N 2.78Å; A41-T45 PolarHBondContact O-OG1 2.97Å
42	E	98.6	Very high	97.7	Very high	101 Å²	101	95.1 Å²	95.1	47%	0.472	51%	0.505	S	S	.	.	H	α-helix	trans	-64.2	-44.8	174.7	-175	175.5	171	0	0	111.3	K38 L39 V44 T45 L46	K38-E42 PolarHBondContact O-N 3.47Å; L39-E42 PolarHBondContact O-N 2.93Å; E42-V44 VanDerWaalsContact C-N 3.31Å; E42-V44 PolarHBondContact O-N 3.29Å; E42-T45 CarbonylContact O-C 3.57Å; E42-T45 WeakPolarHBondContact O-CA 3.47Å; E42-T45 WeakPolarHBondContact O-CB 3.33Å; E42-T45 PolarHBondContact O-N 3.46Å; E42-T45 VanDerWaalsContact O-N 3.09Å; E42-L46 HydrophobicContact CG-CD1 4.05Å; E42-L46 HydrophobicContact CG-CG 4.23Å; E42-L46 WeakPolarHBondContact O-CB 3.5Å; E42-L46 WeakPolarHBondContact O-CG 3.42Å; E42-L46 PolarHBondContact O-N 2.96Å
43	I	98.4	Very high	97.9	Very high	75 Å²	75	97.3 Å²	97.3	39%	0.385	51%	0.51	S	S	.	.	H	α-helix	trans	-57.2	-46.1	176.1	-71.8	165.2	0	0	0	110.6	L39 E40 T45 L46 R47	L39-I43 WeakPolarHBondContact O-CB 3.48Å; L39-I43 VanDerWaalsContact O-CG1 3.23Å; L39-I43 WeakPolarHBondContact O-CG1 3.49Å; L39-I43 PolarHBondContact O-N 2.86Å; E40-I43 PolarHBondContact O-N 3.07Å; I43-T45 VanDerWaalsContact C-N 3.31Å; I43-T45 PolarHBondContact O-N 3.38Å; I43-L46 PolarHBondContact O-N 3.01Å; I43-R47 VanDerWaalsContact CG2-NH1 3.26Å; I43-R47 WeakPolarHBondContact O-CG 3.39Å; I43-R47 PolarHBondContact O-N 3.47Å
44	V	98.6	Very high	98.1	Very high	88 Å²	88	96.5 Å²	96.5	53%	0.533	51%	0.511	S	S	.	.	H	α-helix	trans	-60.3	-44.8	176.5	170.2	0	0	0	0	110.7	E40 A41 E42 R47 H48	E40-V44 WeakPolarHBondContact O-CG2 3.34Å; E40-V44 PolarHBondContact O-N 2.93Å; A41-V44 PolarHBondContact O-N 3.28Å; E42-V44 VanDerWaalsContact C-N 3.31Å; E42-V44 PolarHBondContact O-N 3.29Å; V44-R47 PolarHBondContact O-N 3.4Å; V44-H48 PolarHBondContact O-N 2.95Å
45	T	98.6	Very high	98.2	Very high	81 Å²	81	102.4 Å²	102.4	50%	0.497	52%	0.52	S	S	.	.	H	α-helix	trans	-62.2	-46.6	178.3	-58.4	0	0	0	0	111.5	A41 E42 I43 R47 H48 V49	A41-T45 WeakPolarHBondContact O-CB 3.41Å; A41-T45 PolarHBondContact O-N 2.78Å; A41-T45 PolarHBondContact O-OG1 2.97Å; E42-T45 CarbonylContact O-C 3.57Å; E42-T45 WeakPolarHBondContact O-CA 3.47Å; E42-T45 WeakPolarHBondContact O-CB 3.33Å; E42-T45 PolarHBondContact O-N 3.46Å; E42-T45 VanDerWaalsContact O-N 3.09Å; I43-T45 VanDerWaalsContact C-N 3.31Å; I43-T45 PolarHBondContact O-N 3.38Å; T45-R47 VanDerWaalsContact C-N 3.34Å; T45-R47 PolarHBondContact O-N 2.84Å; T45-H48 WeakPolarHBondContact O-CA 3.45Å; T45-H48 WeakPolarHBondContact O-CB 3.31Å; T45-H48 PolarHBondContact O-N 3.34Å; T45-H48 VanDerWaalsContact O-N 3.07Å; T45-V49 HydrophobicContact CG2-CG2 4.46Å; T45-V49 WeakPolarHBondContact O-CG2 3.25Å; T45-V49 PolarHBondContact O-N 3.43Å
46	L	98.8	Very high	98.2	Very high	100 Å²	100	106.4 Å²	106.4	52%	0.524	53%	0.532	S	S	.	.	H	α-helix	trans	-61.4	-41.6	178.3	-72	175.3	0	0	0	111.7	E42 I43 H48 V49 L50	E42-L46 HydrophobicContact CG-CD1 4.05Å; E42-L46 HydrophobicContact CG-CG 4.23Å; E42-L46 WeakPolarHBondContact O-CB 3.5Å; E42-L46 WeakPolarHBondContact O-CG 3.42Å; E42-L46 PolarHBondContact O-N 2.96Å; I43-L46 PolarHBondContact O-N 3.01Å; L46-H48 VanDerWaalsContact C-N 3.3Å; L46-H48 PolarHBondContact O-N 3.02Å; L46-V49 PolarHBondContact O-N 3.4Å; L46-L50 VanDerWaalsContact O-CB 3.31Å; L46-L50 WeakPolarHBondContact O-CB 3.5Å; L46-L50 PolarHBondContact O-N 3.16Å
47	R	98.6	Very high	98.1	Very high	170 Å²	170	104.4 Å²	104.4	64%	0.642	53%	0.526	S	S	*	.	H	α-helix	trans	-59.7	-41.5	172.6	-74.1	173.9	178	144.1	2.5	111.6	I43 V44 T45 L50 A51	I43-R47 VanDerWaalsContact CG2-NH1 3.26Å; I43-R47 WeakPolarHBondContact O-CG 3.39Å; I43-R47 PolarHBondContact O-N 3.47Å; V44-R47 PolarHBondContact O-N 3.4Å; T45-R47 VanDerWaalsContact C-N 3.34Å; T45-R47 PolarHBondContact O-N 2.84Å; R47-L50 PolarHBondContact O-N 3.02Å; R47-A51 WeakPolarHBondContact O-CB 3.49Å; R47-A51 PolarHBondContact O-N 3.03Å
48	H	98.6	Very high	98	Very high	140 Å²	140	101.8 Å²	101.8	65%	0.648	52%	0.516	S	S	*	.	H	α-helix	trans	-65.4	-45.2	178	-143.6	116	0	0	0	112	V44 T45 L46 A51 A52	V44-H48 PolarHBondContact O-N 2.95Å; T45-H48 WeakPolarHBondContact O-CA 3.45Å; T45-H48 WeakPolarHBondContact O-CB 3.31Å; T45-H48 PolarHBondContact O-N 3.34Å; T45-H48 VanDerWaalsContact O-N 3.07Å; L46-H48 VanDerWaalsContact C-N 3.3Å; L46-H48 PolarHBondContact O-N 3.02Å; H48-A51 PolarHBondContact O-N 2.82Å; H48-A52 WeakPolarHBondContact O-CB 3.34Å; H48-A52 PolarHBondContact O-N 3.16Å
49	V	98.8	Very high	97.8	Very high	68 Å²	68	101 Å²	101	41%	0.412	51%	0.513	S	S	.	.	H	α-helix	trans	-62.9	-42.6	176.6	170.8	0	0	0	0	111	T45 L46 A52 K53	T45-V49 HydrophobicContact CG2-CG2 4.46Å; T45-V49 WeakPolarHBondContact O-CG2 3.25Å; T45-V49 PolarHBondContact O-N 3.43Å; L46-V49 PolarHBondContact O-N 3.4Å; V49-A52 WeakPolarHBondContact O-CB 3.44Å; V49-A52 PolarHBondContact O-N 2.96Å; V49-K53 HydrophobicContact CG1-CD 4.41Å; V49-K53 WeakPolarHBondContact O-CG 3.47Å; V49-K53 PolarHBondContact O-N 3.32Å
50	L	98.6	Very high	97.7	Very high	102 Å²	102	100.9 Å²	100.9	53%	0.534	51%	0.512	S	S	.	.	H	α-helix	trans	-62.3	-49	176.9	-176.4	61.3	0	0	0	110.9	L46 R47 A52 K53 D54	L46-L50 VanDerWaalsContact O-CB 3.31Å; L46-L50 WeakPolarHBondContact O-CB 3.5Å; L46-L50 PolarHBondContact O-N 3.16Å; R47-L50 PolarHBondContact O-N 3.02Å; L50-A52 VanDerWaalsContact C-N 3.26Å; L50-A52 PolarHBondContact O-N 3.43Å; L50-K53 CarbonylContact O-C 3.57Å; L50-K53 WeakPolarHBondContact O-CA 3.46Å; L50-K53 WeakPolarHBondContact O-CB 3.48Å; L50-K53 PolarHBondContact O-N 2.88Å; L50-D54 PolarHBondContact O-N 3.46Å
51	A	98.3	Very high	97.5	Very high	42 Å²	42	101.3 Å²	101.3	35%	0.347	51%	0.512	S	S	.	.	H	α-helix	trans	-58.3	-39	175.8	0	0	0	0	0	112.2	R47 H48 D54 R55	R47-A51 WeakPolarHBondContact O-CB 3.49Å; R47-A51 PolarHBondContact O-N 3.03Å; H48-A51 PolarHBondContact O-N 2.82Å; A51-D54 PolarHBondContact O-N 3.38Å; A51-R55 WeakPolarHBondContact O-CB 3.47Å; A51-R55 VanDerWaalsContact O-CG 3.25Å; A51-R55 WeakPolarHBondContact O-CG 3.43Å; A51-R55 PolarHBondContact O-N 3.03Å
52	A	98.3	Very high	97.2	Very high	54 Å²	54	106.9 Å²	106.9	45%	0.446	52%	0.521	S	S	.	.	H	α-helix	trans	-64.6	-41.9	174.3	0	0	0	0	0	112.1	H48 V49 L50 R55 R56	H48-A52 WeakPolarHBondContact O-CB 3.34Å; H48-A52 PolarHBondContact O-N 3.16Å; V49-A52 WeakPolarHBondContact O-CB 3.44Å; V49-A52 PolarHBondContact O-N 2.96Å; L50-A52 VanDerWaalsContact C-N 3.26Å; L50-A52 PolarHBondContact O-N 3.43Å; A52-R55 PolarHBondContact O-N 3.08Å; A52-R56 PolarHBondContact O-N 2.86Å
53	K	98.2	Very high	96.9	Very high	138 Å²	138	110.8 Å²	110.8	60%	0.6	54%	0.537	S	S	*	.	H	α-helix	trans	-64.3	-41.8	175.1	-79.3	-176.7	170.1	176	0	112.1	V49 L50 R56 C57	V49-K53 HydrophobicContact CG1-CD 4.41Å; V49-K53 WeakPolarHBondContact O-CG 3.47Å; V49-K53 PolarHBondContact O-N 3.32Å; L50-K53 CarbonylContact O-C 3.57Å; L50-K53 WeakPolarHBondContact O-CA 3.46Å; L50-K53 WeakPolarHBondContact O-CB 3.48Å; L50-K53 PolarHBondContact O-N 2.88Å; K53-R56 WeakPolarHBondContact O-CB 3.41Å; K53-R56 PolarHBondContact O-N 3.27Å; K53-R56 VanDerWaalsContact O-N 3.16Å; K53-C57 WeakPolarHBondContact O-CB 3.24Å; K53-C57 PolarHBondContact O-N 3.13Å
54	D	97.7	Very high	96.6	Very high	98 Å²	98	113 Å²	113	52%	0.524	55%	0.549	S	S	.	.	H	α-helix	trans	-63.8	-43	176.8	-73	-26.1	0	0	0	111.8	L50 A51 R56 C57 G58	L50-D54 PolarHBondContact O-N 3.46Å; A51-D54 PolarHBondContact O-N 3.38Å; D54-R56 VanDerWaalsContact C-N 3.31Å; D54-R56 PolarHBondContact O-N 2.82Å; D54-C57 PolarHBondContact O-N 2.88Å; D54-G58 PolarHBondContact O-N 3.14Å
55	R	97.1	Very high	96.1	Very high	186 Å²	186	109.7 Å²	109.7	70%	0.702	53%	0.533	S	S	*	.	H	α-helix	trans	-58.5	-42.6	172.3	-72.6	172.3	-178.6	-169.1	1.7	111.5	A51 A52 K59	A51-R55 WeakPolarHBondContact O-CB 3.47Å; A51-R55 VanDerWaalsContact O-CG 3.25Å; A51-R55 WeakPolarHBondContact O-CG 3.43Å; A51-R55 PolarHBondContact O-N 3.03Å; A52-R55 PolarHBondContact O-N 3.08Å; R55-K59 WeakPolarHBondContact O-CG 3.49Å; R55-K59 PolarHBondContact O-N 2.83Å
56	R	97	Very high	95.4	Very high	192 Å²	192	112.5 Å²	112.5	73%	0.725	54%	0.538	S	S	*	.	H	α-helix	trans	-65.8	-44	177	-174.5	-179.6	-178.9	-109.3	3.4	111.6	A52 K53 D54 K59 L60	A52-R56 PolarHBondContact O-N 2.86Å; K53-R56 WeakPolarHBondContact O-CB 3.41Å; K53-R56 PolarHBondContact O-N 3.27Å; K53-R56 VanDerWaalsContact O-N 3.16Å; D54-R56 VanDerWaalsContact C-N 3.31Å; D54-R56 PolarHBondContact O-N 2.82Å; R56-K59 PolarHBondContact O-N 2.94Å; R56-L60 PolarHBondContact O-N 3.32Å
57	C	95.6	Very high	94.5	Very high	58 Å²	58	111.8 Å²	111.8	39%	0.392	54%	0.538	S	S	.	.	H	α-helix	trans	-59.8	-46.7	175.7	-177.1	0	0	0	0	111.2	K53 D54 K59 L60 K61	K53-C57 WeakPolarHBondContact O-CB 3.24Å; K53-C57 PolarHBondContact O-N 3.13Å; D54-C57 PolarHBondContact O-N 2.88Å; C57-K59 PolarHBondContact O-N 3.21Å; C57-L60 PolarHBondContact O-N 2.93Å; C57-L60 VanDerWaalsContact O-N 3.16Å; C57-K61 WeakPolarHBondContact O-CG 3.48Å; C57-K61 PolarHBondContact O-N 2.81Å
58	G	94.6	Very high	93.6	Very high	31 Å²	31	107.1 Å²	107.1	32%	0.32	54%	0.536	S	S	.	.	H	α-helix	trans	-59.8	-42.5	175.8	0	0	0	0	0	113.1	D54 R62	D54-G58 PolarHBondContact O-N 3.14Å; G58-R62 PolarHBondContact O-N 3.41Å; G58-R62 VanDerWaalsContact O-N 3.08Å
59	K	94.5	Very high	92.9	Very high	138 Å²	138	105 Å²	105	60%	0.6	53%	0.529	S	S	*	.	H	α-helix	trans	-61	-43.9	173.3	-73.6	175.5	-177.9	-177.1	0	111.8	R55 R56 C57 R62 K63	R55-K59 WeakPolarHBondContact O-CG 3.49Å; R55-K59 PolarHBondContact O-N 2.83Å; R56-K59 PolarHBondContact O-N 2.94Å; C57-K59 PolarHBondContact O-N 3.21Å; K59-R62 PolarHBondContact O-N 3.02Å; K59-K63 PolarHBondContact O-N 3.46Å
60	L	95.4	Very high	92.2	Very high	95 Å²	95	105.3 Å²	105.3	50%	0.497	53%	0.53	S	S	.	.	H	α-helix	trans	-66.8	-44.2	179.4	-171.7	63.5	0	0	0	111.9	R56 C57 R62 K63 L64	R56-L60 PolarHBondContact O-N 3.32Å; C57-L60 PolarHBondContact O-N 2.93Å; C57-L60 VanDerWaalsContact O-N 3.16Å; L60-R62 VanDerWaalsContact C-N 3.27Å; L60-R62 PolarHBondContact O-N 2.84Å; L60-K63 PolarHBondContact O-N 3.25Å; L60-K63 VanDerWaalsContact O-N 3.13Å; L60-L64 HydrophobicContact CD1-CD1 4.49Å; L60-L64 HydrophobicContact CG-CD1 4.08Å; L60-L64 HydrophobicContact CG-CG 4.49Å; L60-L64 WeakPolarHBondContact O-CG 3.39Å; L60-L64 PolarHBondContact O-N 3.29Å
61	K	94.5	Very high	91.4	Very high	113 Å²	113	102.1 Å²	102.1	49%	0.491	52%	0.522	S	S	.	.	H	α-helix	trans	-56.4	-40.3	174	-76.1	-179.8	175.9	179	0	112.1	C57 L64 G65 F66	C57-K61 WeakPolarHBondContact O-CG 3.48Å; C57-K61 PolarHBondContact O-N 2.81Å; K61-L64 PolarHBondContact O-N 3.49Å; K61-G65 PolarHBondContact O-N 3.18Å; K61-F66 HydrophobicContact CB-CB 4.25Å; K61-F66 WeakPolarHBondContact O-CB 3.42Å; K61-F66 PolarHBondContact O-N 3.27Å
62	R	92.6	Very high	90.8	Very high	175 Å²	175	104.9 Å²	104.9	66%	0.66	53%	0.531	S	S	*	.	H	α-helix	trans	-66.3	-44.5	175.5	-167.2	-174.3	-55.8	152	2.3	112.1	G58 K59 L60 L64 G65	G58-R62 PolarHBondContact O-N 3.41Å; G58-R62 VanDerWaalsContact O-N 3.08Å; K59-R62 PolarHBondContact O-N 3.02Å; L60-R62 VanDerWaalsContact C-N 3.27Å; L60-R62 PolarHBondContact O-N 2.84Å; R62-L64 VanDerWaalsContact C-N 3.31Å; R62-L64 PolarHBondContact O-N 3.07Å; R62-G65 PolarHBondContact O-N 3.31Å
63	K	92.3	Very high	90.3	Very high	183 Å²	183	111.1 Å²	111.1	80%	0.796	54%	0.543	S	S	*	.	H	α-helix	trans	-61.6	-38.3	176	-75.7	-170.8	172.9	-161.6	0	112.6	K59 L60 G65	K59-K63 PolarHBondContact O-N 3.46Å; L60-K63 PolarHBondContact O-N 3.25Å; L60-K63 VanDerWaalsContact O-N 3.13Å; K63-G65 PolarHBondContact O-N 2.78Å
64	L	92	Very high	89.8	Confident	121 Å²	121	110 Å²	110	63%	0.634	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.2	5.3	174.7	-66.1	174.6	0	0	0	113.2	L60 K61 R62 F66	L60-L64 HydrophobicContact CD1-CD1 4.49Å; L60-L64 HydrophobicContact CG-CD1 4.08Å; L60-L64 HydrophobicContact CG-CG 4.49Å; L60-L64 WeakPolarHBondContact O-CG 3.39Å; L60-L64 PolarHBondContact O-N 3.29Å; K61-L64 PolarHBondContact O-N 3.49Å; R62-L64 VanDerWaalsContact C-N 3.31Å; R62-L64 PolarHBondContact O-N 3.07Å; L64-F66 PolarHBondContact O-N 2.96Å
65	G	88.9	Confident	89.2	Confident	19 Å²	19	110.1 Å²	110.1	20%	0.196	54%	0.54	C	S	.	.	T	Hydrogen-bonded Turn	trans	73.5	3.1	176.7	0	0	0	0	0	114.8	K61 R62 K63 T67 A68 L69	K61-G65 PolarHBondContact O-N 3.18Å; R62-G65 PolarHBondContact O-N 3.31Å; K63-G65 PolarHBondContact O-N 2.78Å; G65-T67 VanDerWaalsContact C-N 3.28Å; G65-T67 PolarHBondContact O-N 3.05Å; G65-A68 CarbonylContact O-C 3.56Å; G65-A68 WeakPolarHBondContact O-CA 3.37Å; G65-A68 WeakPolarHBondContact O-CB 3.48Å; G65-A68 PolarHBondContact O-N 3.31Å; G65-L69 WeakPolarHBondContact O-CB 3.47Å; G65-L69 WeakPolarHBondContact O-CD1 3.08Å; G65-L69 PolarHBondContact O-N 2.92Å
66	F	83.9	Confident	88.8	Confident	139 Å²	139	106.3 Å²	106.3	61%	0.61	53%	0.533	S	S	*	.	H	α-helix	trans	-56.9	-40.7	-176.8	-120.8	-92.5	0	0	0	112.3	K61 L64 V70	K61-F66 HydrophobicContact CB-CB 4.25Å; K61-F66 WeakPolarHBondContact O-CB 3.42Å; K61-F66 PolarHBondContact O-N 3.27Å; L64-F66 PolarHBondContact O-N 2.96Å; F66-V70 VanDerWaalsContact O-CG2 3.25Å; F66-V70 WeakPolarHBondContact O-CG2 3.21Å; F66-V70 PolarHBondContact O-N 3.48Å
67	T	79.8	Confident	88.2	Confident	86 Å²	86	100.6 Å²	100.6	53%	0.528	52%	0.523	S	S	.	.	H	α-helix	trans	-67.1	-37.8	175.6	-50	0	0	0	0	112.3	G65 G71	G65-T67 VanDerWaalsContact C-N 3.28Å; G65-T67 PolarHBondContact O-N 3.05Å; T67-G71 PolarHBondContact O-N 3.4Å
68	A	79.6	Confident	87.7	Confident	71 Å²	71	104.8 Å²	104.8	59%	0.587	53%	0.534	S	S	*	.	H	α-helix	trans	-72.1	-39.6	177.6	0	0	0	0	0	111.8	G65 G71 L72	G65-A68 CarbonylContact O-C 3.56Å; G65-A68 WeakPolarHBondContact O-CA 3.37Å; G65-A68 WeakPolarHBondContact O-CB 3.48Å; G65-A68 PolarHBondContact O-N 3.31Å; A68-G71 PolarHBondContact O-N 3.44Å; A68-L72 WeakPolarHBondContact O-CB 3.25Å; A68-L72 PolarHBondContact O-N 3.02Å
69	L	83.5	Confident	87.3	Confident	97 Å²	97	106 Å²	106	51%	0.508	54%	0.538	S	S	.	.	H	α-helix	trans	-64	-38.7	175.5	-91.1	115.3	0	0	0	112.2	G65 R73	G65-L69 WeakPolarHBondContact O-CB 3.47Å; G65-L69 WeakPolarHBondContact O-CD1 3.08Å; G65-L69 PolarHBondContact O-N 2.92Å; L69-R73 WeakPolarHBondContact O-CB 3.34Å; L69-R73 WeakPolarHBondContact O-CG 3.36Å; L69-R73 PolarHBondContact O-N 2.85Å
70	V	83.6	Confident	86.9	Confident	73 Å²	73	107.8 Å²	107.8	44%	0.442	54%	0.541	S	S	.	.	H	α-helix	trans	-64.3	-45	174.3	170.1	0	0	0	0	110.9	F66 R73 Q74	F66-V70 VanDerWaalsContact O-CG2 3.25Å; F66-V70 WeakPolarHBondContact O-CG2 3.21Å; F66-V70 PolarHBondContact O-N 3.48Å; V70-R73 PolarHBondContact O-N 3.24Å; V70-Q74 WeakPolarHBondContact O-CG 3.26Å; V70-Q74 PolarHBondContact O-N 3.47Å
71	G	83	Confident	86.3	Confident	35 Å²	35	108.3 Å²	108.3	36%	0.361	54%	0.544	S	S	.	.	H	α-helix	trans	-64.5	-42.1	176.4	0	0	0	0	0	113.3	T67 A68 Q74 N75	T67-G71 PolarHBondContact O-N 3.4Å; A68-G71 PolarHBondContact O-N 3.44Å; G71-Q74 PolarHBondContact O-N 2.92Å; G71-N75 WeakPolarHBondContact O-CB 3.44Å; G71-N75 PolarHBondContact O-N 3.26Å
72	L	85.2	Confident	85.6	Confident	101 Å²	101	108.2 Å²	108.2	53%	0.529	55%	0.548	S	S	.	.	H	α-helix	trans	-63.1	-46.6	175.9	179.2	62.8	0	0	0	111.3	A68 Q74 N75 L76	A68-L72 WeakPolarHBondContact O-CB 3.25Å; A68-L72 PolarHBondContact O-N 3.02Å; L72-Q74 VanDerWaalsContact C-N 3.34Å; L72-Q74 PolarHBondContact O-N 2.79Å; L72-N75 PolarHBondContact O-N 3.08Å; L72-L76 HydrophobicContact CD1-CD1 4.03Å; L72-L76 HydrophobicContact CD1-CG 4.08Å; L72-L76 HydrophobicContact CG-CD1 3.91Å; L72-L76 HydrophobicContact CG-CG 4.37Å; L72-L76 WeakPolarHBondContact O-CB 3.38Å; L72-L76 VanDerWaalsContact O-CG 3.26Å; L72-L76 WeakPolarHBondContact O-CG 3.34Å; L72-L76 PolarHBondContact O-N 3.49Å
73	R	86.6	Confident	85	Confident	184 Å²	184	104.3 Å²	104.3	69%	0.694	54%	0.544	S	S	*	.	H	α-helix	trans	-57.9	-46.9	175.8	-80.5	-174.6	170.6	-142.6	-1.7	111.6	L69 V70 N75 L76 S77	L69-R73 WeakPolarHBondContact O-CB 3.34Å; L69-R73 WeakPolarHBondContact O-CG 3.36Å; L69-R73 PolarHBondContact O-N 2.85Å; V70-R73 PolarHBondContact O-N 3.24Å; R73-N75 PolarHBondContact O-N 2.82Å; R73-L76 PolarHBondContact O-N 2.85Å; R73-S77 WeakPolarHBondContact O-CB 3.34Å; R73-S77 PolarHBondContact O-N 2.88Å; R73-S77 PolarHBondContact O-OG 3.42Å
74	Q	87.5	Confident	84.1	Confident	116 Å²	116	100.2 Å²	100.2	54%	0.542	53%	0.528	S	S	.	.	H	α-helix	trans	-63.9	-39.4	178.1	-73.6	178.8	-10.7	0	0	112.6	V70 G71 L72 K78	V70-Q74 WeakPolarHBondContact O-CG 3.26Å; V70-Q74 PolarHBondContact O-N 3.47Å; G71-Q74 PolarHBondContact O-N 2.92Å; L72-Q74 VanDerWaalsContact C-N 3.34Å; L72-Q74 PolarHBondContact O-N 2.79Å; Q74-K78 WeakPolarHBondContact O-CG 3.46Å; Q74-K78 PolarHBondContact O-N 3.15Å
75	N	85.2	Confident	83.2	Confident	100 Å²	100	98.7 Å²	98.7	54%	0.535	52%	0.523	S	S	.	.	H	α-helix	trans	-65.9	-46.3	177.2	-167.8	-52.7	0	0	0	111.1	G71 L72 R73 S77 K78 S79	G71-N75 WeakPolarHBondContact O-CB 3.44Å; G71-N75 PolarHBondContact O-N 3.26Å; L72-N75 PolarHBondContact O-N 3.08Å; R73-N75 PolarHBondContact O-N 2.82Å; N75-S77 PolarHBondContact O-N 3.14Å; N75-K78 PolarHBondContact O-N 3.33Å; N75-K78 VanDerWaalsContact O-N 3.15Å; N75-S79 PolarHBondContact O-N 2.91Å
76	L	88.6	Confident	82.3	Confident	105 Å²	105	100.8 Å²	100.8	55%	0.55	54%	0.535	S	S	.	.	H	α-helix	trans	-61.5	-41.4	175.8	-68.1	172.8	0	0	0	112.1	L72 R73 K78 S79 W80	L72-L76 HydrophobicContact CD1-CD1 4.03Å; L72-L76 HydrophobicContact CD1-CG 4.08Å; L72-L76 HydrophobicContact CG-CD1 3.91Å; L72-L76 HydrophobicContact CG-CG 4.37Å; L72-L76 WeakPolarHBondContact O-CB 3.38Å; L72-L76 VanDerWaalsContact O-CG 3.26Å; L72-L76 WeakPolarHBondContact O-CG 3.34Å; L72-L76 PolarHBondContact O-N 3.49Å; R73-L76 PolarHBondContact O-N 2.85Å; L76-K78 VanDerWaalsContact C-N 3.32Å; L76-K78 PolarHBondContact O-N 2.9Å; L76-S79 PolarHBondContact O-N 3.03Å; L76-W80 VanDerWaalsContact O-CB 3.25Å; L76-W80 WeakPolarHBondContact O-CB 3.39Å; L76-W80 PolarHBondContact O-N 3.45Å
77	S	85.4	Confident	81.7	Confident	72 Å²	72	98.8 Å²	98.8	50%	0.503	53%	0.531	S	S	.	.	H	α-helix	trans	-61.8	-39.4	174.5	-63.6	0	0	0	0	112.4	R73 N75 L81	R73-S77 WeakPolarHBondContact O-CB 3.34Å; R73-S77 PolarHBondContact O-N 2.88Å; R73-S77 PolarHBondContact O-OG 3.42Å; N75-S77 PolarHBondContact O-N 3.14Å; S77-L81 WeakPolarHBondContact O-CG 3.26Å; S77-L81 PolarHBondContact O-N 2.91Å; S77-L81 VanDerWaalsContact O-N 3.13Å
78	K	85.8	Confident	81.4	Confident	146 Å²	146	98.5 Å²	98.5	64%	0.635	53%	0.529	S	S	*	.	H	α-helix	trans	-69.3	-49.2	176.4	-73.7	176.3	-178.2	178.8	0	112	Q74 N75 L76 W80 L81 D82	Q74-K78 WeakPolarHBondContact O-CG 3.46Å; Q74-K78 PolarHBondContact O-N 3.15Å; N75-K78 PolarHBondContact O-N 3.33Å; N75-K78 VanDerWaalsContact O-N 3.15Å; L76-K78 VanDerWaalsContact C-N 3.32Å; L76-K78 PolarHBondContact O-N 2.9Å; K78-W80 PolarHBondContact O-N 3.43Å; K78-L81 PolarHBondContact O-N 3.05Å; K78-L81 VanDerWaalsContact O-N 3.14Å; K78-D82 WeakPolarHBondContact O-CB 3.25Å; K78-D82 PolarHBondContact O-N 3.02Å
79	S	86	Confident	81.1	Confident	57 Å²	57	101.2 Å²	101.2	40%	0.399	53%	0.525	S	S	.	.	H	α-helix	trans	-60.2	-35.6	176.6	-74.9	0	0	0	0	112.2	N75 L76 D82 V83	N75-S79 PolarHBondContact O-N 2.91Å; L76-S79 PolarHBondContact O-N 3.03Å; S79-D82 PolarHBondContact O-N 3.33Å; S79-V83 VanDerWaalsContact O-CG2 3.27Å; S79-V83 WeakPolarHBondContact O-CG2 3.37Å; S79-V83 PolarHBondContact O-N 3.22Å
80	W	86.2	Confident	80.7	Confident	176 Å²	176	100.5 Å²	100.5	67%	0.667	52%	0.524	S	S	*	.	H	α-helix	trans	-65.4	-43.1	174.4	179.6	-101.8	0	0	0	112.8	L76 K78 D82 Q84	L76-W80 VanDerWaalsContact O-CB 3.25Å; L76-W80 WeakPolarHBondContact O-CB 3.39Å; L76-W80 PolarHBondContact O-N 3.45Å; K78-W80 PolarHBondContact O-N 3.43Å; W80-D82 VanDerWaalsContact C-N 3.32Å; W80-Q84 VanDerWaalsContact CD1-NE2 3.27Å; W80-Q84 PolarHBondContact O-N 2.83Å
81	L	81.4	Confident	80.3	Confident	106 Å²	106	101.8 Å²	101.8	56%	0.555	53%	0.525	S	S	*	.	H	α-helix	trans	-63.5	-41.1	172.6	-73	169	0	0	0	111.1	S77 K78 V83 Q84 V85	S77-L81 WeakPolarHBondContact O-CG 3.26Å; S77-L81 PolarHBondContact O-N 2.91Å; S77-L81 VanDerWaalsContact O-N 3.13Å; K78-L81 PolarHBondContact O-N 3.05Å; K78-L81 VanDerWaalsContact O-N 3.14Å; L81-V83 PolarHBondContact O-N 3.13Å; L81-Q84 PolarHBondContact O-N 3.48Å; L81-V85 VanDerWaalsContact O-CG2 3.28Å; L81-V85 WeakPolarHBondContact O-CG2 3.29Å; L81-V85 PolarHBondContact O-N 2.76Å
82	D	81.1	Confident	80.2	Confident	110 Å²	110	106.7 Å²	106.7	59%	0.588	54%	0.539	S	S	*	.	H	α-helix	trans	-64.8	-38.7	-179.9	-164.2	48.5	0	0	0	112.3	K78 S79 W80 Q84 V85 S86	K78-D82 WeakPolarHBondContact O-CB 3.25Å; K78-D82 PolarHBondContact O-N 3.02Å; S79-D82 PolarHBondContact O-N 3.33Å; W80-D82 VanDerWaalsContact C-N 3.32Å; D82-Q84 PolarHBondContact O-N 3.5Å; D82-V85 PolarHBondContact O-N 3.34Å; D82-S86 VanDerWaalsContact O-CB 3.26Å; D82-S86 WeakPolarHBondContact O-CB 3.49Å; D82-S86 PolarHBondContact O-N 2.91Å
83	V	79.2	Confident	80	Confident	94 Å²	94	107.5 Å²	107.5	57%	0.57	54%	0.538	S	S	*	.	H	α-helix	trans	-65	-39.9	173.8	169.4	0	0	0	0	111.6	S79 L81 S86 N87	S79-V83 VanDerWaalsContact O-CG2 3.27Å; S79-V83 WeakPolarHBondContact O-CG2 3.37Å; S79-V83 PolarHBondContact O-N 3.22Å; L81-V83 PolarHBondContact O-N 3.13Å; V83-S86 PolarHBondContact O-N 2.91Å; V83-N87 WeakPolarHBondContact O-CB 3.28Å; V83-N87 PolarHBondContact O-N 3.4Å
84	Q	74.6	Confident	79.7	Confident	97 Å²	97	104 Å²	104	45%	0.453	53%	0.531	S	S	.	.	H	α-helix	trans	-66.3	-41.7	174.9	-75	179.9	88.9	0	0	112	W80 L81 D82 N87 T88	W80-Q84 VanDerWaalsContact CD1-NE2 3.27Å; W80-Q84 PolarHBondContact O-N 2.83Å; L81-Q84 PolarHBondContact O-N 3.48Å; D82-Q84 PolarHBondContact O-N 3.5Å; Q84-N87 PolarHBondContact O-N 3.41Å; Q84-T88 WeakPolarHBondContact O-CG2 3.27Å; Q84-T88 PolarHBondContact O-N 3Å; Q84-T88 VanDerWaalsContact O-N 3.09Å; Q84-T88 PolarHBondContact O-OG1 2.91Å
85	V	71.6	Confident	79.4	Confident	89 Å²	89	102 Å²	102	54%	0.539	53%	0.53	S	S	.	.	H	α-helix	trans	-67.4	-39.2	177.2	173.8	0	0	0	0	110.6	L81 D82 T88 Y89	L81-V85 VanDerWaalsContact O-CG2 3.28Å; L81-V85 WeakPolarHBondContact O-CG2 3.29Å; L81-V85 PolarHBondContact O-N 2.76Å; D82-V85 PolarHBondContact O-N 3.34Å; V85-T88 WeakPolarHBondContact CA-OG1 3.33Å; V85-T88 PolarHBondContact O-N 3.32Å; V85-T88 PolarHBondContact O-OG1 3.15Å; V85-Y89 VanDerWaalsContact O-CB 3.29Å; V85-Y89 WeakPolarHBondContact O-CB 3.42Å; V85-Y89 PolarHBondContact O-N 3.44Å
86	S	70.6	Confident	79.4	Confident	62 Å²	62	99.9 Å²	99.9	43%	0.434	53%	0.526	S	S	.	.	H	α-helix	trans	-66.4	-38.6	175.9	-173.2	0	0	0	0	112.1	D82 V83 Y89 V90	D82-S86 VanDerWaalsContact O-CB 3.26Å; D82-S86 WeakPolarHBondContact O-CB 3.49Å; D82-S86 PolarHBondContact O-N 2.91Å; V83-S86 PolarHBondContact O-N 2.91Å; S86-Y89 PolarHBondContact O-N 3.41Å; S86-V90 WeakPolarHBondContact O-CG2 3.35Å; S86-V90 PolarHBondContact O-N 3.47Å
87	N	71.2	Confident	79.3	Confident	98 Å²	98	97.2 Å²	97.2	52%	0.524	52%	0.519	S	S	.	.	H	α-helix	trans	-63.9	-47	176.3	-167.6	19.4	0	0	0	111	V83 Q84 Y89 V90 E91	V83-N87 WeakPolarHBondContact O-CB 3.28Å; V83-N87 PolarHBondContact O-N 3.4Å; Q84-N87 PolarHBondContact O-N 3.41Å; N87-Y89 VanDerWaalsContact C-N 3.32Å; N87-Y89 PolarHBondContact O-N 2.94Å; N87-V90 PolarHBondContact O-N 3.09Å; N87-E91 WeakPolarHBondContact O-CB 3.4Å; N87-E91 VanDerWaalsContact O-CG 3.31Å; N87-E91 WeakPolarHBondContact O-CG 3.46Å; N87-E91 PolarHBondContact O-N 3.23Å
88	T	73.1	Confident	79.3	Confident	80 Å²	80	99.4 Å²	99.4	49%	0.491	52%	0.524	S	S	.	.	H	α-helix	trans	-65.7	-34	177	54	0	0	0	0	112.8	Q84 V85 Q92	Q84-T88 WeakPolarHBondContact O-CG2 3.27Å; Q84-T88 PolarHBondContact O-N 3Å; Q84-T88 VanDerWaalsContact O-N 3.09Å; Q84-T88 PolarHBondContact O-OG1 2.91Å; V85-T88 WeakPolarHBondContact CA-OG1 3.33Å; V85-T88 PolarHBondContact O-N 3.32Å; V85-T88 PolarHBondContact O-OG1 3.15Å; T88-Q92 VanDerWaalsContact O-CB 3.3Å; T88-Q92 WeakPolarHBondContact O-CB 3.32Å; T88-Q92 WeakPolarHBondContact O-CG 3.3Å; T88-Q92 PolarHBondContact O-N 2.96Å
89	Y	73.4	Confident	79.4	Confident	127 Å²	127	95.8 Å²	95.8	50%	0.498	52%	0.518	S	S	.	.	H	α-helix	trans	-66.1	-42.8	174.6	-178.4	-105.6	0	0	0	112.9	V85 S86 N87 K93	V85-Y89 VanDerWaalsContact O-CB 3.29Å; V85-Y89 WeakPolarHBondContact O-CB 3.42Å; V85-Y89 PolarHBondContact O-N 3.44Å; S86-Y89 PolarHBondContact O-N 3.41Å; N87-Y89 VanDerWaalsContact C-N 3.32Å; N87-Y89 PolarHBondContact O-N 2.94Å; Y89-K93 HydrophobicContact CD1-CD 4.07Å; Y89-K93 HydrophobicContact CE1-CD 3.51Å; Y89-K93 HydrophobicContact CE2-CD 4.14Å; Y89-K93 WeakPolarHBondContact O-CG 3.45Å; Y89-K93 PolarHBondContact O-N 3.4Å; Y89-K93 PolarHBondContact OH-NZ 2.86Å
90	V	76	Confident	79.4	Confident	82 Å²	82	97.8 Å²	97.8	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-64.9	-46.2	175.6	171.4	0	0	0	0	110.6	S86 N87 Q92 K93 M94	S86-V90 WeakPolarHBondContact O-CG2 3.35Å; S86-V90 PolarHBondContact O-N 3.47Å; N87-V90 PolarHBondContact O-N 3.09Å; V90-Q92 PolarHBondContact O-N 3.48Å; V90-K93 PolarHBondContact O-N 3.27Å; V90-M94 WeakPolarHBondContact O-CB 3.48Å; V90-M94 PolarHBondContact O-N 2.98Å
91	E	75.1	Confident	79.5	Confident	101 Å²	101	96.1 Å²	96.1	47%	0.472	53%	0.529	S	S	.	.	H	α-helix	trans	-61.1	-43.3	176.4	-72.6	-62.6	149.5	0	0	112.2	N87 K93 M94 S95	N87-E91 WeakPolarHBondContact O-CB 3.4Å; N87-E91 VanDerWaalsContact O-CG 3.31Å; N87-E91 WeakPolarHBondContact O-CG 3.46Å; N87-E91 PolarHBondContact O-N 3.23Å; E91-K93 PolarHBondContact O-N 3.02Å; E91-M94 PolarHBondContact O-N 2.76Å; E91-S95 VanDerWaalsContact O-CB 3.23Å; E91-S95 WeakPolarHBondContact O-CB 3.41Å; E91-S95 PolarHBondContact O-N 2.85Å
92	Q	80.4	Confident	79.8	Confident	137 Å²	137	92.6 Å²	92.6	64%	0.64	52%	0.518	S	S	*	.	H	α-helix	trans	-62.6	-42.6	175.7	-83.9	-175.6	-11.5	0	0	112.2	T88 V90 S95 A96	T88-Q92 VanDerWaalsContact O-CB 3.3Å; T88-Q92 WeakPolarHBondContact O-CB 3.32Å; T88-Q92 WeakPolarHBondContact O-CG 3.3Å; T88-Q92 PolarHBondContact O-N 2.96Å; V90-Q92 PolarHBondContact O-N 3.48Å; Q92-S95 PolarHBondContact O-N 2.9Å; Q92-A96 VanDerWaalsContact O-CB 3.3Å; Q92-A96 WeakPolarHBondContact O-CB 3.3Å; Q92-A96 PolarHBondContact O-N 2.9Å
93	K	81	Confident	79.9	Confident	119 Å²	119	90.6 Å²	90.6	52%	0.517	51%	0.51	S	S	.	.	H	α-helix	trans	-67.7	-40.1	177.8	-74.6	-178.4	108.3	162.6	0	112.2	Y89 V90 E91 A96 A97	Y89-K93 HydrophobicContact CD1-CD 4.07Å; Y89-K93 HydrophobicContact CE1-CD 3.51Å; Y89-K93 HydrophobicContact CE2-CD 4.14Å; Y89-K93 WeakPolarHBondContact O-CG 3.45Å; Y89-K93 PolarHBondContact O-N 3.4Å; Y89-K93 PolarHBondContact OH-NZ 2.86Å; V90-K93 PolarHBondContact O-N 3.27Å; E91-K93 PolarHBondContact O-N 3.02Å; K93-A96 PolarHBondContact O-N 3.48Å; K93-A97 WeakPolarHBondContact O-CB 3.31Å; K93-A97 PolarHBondContact O-N 3.48Å
94	M	80.7	Confident	80.2	Confident	110 Å²	110	88.8 Å²	88.8	54%	0.542	51%	0.505	S	S	.	.	H	α-helix	trans	-63.2	-46	174.9	-171.7	175.9	80.8	0	0	110.9	V90 E91 A97 L98	V90-M94 WeakPolarHBondContact O-CB 3.48Å; V90-M94 PolarHBondContact O-N 2.98Å; E91-M94 PolarHBondContact O-N 2.76Å; M94-A97 PolarHBondContact O-N 3.49Å; M94-L98 VanDerWaalsContact O-CB 3.29Å; M94-L98 WeakPolarHBondContact O-CB 3.45Å; M94-L98 PolarHBondContact O-N 2.84Å
95	S	80.4	Confident	80.5	Confident	75 Å²	75	90 Å²	90	52%	0.524	51%	0.514	S	S	.	.	H	α-helix	trans	-62.5	-42.2	177.3	-174.3	0	0	0	0	112.4	E91 Q92 L98 S99	E91-S95 VanDerWaalsContact O-CB 3.23Å; E91-S95 WeakPolarHBondContact O-CB 3.41Å; E91-S95 PolarHBondContact O-N 2.85Å; Q92-S95 PolarHBondContact O-N 2.9Å; S95-L98 PolarHBondContact O-N 3.46Å; S95-S99 VanDerWaalsContact O-CB 3.26Å; S95-S99 WeakPolarHBondContact O-CB 3.32Å; S95-S99 PolarHBondContact O-N 3.44Å
96	A	85.8	Confident	80.9	Confident	55 Å²	55	90 Å²	90	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-65.2	-42.2	175.8	0	0	0	0	0	112.4	Q92 K93 T100	Q92-A96 VanDerWaalsContact O-CB 3.3Å; Q92-A96 WeakPolarHBondContact O-CB 3.3Å; Q92-A96 PolarHBondContact O-N 2.9Å; K93-A96 PolarHBondContact O-N 3.48Å; A96-T100 WeakPolarHBondContact O-CB 3.26Å; A96-T100 PolarHBondContact O-N 3.23Å; A96-T100 PolarHBondContact O-OG1 2.75Å
97	A	86.6	Confident	81.6	Confident	48 Å²	48	95.9 Å²	95.9	40%	0.397	53%	0.53	S	S	.	.	H	α-helix	trans	-64.9	-45.5	175.8	0	0	0	0	0	111.4	K93 M94 S99 T100 M101	K93-A97 WeakPolarHBondContact O-CB 3.31Å; K93-A97 PolarHBondContact O-N 3.48Å; M94-A97 PolarHBondContact O-N 3.49Å; A97-S99 PolarHBondContact O-N 3.34Å; A97-T100 WeakPolarHBondContact O-CB 3.29Å; A97-T100 PolarHBondContact O-N 2.95Å; A97-M101 VanDerWaalsContact O-CG 3.32Å; A97-M101 WeakPolarHBondContact O-CG 3.23Å; A97-M101 PolarHBondContact O-N 2.88Å
98	L	86.3	Confident	82.1	Confident	118 Å²	118	98.9 Å²	98.9	62%	0.618	54%	0.538	S	S	*	.	H	α-helix	trans	-61.6	-44.1	176.6	-175.3	152.1	0	0	0	111.4	M94 S95 T100 M101 G102	M94-L98 VanDerWaalsContact O-CB 3.29Å; M94-L98 WeakPolarHBondContact O-CB 3.45Å; M94-L98 PolarHBondContact O-N 2.84Å; S95-L98 PolarHBondContact O-N 3.46Å; L98-T100 VanDerWaalsContact C-N 3.33Å; L98-T100 PolarHBondContact O-N 3.23Å; L98-M101 PolarHBondContact O-N 3.45Å; L98-G102 PolarHBondContact O-N 3.46Å
99	S	87.9	Confident	82.5	Confident	70 Å²	70	101 Å²	101	49%	0.49	55%	0.546	S	S	.	.	H	α-helix	trans	-63.1	-39.5	176.2	-173.6	0	0	0	0	111.9	S95 A97 G102 T103	S95-S99 VanDerWaalsContact O-CB 3.26Å; S95-S99 WeakPolarHBondContact O-CB 3.32Å; S95-S99 PolarHBondContact O-N 3.44Å; A97-S99 PolarHBondContact O-N 3.34Å; S99-G102 PolarHBondContact O-N 2.77Å; S99-T103 VanDerWaalsContact O-CB 3.31Å; S99-T103 WeakPolarHBondContact O-CB 3.31Å; S99-T103 PolarHBondContact O-N 2.85Å; S99-T103 PolarHBondContact O-OG1 3.46Å
100	T	86.1	Confident	82.6	Confident	99 Å²	99	96.2 Å²	96.2	61%	0.607	54%	0.536	S	S	*	.	H	α-helix	trans	-63	-45.4	174.7	-57.7	0	0	0	0	111.3	A96 A97 L98 T103 A104	A96-T100 WeakPolarHBondContact O-CB 3.26Å; A96-T100 PolarHBondContact O-N 3.23Å; A96-T100 PolarHBondContact O-OG1 2.75Å; A97-T100 WeakPolarHBondContact O-CB 3.29Å; A97-T100 PolarHBondContact O-N 2.95Å; L98-T100 VanDerWaalsContact C-N 3.33Å; L98-T100 PolarHBondContact O-N 3.23Å; T100-T103 PolarHBondContact O-N 3.02Å; T100-A104 PolarHBondContact O-N 2.87Å
101	M	86.7	Confident	82.5	Confident	141 Å²	141	94.1 Å²	94.1	70%	0.695	53%	0.53	S	S	*	.	H	α-helix	trans	-66	-43.8	176.7	-69.6	177.6	174.4	0	0	112.2	A97 L98 T103 A104 L105	A97-M101 VanDerWaalsContact O-CG 3.32Å; A97-M101 WeakPolarHBondContact O-CG 3.23Å; A97-M101 PolarHBondContact O-N 2.88Å; L98-M101 PolarHBondContact O-N 3.45Å; M101-T103 VanDerWaalsContact C-N 3.33Å; M101-T103 PolarHBondContact O-N 3.45Å; M101-A104 PolarHBondContact O-N 3.16Å; M101-L105 PolarHBondContact O-N 3.05Å
102	G	87.7	Confident	82.2	Confident	32 Å²	32	94.6 Å²	94.6	33%	0.33	54%	0.535	S	S	.	.	H	α-helix	trans	-61.3	-40.8	175.9	0	0	0	0	0	112	L98 S99 L105 C106	L98-G102 PolarHBondContact O-N 3.46Å; S99-G102 PolarHBondContact O-N 2.77Å; G102-L105 PolarHBondContact O-N 3.33Å; G102-C106 WeakPolarHBondContact O-CB 3.3Å; G102-C106 PolarHBondContact O-N 2.93Å; G102-C106 PolarHBondContact O-SG 3.29Å
103	T	84.3	Confident	81.5	Confident	68 Å²	68	97 Å²	97	42%	0.417	54%	0.543	S	S	.	.	H	α-helix	trans	-65.3	-41.3	175.1	-57	0	0	0	0	111.9	S99 T100 M101 C106 R107	S99-T103 VanDerWaalsContact O-CB 3.31Å; S99-T103 WeakPolarHBondContact O-CB 3.31Å; S99-T103 PolarHBondContact O-N 2.85Å; S99-T103 PolarHBondContact O-OG1 3.46Å; T100-T103 PolarHBondContact O-N 3.02Å; M101-T103 VanDerWaalsContact C-N 3.33Å; M101-T103 PolarHBondContact O-N 3.45Å; T103-C106 PolarHBondContact O-N 3.49Å; T103-R107 VanDerWaalsContact O-CB 3.3Å; T103-R107 WeakPolarHBondContact O-CB 3.35Å; T103-R107 PolarHBondContact O-N 2.88Å
104	A	84.6	Confident	80.6	Confident	57 Å²	57	100.3 Å²	100.3	47%	0.471	56%	0.558	S	S	.	*	H	α-helix	trans	-63.9	-40.7	175.9	0	0	0	0	0	112.1	T100 M101 R107 K108	T100-A104 PolarHBondContact O-N 2.87Å; M101-A104 PolarHBondContact O-N 3.16Å; A104-R107 PolarHBondContact O-N 2.95Å; A104-K108 PolarHBondContact O-N 3.37Å
105	L	82.1	Confident	79.6	Confident	122 Å²	122	97.8 Å²	97.8	64%	0.639	55%	0.551	S	S	*	*	H	α-helix	trans	-65.4	-48.7	175.5	-177	62	0	0	0	111.8	M101 G102 R107 K108 L109	M101-L105 PolarHBondContact O-N 3.05Å; G102-L105 PolarHBondContact O-N 3.33Å; L105-R107 VanDerWaalsContact C-N 3.26Å; L105-R107 PolarHBondContact O-N 2.94Å; L105-K108 PolarHBondContact O-N 3.25Å; L105-K108 VanDerWaalsContact O-N 3.16Å; L105-L109 PolarHBondContact O-N 3.44Å
106	C	80.1	Confident	78.5	Confident	90 Å²	90	97.9 Å²	97.9	61%	0.608	56%	0.556	S	S	*	*	H	α-helix	trans	-59	-37.4	176.3	-74	0	0	0	0	112	G102 T103 G110	G102-C106 WeakPolarHBondContact O-CB 3.3Å; G102-C106 PolarHBondContact O-N 2.93Å; G102-C106 PolarHBondContact O-SG 3.29Å; T103-C106 PolarHBondContact O-N 3.49Å; C106-G110 WeakPolarHBondContact O-CA 3.46Å; C106-G110 PolarHBondContact O-N 3.27Å
107	R	84.3	Confident	77.1	Confident	184 Å²	184	101.1 Å²	101.1	69%	0.694	57%	0.571	S	S	*	*	H	α-helix	trans	-66.5	-43.1	175.5	-170.5	178	-60.5	164.2	3.2	112	T103 A104 L105 G111	T103-R107 VanDerWaalsContact O-CB 3.3Å; T103-R107 WeakPolarHBondContact O-CB 3.35Å; T103-R107 PolarHBondContact O-N 2.88Å; A104-R107 PolarHBondContact O-N 2.95Å; L105-R107 VanDerWaalsContact C-N 3.26Å; L105-R107 PolarHBondContact O-N 2.94Å; R107-G111 PolarHBondContact O-N 2.9Å
108	K	82.4	Confident	75.4	Confident	162 Å²	162	107 Å²	107	70%	0.704	59%	0.588	S	S	*	*	H	α-helix	trans	-66	-41.5	178.2	-164.6	166.7	-171.3	-77.8	0	111.7	A104 L105 I112	A104-K108 PolarHBondContact O-N 3.37Å; L105-K108 PolarHBondContact O-N 3.25Å; L105-K108 VanDerWaalsContact O-N 3.16Å; K108-I112 WeakPolarHBondContact O-CG1 3.49Å
109	L	79.9	Confident	74	Confident	123 Å²	123	110.8 Å²	110.8	64%	0.644	59%	0.593	S	S	*	*	H	α-helix	trans	-71.1	-43	176.5	-175	61.3	0	0	0	112.4	L105 G111 I112 K113	L105-L109 PolarHBondContact O-N 3.44Å; L109-G111 VanDerWaalsContact C-N 3.31Å; L109-G111 PolarHBondContact O-N 3.44Å; L109-I112 PolarHBondContact O-N 2.87Å; L109-K113 PolarHBondContact O-N 2.84Å
110	G	77.3	Confident	72.4	Confident	28 Å²	28	112.6 Å²	112.6	29%	0.289	61%	0.606	S	S	.	*	H	α-helix	trans	-65.9	-31.9	177.1	0	0	0	0	0	113.4	C106 I112 K113 K114	C106-G110 WeakPolarHBondContact O-CA 3.46Å; C106-G110 PolarHBondContact O-N 3.27Å; G110-I112 VanDerWaalsContact C-N 3.33Å; G110-K113 PolarHBondContact O-N 3.5Å; G110-K114 PolarHBondContact O-N 3.32Å
111	G	74.2	Confident	70.8	Confident	37 Å²	37	116.7 Å²	116.7	38%	0.381	62%	0.616	S	S	.	*	H	α-helix	trans	-62.9	-36.9	173.6	0	0	0	0	0	112.9	R107 L109 K113 K114 S115	R107-G111 PolarHBondContact O-N 2.9Å; L109-G111 VanDerWaalsContact C-N 3.31Å; L109-G111 PolarHBondContact O-N 3.44Å; G111-K113 VanDerWaalsContact C-N 3.35Å; G111-K113 PolarHBondContact O-N 3.46Å; G111-K114 CarbonylContact O-C 3.53Å; G111-K114 PolarHBondContact O-N 2.82Å; G111-S115 VanDerWaalsContact O-CB 3.3Å; G111-S115 WeakPolarHBondContact O-CB 3.3Å; G111-S115 PolarHBondContact O-N 3.33Å
112	I	67.8	Low	69.6	Low	111 Å²	111	118 Å²	118	57%	0.569	62%	0.62	S	S	*	*	H	α-helix	trans	-65.4	-41.3	176.7	-64	160.6	0	0	0	110.3	K108 L109 G110 K114 S115	K108-I112 WeakPolarHBondContact O-CG1 3.49Å; L109-I112 PolarHBondContact O-N 2.87Å; G110-I112 VanDerWaalsContact C-N 3.33Å; I112-K114 VanDerWaalsContact C-N 3.26Å; I112-K114 PolarHBondContact O-N 3.3Å; I112-S115 PolarHBondContact O-N 3.22Å; I112-S115 PolarHBondContact O-OG 3.18Å
113	K	65.2	Low	67.7	Low	189 Å²	189	119.7 Å²	119.7	82%	0.822	64%	0.638	S	S	*	*	H	α-helix	trans	-67	-23.6	176.5	-158.4	176.6	76.5	-175	0	113.7	L109 G110 G111	L109-K113 PolarHBondContact O-N 2.84Å; G110-K113 PolarHBondContact O-N 3.5Å; G111-K113 VanDerWaalsContact C-N 3.35Å; G111-K113 PolarHBondContact O-N 3.46Å
114	K	62	Low	66.1	Low	188 Å²	188	124.1 Å²	124.1	82%	0.817	66%	0.659	S	S	*	*	H	α-helix	trans	-101	-8	176.6	-68	-171.5	-179.5	-112.4	0	113.8	G110 G111 I112	G110-K114 PolarHBondContact O-N 3.32Å; G111-K114 CarbonylContact O-C 3.53Å; G111-K114 PolarHBondContact O-N 2.82Å; I112-K114 VanDerWaalsContact C-N 3.26Å; I112-K114 PolarHBondContact O-N 3.3Å
115	S	61.2	Low	65.1	Low	56 Å²	56	126.6 Å²	126.6	39%	0.392	67%	0.67	S	S	.	*	S	Bend	trans	-74.3	145.8	-178.5	69.3	0	0	0	0	111.2	G111 I112 T117	G111-S115 VanDerWaalsContact O-CB 3.3Å; G111-S115 WeakPolarHBondContact O-CB 3.3Å; G111-S115 PolarHBondContact O-N 3.33Å; I112-S115 PolarHBondContact O-N 3.22Å; I112-S115 PolarHBondContact O-OG 3.18Å; S115-T117 PolarHBondContact O-N 3.25Å
116	A	56.1	Low	64	Low	77 Å²	77	129.8 Å²	129.8	64%	0.636	68%	0.679	S	S	*	*	G	3₁₀ helix	trans	-65.2	5.5	-166.4	0	0	0	0	0	116.1	F118	A116-F118 PolarHBondContact O-N 2.87Å
117	T	56.1	Low	62.8	Low	124 Å²	124	133.9 Å²	133.9	76%	0.761	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-69.9	-14.9	-179.3	-43.6	0	0	0	0	113.2	S115	S115-T117 PolarHBondContact O-N 3.25Å
118	F	52.3	Low	61.1	Low	172 Å²	172	129.4 Å²	129.4	75%	0.754	70%	0.7	S	S	*	*	G	3₁₀ helix	trans	-123.2	8.3	176.7	-139.7	-96.4	0	0	0	115.1	A116	A116-F118 PolarHBondContact O-N 2.87Å
119	R	55.4	Low	60	Low	196 Å²	196	126.2 Å²	126.2	74%	0.74	70%	0.698	S	S	*	*	S	Bend	trans	-84.6	-9.4	168	-83.1	-159.5	77.7	-114.9	-0.1	113.5	F121	R119-F121 VanDerWaalsContact C-N 3.26Å; R119-F121 PolarHBondContact O-N 3.34Å
120	S	54	Low	58.8	Low	109 Å²	109	131.5 Å²	131.5	76%	0.762	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.3	-3.6	179.1	-74.8	0	0	0	0	115.1
121	F	54.3	Low	57.5	Low	184 Å²	184	141.5 Å²	141.5	81%	0.807	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.5	5.2	175.3	-86.9	-78	0	0	0	114.6	R119	R119-F121 VanDerWaalsContact C-N 3.26Å; R119-F121 PolarHBondContact O-N 3.34Å
122	E	60	Low	56.6	Low	169 Å²	169	146.7 Å²	146.7	79%	0.79	77%	0.773	S	S	*	*			trans	-142.5	83.4	-179.5	-154.6	153.5	-155.3	0	0	112.3
123	G	47.5	Very low	56	Low	68 Å²	68	148.6 Å²	148.6	70%	0.701	78%	0.783	S	S	*	*			trans	-171.1	124.3	162.1	0	0	0	0	0	108
124	N	52	Low	55.5	Low	160 Å²	160	146.3 Å²	146.3	86%	0.856	78%	0.781	S	S	*	*			cis	-144.6	155.8	3	-91.7	-45.8	0	0	0	107.8
125	P	62.4	Low	55.1	Low	109 Å²	109	143.9 Å²	143.9	71%	0.708	78%	0.779	S	S	*	*			trans	-82.3	151.2	160	34	-28.5	0	0	0	110.2
126	K	60.1	Low	54.8	Low	189 Å²	189	149.4 Å²	149.4	82%	0.822	80%	0.803	S	S	*	*			trans	94.6	105.2	172.2	-51.3	-168.1	-178.7	-172.8	0	115.7
127	E	54.7	Low	54.7	Low	177 Å²	177	154.2 Å²	154.2	83%	0.827	81%	0.814	S	S	*	*				-166.2	101.2	114.9	-148.3	67.9	-170.9	0	0	108.2
128	G	47.8	Very low	54.6	Low	89 Å²	89	156.4 Å²	156.4	92%	0.918	82%	0.818	S	S	*	*			trans	-122.9	83.1	174.3	0	0	0	0	0	108.7
129	S	60.9	Low	54.8	Low	96 Å²	96	155.2 Å²	155.2	67%	0.671	82%	0.823	S	S	*	*			trans	-132.9	136.5	171.7	-166.3	0	0	0	0	108.5
130	R	53.5	Low	54.7	Low	233 Å²	233	151.8 Å²	151.8	88%	0.879	83%	0.83	S	S	*	*			trans	70.7	124.1	-176.8	-104.8	172.9	-90.9	-180	-7.8	112.8
131	I	49.3	Very low	54.8	Low	238 Å²	238	155.6 Å²	155.6	100%	1.221	84%	0.836	S	S	*	*			cis	-146.5	0	36.8	-55.1	158.1	0	0	0	108.6

Retrieved 131 of 131 residues in 874.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).