A0A096MUM6_PAPAN Loading...

Family with sequence similarity 240 member C

AlphaFold DB , UniProt , Accession A0A096MUM6, Species PAPAN (Papio anubis, Olive baboon), Gene FAM240C, Length 95 aa.

						>A0A096MUM6_PAPAN|A0A096MUM6|FAM240C
MVGKNVSKSLTLKNPGRVAYDSGGIKMFWEKQIEHHARHLQNEDMRVRRSALNKLRVGWAEQLEGRNKMLQGPGRCPDGVPEVAEPLHTKDKMAA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.3	Very low	54.3	Low	246 Å²	246	142.5 Å²	142.5	100%	1.212	80%	0.799	S	S	*	*				0	104.2	0	-72.8	153	83.2	0	0	107.5
2	V	46.4	Very low	54.8	Low	145 Å²	145	138.7 Å²	138.7	88%	0.879	78%	0.775	S	S	*	*			trans	-98.1	121	179.9	174	0	0	0	0	108.4
3	G	52.7	Low	55.2	Low	59 Å²	59	142.6 Å²	142.6	61%	0.608	78%	0.778	S	S	*	*			trans	-64.4	131.1	-175.2	0	0	0	0	0	112.7	N5	G3-N5 PolarHBondContact O-N 2.79Å
4	K	51.4	Low	55.4	Low	196 Å²	196	140 Å²	140	85%	0.852	76%	0.763	S	S	*	*			trans	-82.1	93.9	170.5	-74	175.9	175.8	177.5	0	108.9	V6	K4-V6 PolarHBondContact O-N 2.83Å; K4-V6 VanDerWaalsContact O-N 3.14Å
5	N	57.8	Low	55.9	Low	154 Å²	154	137.4 Å²	137.4	82%	0.824	76%	0.756	S	S	*	*			trans	-77.6	90.4	166.1	-66.1	-49.8	0	0	0	108.9	G3 S7	G3-N5 PolarHBondContact O-N 2.79Å; N5-S7 VanDerWaalsContact C-N 3.28Å; N5-S7 PolarHBondContact O-N 2.89Å
6	V	55.7	Low	56.3	Low	110 Å²	110	132.3 Å²	132.3	67%	0.667	74%	0.744	S	S	*	*			trans	-88.9	69.2	168.1	-71.3	0	0	0	0	109.3	K4 K8	K4-V6 PolarHBondContact O-N 2.83Å; K4-V6 VanDerWaalsContact O-N 3.14Å; V6-K8 HydrophobicContact CB-CG 4.42Å; V6-K8 PolarHBondContact O-N 3.31Å
7	S	58.2	Low	56.6	Low	118 Å²	118	136.5 Å²	136.5	83%	0.825	75%	0.746	S	S	*	*			trans	-67.1	81.4	158.4	-70.4	0	0	0	0	107.2	N5 S9	N5-S7 VanDerWaalsContact C-N 3.28Å; N5-S7 PolarHBondContact O-N 2.89Å; S7-S9 PolarHBondContact O-N 2.68Å
8	K	54.6	Low	56.9	Low	182 Å²	182	132.7 Å²	132.7	79%	0.791	73%	0.727	S	S	*	*			trans	-64.9	92.1	168.2	-69.3	177	-178	172.2	0	105.7	V6 L10	V6-K8 HydrophobicContact CB-CG 4.42Å; V6-K8 PolarHBondContact O-N 3.31Å; K8-L10 PolarHBondContact O-N 2.93Å; K8-L10 VanDerWaalsContact O-N 3.13Å
9	S	59.2	Low	57.3	Low	94 Å²	94	128.8 Å²	128.8	66%	0.657	72%	0.715	S	S	*	*			trans	-47.2	122.4	165.9	177.9	0	0	0	0	107	S7 T11	S7-S9 PolarHBondContact O-N 2.68Å; S9-T11 PolarHBondContact O-N 3.46Å
10	L	60.5	Low	57.8	Low	158 Å²	158	132.4 Å²	132.4	83%	0.827	72%	0.718	S	S	*	*			trans	-69.1	71.2	177.2	-167.3	84.1	0	0	0	107.4	K8 L12	K8-L10 PolarHBondContact O-N 2.93Å; K8-L10 VanDerWaalsContact O-N 3.13Å; L10-L12 PolarHBondContact O-N 3.24Å
11	T	61.1	Low	58.5	Low	105 Å²	105	131.8 Å²	131.8	64%	0.644	72%	0.715	S	S	*	*			trans	-66	105.4	174.9	53.9	0	0	0	0	106.7	S9 K13	S9-T11 PolarHBondContact O-N 3.46Å; T11-K13 PolarHBondContact O-N 2.9Å
12	L	60.4	Low	60.6	Low	97 Å²	97	123.1 Å²	123.1	51%	0.508	68%	0.678	S	S	.	*			trans	-51.8	102.9	177.1	-130.2	66.1	0	0	0	109	L10 N14 V18	L10-L12 PolarHBondContact O-N 3.24Å; L12-N14 PolarHBondContact O-N 3.37Å; L12-V18 HydrophobicContact CD2-CB 3.62Å; L12-V18 HydrophobicContact CD2-CG1 3.57Å; L12-V18 HydrophobicContact CD2-CG2 3.19Å; L12-V18 HydrophobicContact CG-CG2 3.71Å
13	K	59.7	Low	62.6	Low	190 Å²	190	118 Å²	118	83%	0.826	66%	0.655	S	S	*	*	S	Bend	trans	-69.3	98.5	172.9	-61.2	-179.4	-179	-174.8	0	106.3	T11	T11-K13 PolarHBondContact O-N 2.9Å
14	N	58.3	Low	64.4	Low	106 Å²	106	117 Å²	117	57%	0.567	64%	0.644	S	S	*	*			trans	100.5	80.6	-178.3	-58.9	-70.9	0	0	0	116.3	L12 G16 R17	L12-N14 PolarHBondContact O-N 3.37Å; N14-G16 VanDerWaalsContact C-N 3.28Å; N14-G16 PolarHBondContact O-N 3.46Å; N14-R17 HydrophobicContact CB-CB 4.22Å; N14-R17 PolarHBondContact O-N 3.45Å
15	P	63.5	Low	66.4	Low	101 Å²	101	111.7 Å²	111.7	66%	0.656	63%	0.625	S	S	*	*	H	α-helix	trans	-60.6	-32	172.9	22.9	-32.4	0	0	0	113.7	V18 A19	P15-V18 PolarHBondContact O-N 3.23Å; P15-A19 WeakPolarHBondContact O-CB 3.44Å; P15-A19 PolarHBondContact O-N 2.89Å
16	G	61.8	Low	68.1	Low	55 Å²	55	110.3 Å²	110.3	57%	0.567	61%	0.611	S	S	*	*	H	α-helix	trans	-66.9	-35.2	179.4	0	0	0	0	0	114.6	N14 Y20	N14-G16 VanDerWaalsContact C-N 3.28Å; N14-G16 PolarHBondContact O-N 3.46Å; G16-Y20 PolarHBondContact O-N 2.89Å
17	R	61.8	Low	70	Confident	205 Å²	205	111 Å²	111	77%	0.774	61%	0.609	S	S	*	*	H	α-helix	trans	-69.5	-38.8	175.6	-103.2	-177.1	176.4	-112.2	1.6	111.7	N14 Y20 D21	N14-R17 HydrophobicContact CB-CB 4.22Å; N14-R17 PolarHBondContact O-N 3.45Å; R17-Y20 PolarHBondContact O-N 3.04Å; R17-D21 WeakPolarHBondContact O-CB 3.15Å; R17-D21 PolarHBondContact O-N 3.33Å; R17-D21 VanDerWaalsContact O-N 3.11Å
18	V	62	Low	71.9	Confident	67 Å²	67	110.4 Å²	110.4	41%	0.406	59%	0.591	S	S	.	*	H	α-helix	trans	-71.1	-37.8	179.3	175.7	0	0	0	0	111.3	L12 P15 D21 S22	L12-V18 HydrophobicContact CD2-CB 3.62Å; L12-V18 HydrophobicContact CD2-CG1 3.57Å; L12-V18 HydrophobicContact CD2-CG2 3.19Å; L12-V18 HydrophobicContact CG-CG2 3.71Å; P15-V18 PolarHBondContact O-N 3.23Å; V18-D21 PolarHBondContact O-N 3.46Å; V18-S22 VanDerWaalsContact O-CB 3.24Å; V18-S22 WeakPolarHBondContact O-CB 3.37Å; V18-S22 PolarHBondContact O-N 3.29Å; V18-S22 PolarHBondContact O-OG 3.1Å
19	A	63.5	Low	73.9	Confident	59 Å²	59	108.7 Å²	108.7	49%	0.488	58%	0.58	S	S	.	*	H	α-helix	trans	-61.7	-43.9	174	0	0	0	0	0	112	P15 S22 G23	P15-A19 WeakPolarHBondContact O-CB 3.44Å; P15-A19 PolarHBondContact O-N 2.89Å; A19-S22 WeakPolarHBondContact CA-OG 3.29Å; A19-S22 PolarHBondContact O-N 2.89Å; A19-S22 PolarHBondContact O-OG 3Å; A19-G23 PolarHBondContact O-N 3.28Å; A19-G23 VanDerWaalsContact O-N 3.15Å
20	Y	67	Low	75.8	Confident	201 Å²	201	109 Å²	109	79%	0.788	57%	0.571	S	S	*	*	H	α-helix	trans	-62.8	-46.4	177.5	-176	-97.5	0	0	0	112.6	G16 R17 S22 G23 G24	G16-Y20 PolarHBondContact O-N 2.89Å; R17-Y20 PolarHBondContact O-N 3.04Å; Y20-S22 VanDerWaalsContact C-N 3.33Å; Y20-S22 PolarHBondContact O-N 3.47Å; Y20-G23 PolarHBondContact O-N 3.35Å; Y20-G24 PolarHBondContact O-N 2.87Å
21	D	74.3	Confident	77.6	Confident	120 Å²	120	108.5 Å²	108.5	64%	0.642	56%	0.562	S	S	*	*	H	α-helix	trans	-64.4	-38.8	178	-165.2	26.3	0	0	0	111.8	R17 V18 G23 G24 I25	R17-D21 WeakPolarHBondContact O-CB 3.15Å; R17-D21 PolarHBondContact O-N 3.33Å; R17-D21 VanDerWaalsContact O-N 3.11Å; V18-D21 PolarHBondContact O-N 3.46Å; D21-G23 VanDerWaalsContact C-N 3.34Å; D21-G23 PolarHBondContact O-N 3.29Å; D21-G24 PolarHBondContact O-N 3.33Å; D21-I25 WeakPolarHBondContact O-CG2 3.49Å; D21-I25 PolarHBondContact O-N 3.06Å; D21-I25 VanDerWaalsContact O-N 3.15Å
22	S	81.9	Confident	79.4	Confident	63 Å²	63	106.7 Å²	106.7	44%	0.441	55%	0.546	S	S	.	.	H	α-helix	trans	-65.7	-32	177.9	74.3	0	0	0	0	113.7	V18 A19 Y20 I25 K26	V18-S22 VanDerWaalsContact O-CB 3.24Å; V18-S22 WeakPolarHBondContact O-CB 3.37Å; V18-S22 PolarHBondContact O-N 3.29Å; V18-S22 PolarHBondContact O-OG 3.1Å; A19-S22 WeakPolarHBondContact CA-OG 3.29Å; A19-S22 PolarHBondContact O-N 2.89Å; A19-S22 PolarHBondContact O-OG 3Å; Y20-S22 VanDerWaalsContact C-N 3.33Å; Y20-S22 PolarHBondContact O-N 3.47Å; S22-I25 WeakPolarHBondContact O-CG2 3.25Å; S22-K26 WeakPolarHBondContact O-CB 3.47Å; S22-K26 PolarHBondContact O-N 3.46Å; S22-K26 VanDerWaalsContact O-N 3.1Å
23	G	89.6	Confident	81.2	Confident	39 Å²	39	107.5 Å²	107.5	40%	0.402	55%	0.55	S	S	.	.	H	α-helix	trans	-71.3	-43.3	177.5	0	0	0	0	0	112.6	A19 Y20 D21 K26 M27	A19-G23 PolarHBondContact O-N 3.28Å; A19-G23 VanDerWaalsContact O-N 3.15Å; Y20-G23 PolarHBondContact O-N 3.35Å; D21-G23 VanDerWaalsContact C-N 3.34Å; D21-G23 PolarHBondContact O-N 3.29Å; G23-K26 PolarHBondContact O-N 3.45Å; G23-M27 WeakPolarHBondContact O-CB 3.43Å; G23-M27 PolarHBondContact O-N 2.95Å
24	G	90.9	Very high	83	Confident	37 Å²	37	103.3 Å²	103.3	38%	0.381	53%	0.533	S	S	.	.	H	α-helix	trans	-64.6	-46.9	178.5	0	0	0	0	0	112.6	Y20 D21 K26 M27 F28	Y20-G24 PolarHBondContact O-N 2.87Å; D21-G24 PolarHBondContact O-N 3.33Å; G24-K26 VanDerWaalsContact C-N 3.34Å; G24-K26 PolarHBondContact O-N 3.31Å; G24-M27 PolarHBondContact O-N 3.36Å; G24-F28 WeakPolarHBondContact O-CB 3.5Å; G24-F28 PolarHBondContact O-N 3.05Å
25	I	92	Very high	84.9	Confident	85 Å²	85	103 Å²	103	44%	0.436	53%	0.528	S	S	.	.	H	α-helix	trans	-66.1	-37.4	177.7	-165.8	58.8	0	0	0	111.8	D21 S22 F28 W29	D21-I25 WeakPolarHBondContact O-CG2 3.49Å; D21-I25 PolarHBondContact O-N 3.06Å; D21-I25 VanDerWaalsContact O-N 3.15Å; S22-I25 WeakPolarHBondContact O-CG2 3.25Å; I25-F28 HydrophobicContact CD1-CD1 4.41Å; I25-F28 PolarHBondContact O-N 3.48Å; I25-W29 PolarHBondContact O-N 2.98Å; I25-W29 VanDerWaalsContact O-N 3.1Å
26	K	94.3	Very high	86.6	Confident	125 Å²	125	103.4 Å²	103.4	54%	0.543	52%	0.521	S	S	.	.	H	α-helix	trans	-60	-54.5	174.9	175.4	-179.3	170.4	-177.2	0	111.1	S22 G23 G24 F28 W29 E30	S22-K26 WeakPolarHBondContact O-CB 3.47Å; S22-K26 PolarHBondContact O-N 3.46Å; S22-K26 VanDerWaalsContact O-N 3.1Å; G23-K26 PolarHBondContact O-N 3.45Å; G24-K26 VanDerWaalsContact C-N 3.34Å; G24-K26 PolarHBondContact O-N 3.31Å; K26-F28 VanDerWaalsContact C-N 3.28Å; K26-F28 PolarHBondContact O-N 3.07Å; K26-W29 PolarHBondContact O-N 3.48Å; K26-W29 VanDerWaalsContact O-N 3.14Å; K26-E30 WeakPolarHBondContact CE-OE1 3.35Å; K26-E30 HydrophobicContact CG-CG 4.32Å; K26-E30 IonicContact NZ-OE1 3.14Å; K26-E30 WeakPolarHBondContact O-CG 3.39Å; K26-E30 PolarHBondContact O-N 3.04Å
27	M	96	Very high	88.3	Confident	125 Å²	125	103.5 Å²	103.5	62%	0.616	52%	0.517	S	S	*	.	H	α-helix	trans	-60.5	-38.9	-179	179.4	177.8	54.9	0	0	111.9	G23 G24 E30 K31	G23-M27 WeakPolarHBondContact O-CB 3.43Å; G23-M27 PolarHBondContact O-N 2.95Å; G24-M27 PolarHBondContact O-N 3.36Å; M27-E30 PolarHBondContact O-N 3.41Å; M27-K31 WeakPolarHBondContact O-CB 3.42Å; M27-K31 PolarHBondContact O-N 3.01Å
28	F	96.4	Very high	90.1	Very high	105 Å²	105	98.8 Å²	98.8	46%	0.461	50%	0.499	S	S	.	.	H	α-helix	trans	-57.4	-51.1	174.5	172	-95.1	0	0	0	111.3	G24 I25 K26 K31 Q32	G24-F28 WeakPolarHBondContact O-CB 3.5Å; G24-F28 PolarHBondContact O-N 3.05Å; I25-F28 HydrophobicContact CD1-CD1 4.41Å; I25-F28 PolarHBondContact O-N 3.48Å; K26-F28 VanDerWaalsContact C-N 3.28Å; K26-F28 PolarHBondContact O-N 3.07Å; F28-K31 PolarHBondContact O-N 3.3Å; F28-Q32 HydrophobicContact CE1-CG 4.06Å; F28-Q32 HydrophobicContact CE2-CG 4.3Å; F28-Q32 HydrophobicContact CZ-CG 3.95Å; F28-Q32 WeakPolarHBondContact O-CG 3.41Å; F28-Q32 PolarHBondContact O-N 2.77Å
29	W	98	Very high	91.8	Very high	146 Å²	146	100.4 Å²	100.4	55%	0.553	50%	0.502	S	S	*	.	H	α-helix	trans	-67.7	-39.5	179.9	-74.7	118.9	0	0	0	112.8	I25 K26 K31 Q32 I33	I25-W29 PolarHBondContact O-N 2.98Å; I25-W29 VanDerWaalsContact O-N 3.1Å; K26-W29 PolarHBondContact O-N 3.48Å; K26-W29 VanDerWaalsContact O-N 3.14Å; W29-K31 VanDerWaalsContact C-N 3.33Å; W29-K31 PolarHBondContact O-N 2.72Å; W29-Q32 HydrophobicContact CE3-CB 4.35Å; W29-Q32 PolarHBondContact O-N 3.31Å; W29-I33 WeakPolarHBondContact O-CB 3.45Å; W29-I33 WeakPolarHBondContact O-CD1 3.41Å; W29-I33 WeakPolarHBondContact O-CG1 3.37Å; W29-I33 PolarHBondContact O-N 3.43Å
30	E	98.3	Very high	93.5	Very high	101 Å²	101	103.6 Å²	103.6	47%	0.472	51%	0.51	S	S	.	.	H	α-helix	trans	-57.6	-46.6	174.4	-74.5	175.8	158.1	0	0	111.2	K26 M27 Q32 I33 E34	K26-E30 WeakPolarHBondContact CE-OE1 3.35Å; K26-E30 HydrophobicContact CG-CG 4.32Å; K26-E30 IonicContact NZ-OE1 3.14Å; K26-E30 WeakPolarHBondContact O-CG 3.39Å; K26-E30 PolarHBondContact O-N 3.04Å; M27-E30 PolarHBondContact O-N 3.41Å; E30-Q32 VanDerWaalsContact C-N 3.35Å; E30-Q32 PolarHBondContact O-N 2.99Å; E30-I33 PolarHBondContact O-N 3.5Å; E30-E34 VanDerWaalsContact O-CB 3.29Å; E30-E34 WeakPolarHBondContact O-CB 3.44Å; E30-E34 PolarHBondContact O-N 3.36Å
31	K	98.3	Very high	95	Very high	147 Å²	147	99.5 Å²	99.5	64%	0.639	50%	0.498	S	S	*	.	H	α-helix	trans	-62.9	-40.5	176.8	-174	175.7	-179.3	177.1	0	112.2	M27 F28 W29 H35	M27-K31 WeakPolarHBondContact O-CB 3.42Å; M27-K31 PolarHBondContact O-N 3.01Å; F28-K31 PolarHBondContact O-N 3.3Å; W29-K31 VanDerWaalsContact C-N 3.33Å; W29-K31 PolarHBondContact O-N 2.72Å; K31-H35 WeakPolarHBondContact O-CB 3.44Å; K31-H35 PolarHBondContact O-N 3.21Å
32	Q	98.3	Very high	96.1	Very high	66 Å²	66	98.1 Å²	98.1	31%	0.308	49%	0.491	S	S	.	.	H	α-helix	trans	-64	-48.7	176	-75.7	-59.8	-34.3	0	0	111.4	F28 W29 E30 E34 H35 H36	F28-Q32 HydrophobicContact CE1-CG 4.06Å; F28-Q32 HydrophobicContact CE2-CG 4.3Å; F28-Q32 HydrophobicContact CZ-CG 3.95Å; F28-Q32 WeakPolarHBondContact O-CG 3.41Å; F28-Q32 PolarHBondContact O-N 2.77Å; W29-Q32 HydrophobicContact CE3-CB 4.35Å; W29-Q32 PolarHBondContact O-N 3.31Å; E30-Q32 VanDerWaalsContact C-N 3.35Å; E30-Q32 PolarHBondContact O-N 2.99Å; Q32-E34 VanDerWaalsContact C-N 3.32Å; Q32-E34 PolarHBondContact O-N 2.98Å; Q32-H35 PolarHBondContact O-N 3.13Å; Q32-H36 PolarHBondContact O-N 3.42Å; Q32-H36 PolarHBondContact O-ND1 3.41Å; Q32-H36 PolarHBondContact OE1-CE1 2.94Å
33	I	98.2	Very high	96.9	Very high	114 Å²	114	97.9 Å²	97.9	59%	0.585	48%	0.483	S	S	*	.	H	α-helix	trans	-58.2	-47.4	178.2	-69	162.7	0	0	0	110.2	W29 E30 H35 H36 A37	W29-I33 WeakPolarHBondContact O-CB 3.45Å; W29-I33 WeakPolarHBondContact O-CD1 3.41Å; W29-I33 WeakPolarHBondContact O-CG1 3.37Å; W29-I33 PolarHBondContact O-N 3.43Å; E30-I33 PolarHBondContact O-N 3.5Å; I33-H35 PolarHBondContact O-N 2.93Å; I33-H36 PolarHBondContact O-N 2.88Å; I33-A37 WeakPolarHBondContact O-CB 3.33Å; I33-A37 PolarHBondContact O-N 2.84Å
34	E	98.6	Very high	97.2	Very high	102 Å²	102	99.7 Å²	99.7	48%	0.477	48%	0.483	S	S	.	.	H	α-helix	trans	-63.2	-41.8	-179.5	-165.2	-158.4	-168.3	0	0	112.2	E30 Q32 A37 R38	E30-E34 VanDerWaalsContact O-CB 3.29Å; E30-E34 WeakPolarHBondContact O-CB 3.44Å; E30-E34 PolarHBondContact O-N 3.36Å; Q32-E34 VanDerWaalsContact C-N 3.32Å; Q32-E34 PolarHBondContact O-N 2.98Å; E34-A37 PolarHBondContact O-N 3.46Å; E34-R38 VanDerWaalsContact CD-CZ 3.47Å; E34-R38 VanDerWaalsContact CD-NH2 3.31Å; E34-R38 PolarHBondContact O-N 3.09Å; E34-R38 IonicContact OE1-CZ 3.91Å; E34-R38 IonicContact OE1-NH1 3.72Å; E34-R38 PolarHBondContact OE1-NH1 3.27Å; E34-R38 IonicContact OE1-NH2 2.73Å; E34-R38 IonicContact OE2-CZ 2.82Å; E34-R38 IonicContact OE2-NH1 3.71Å; E34-R38 PolarHBondContact OE2-NH1 2.91Å; E34-R38 VanDerWaalsContact OE2-NH1 3.08Å; E34-R38 IonicContact OE2-NH2 3.08Å; E34-R38 PolarHBondContact OE2-NH2 3.04Å
35	H	98.6	Very high	97.5	Very high	99 Å²	99	100.5 Å²	100.5	46%	0.458	48%	0.478	S	S	.	.	H	α-helix	trans	-58.7	-48.9	173.2	172.6	-91.2	0	0	0	111.9	K31 Q32 I33 A37 R38 H39	K31-H35 WeakPolarHBondContact O-CB 3.44Å; K31-H35 PolarHBondContact O-N 3.21Å; Q32-H35 PolarHBondContact O-N 3.13Å; I33-H35 PolarHBondContact O-N 2.93Å; H35-A37 PolarHBondContact O-N 3.19Å; H35-R38 PolarHBondContact O-N 3Å; H35-H39 WeakPolarHBondContact O-CB 3.49Å; H35-H39 PolarHBondContact O-N 3.49Å
36	H	98.6	Very high	97.8	Very high	110 Å²	110	104 Å²	104	51%	0.509	49%	0.485	S	S	.	.	H	α-helix	trans	-65.7	-38.6	179.8	-72.1	85.2	0	0	0	112	Q32 I33 H39 L40	Q32-H36 PolarHBondContact O-N 3.42Å; Q32-H36 PolarHBondContact O-ND1 3.41Å; Q32-H36 PolarHBondContact OE1-CE1 2.94Å; I33-H36 PolarHBondContact O-N 2.88Å; H36-H39 PolarHBondContact O-N 3.47Å; H36-L40 WeakPolarHBondContact O-CB 3.41Å; H36-L40 PolarHBondContact O-N 2.92Å
37	A	98.5	Very high	97.9	Very high	57 Å²	57	102.4 Å²	102.4	47%	0.471	49%	0.486	S	S	.	.	H	α-helix	trans	-61	-46.7	176.1	0	0	0	0	0	111.7	I33 E34 H35 L40 Q41	I33-A37 WeakPolarHBondContact O-CB 3.33Å; I33-A37 PolarHBondContact O-N 2.84Å; E34-A37 PolarHBondContact O-N 3.46Å; H35-A37 PolarHBondContact O-N 3.19Å; A37-L40 PolarHBondContact O-N 3.44Å; A37-Q41 PolarHBondContact O-N 3Å
38	R	98.6	Very high	97.8	Very high	106 Å²	106	104.6 Å²	104.6	40%	0.4	49%	0.487	S	S	.	.	H	α-helix	trans	-61.9	-44.4	174.1	-78.4	-173.2	-70.5	-104.4	-8.9	112.3	E34 H35 L40 Q41 N42	E34-R38 VanDerWaalsContact CD-CZ 3.47Å; E34-R38 VanDerWaalsContact CD-NH2 3.31Å; E34-R38 PolarHBondContact O-N 3.09Å; E34-R38 IonicContact OE1-CZ 3.91Å; E34-R38 IonicContact OE1-NH1 3.72Å; E34-R38 PolarHBondContact OE1-NH1 3.27Å; E34-R38 IonicContact OE1-NH2 2.73Å; E34-R38 IonicContact OE2-CZ 2.82Å; E34-R38 IonicContact OE2-NH1 3.71Å; E34-R38 PolarHBondContact OE2-NH1 2.91Å; E34-R38 VanDerWaalsContact OE2-NH1 3.08Å; E34-R38 IonicContact OE2-NH2 3.08Å; E34-R38 PolarHBondContact OE2-NH2 3.04Å; H35-R38 PolarHBondContact O-N 3Å; R38-L40 VanDerWaalsContact C-N 3.33Å; R38-L40 PolarHBondContact O-N 3.47Å; R38-Q41 PolarHBondContact O-N 3.34Å; R38-N42 WeakPolarHBondContact O-CB 3.27Å; R38-N42 VanDerWaalsContact O-CG 3.25Å; R38-N42 PolarHBondContact O-N 3.41Å; R38-N42 PolarHBondContact O-ND2 3.49Å
39	H	98.3	Very high	97.7	Very high	101 Å²	101	109.6 Å²	109.6	47%	0.468	50%	0.503	S	S	.	.	H	α-helix	trans	-60.7	-45.2	179.3	-173.6	71.3	0	0	0	111.2	H35 H36 Q41 N42 E43	H35-H39 WeakPolarHBondContact O-CB 3.49Å; H35-H39 PolarHBondContact O-N 3.49Å; H36-H39 PolarHBondContact O-N 3.47Å; H39-Q41 PolarHBondContact O-N 3.03Å; H39-N42 PolarHBondContact O-N 3.43Å; H39-E43 PolarHBondContact O-N 3.38Å
40	L	98.4	Very high	97.6	Very high	126 Å²	126	105.1 Å²	105.1	66%	0.66	49%	0.494	S	S	*	.	H	α-helix	trans	-59.7	-45	176.2	-176.4	65.2	0	0	0	112	H36 A37 R38 N42 E43 D44	H36-L40 WeakPolarHBondContact O-CB 3.41Å; H36-L40 PolarHBondContact O-N 2.92Å; A37-L40 PolarHBondContact O-N 3.44Å; R38-L40 VanDerWaalsContact C-N 3.33Å; R38-L40 PolarHBondContact O-N 3.47Å; L40-N42 VanDerWaalsContact C-N 3.34Å; L40-N42 PolarHBondContact O-N 3.39Å; L40-E43 PolarHBondContact O-N 2.84Å; L40-D44 WeakPolarHBondContact O-CB 3.37Å; L40-D44 PolarHBondContact O-N 3.44Å
41	Q	98.3	Very high	97.5	Very high	116 Å²	116	103.2 Å²	103.2	54%	0.542	50%	0.495	S	S	.	.	H	α-helix	trans	-62.9	-40.8	177.3	-172.4	-174	-8.1	0	0	112	A37 R38 H39 D44 M45	A37-Q41 PolarHBondContact O-N 3Å; R38-Q41 PolarHBondContact O-N 3.34Å; H39-Q41 PolarHBondContact O-N 3.03Å; Q41-D44 PolarHBondContact O-N 3.39Å; Q41-M45 HydrophobicContact CG-CE 4.31Å; Q41-M45 WeakPolarHBondContact O-CG 3.31Å; Q41-M45 PolarHBondContact O-N 3.03Å
42	N	98.1	Very high	97.4	Very high	90 Å²	90	100 Å²	100	48%	0.481	49%	0.485	S	S	.	.	H	α-helix	trans	-66.2	-42.8	177.8	-72.9	-18.2	0	0	0	111.8	R38 H39 L40 M45 R46	R38-N42 WeakPolarHBondContact O-CB 3.27Å; R38-N42 VanDerWaalsContact O-CG 3.25Å; R38-N42 PolarHBondContact O-N 3.41Å; R38-N42 PolarHBondContact O-ND2 3.49Å; H39-N42 PolarHBondContact O-N 3.43Å; L40-N42 VanDerWaalsContact C-N 3.34Å; L40-N42 PolarHBondContact O-N 3.39Å; N42-M45 PolarHBondContact O-N 2.85Å; N42-M45 WeakPolarHBondContact OD1-CE 3.39Å; N42-R46 WeakPolarHBondContact O-CB 3.48Å; N42-R46 PolarHBondContact O-N 2.88Å
43	E	97.9	Very high	97.2	Very high	59 Å²	59	102 Å²	102	28%	0.276	50%	0.498	S	S	.	.	H	α-helix	trans	-64.9	-41.4	176.2	-77.8	-58.5	117.6	0	0	112	H39 L40 M45 R46 V47	H39-E43 PolarHBondContact O-N 3.38Å; L40-E43 PolarHBondContact O-N 2.84Å; E43-M45 PolarHBondContact O-N 3.31Å; E43-R46 VanDerWaalsContact CD-NE 3.32Å; E43-R46 WeakPolarHBondContact O-CB 3.41Å; E43-R46 PolarHBondContact O-N 2.9Å; E43-R46 IonicContact OE1-CZ 2.65Å; E43-R46 IonicContact OE1-NE 3.38Å; E43-R46 PolarHBondContact OE1-NE 2.93Å; E43-R46 IonicContact OE1-NH2 2.86Å; E43-R46 IonicContact OE2-CZ 3.78Å; E43-R46 IonicContact OE2-NE 3.02Å; E43-R46 PolarHBondContact OE2-NE 3.29Å; E43-R46 IonicContact OE2-NH2 3.94Å; E43-R46 PolarHBondContact OE2-NH2 3.02Å; E43-V47 WeakPolarHBondContact O-CB 3.36Å; E43-V47 VanDerWaalsContact O-CG2 3.32Å; E43-V47 WeakPolarHBondContact O-CG2 3.37Å; E43-V47 PolarHBondContact O-N 3.23Å
44	D	97.4	Very high	97.1	Very high	76 Å²	76	104.6 Å²	104.6	41%	0.406	51%	0.505	S	S	.	.	H	α-helix	trans	-59.9	-46	173.7	176.4	67.1	0	0	0	111.6	L40 Q41 R46 V47 R48	L40-D44 WeakPolarHBondContact O-CB 3.37Å; L40-D44 PolarHBondContact O-N 3.44Å; Q41-D44 PolarHBondContact O-N 3.39Å; D44-R46 PolarHBondContact O-N 2.93Å; D44-V47 PolarHBondContact O-N 3.45Å; D44-R48 WeakPolarHBondContact O-CB 3.48Å; D44-R48 WeakPolarHBondContact O-CG 3.2Å; D44-R48 PolarHBondContact O-N 2.65Å; D44-R48 IonicContact OD1-NE 3.79Å; D44-R48 IonicContact OD2-CZ 3.13Å; D44-R48 IonicContact OD2-NE 2.77Å; D44-R48 PolarHBondContact OD2-NE 2.86Å; D44-R48 IonicContact OD2-NH2 2.72Å; D44-R48 PolarHBondContact OD2-NH2 2.82Å
45	M	97.4	Very high	97	Very high	55 Å²	55	104.5 Å²	104.5	27%	0.271	51%	0.507	S	S	.	.	H	α-helix	trans	-61.9	-41.5	173.9	-75.2	-168.3	-69.7	0	0	112.5	Q41 N42 E43 R48 R49	Q41-M45 HydrophobicContact CG-CE 4.31Å; Q41-M45 WeakPolarHBondContact O-CG 3.31Å; Q41-M45 PolarHBondContact O-N 3.03Å; N42-M45 PolarHBondContact O-N 2.85Å; N42-M45 WeakPolarHBondContact OD1-CE 3.39Å; E43-M45 PolarHBondContact O-N 3.31Å; M45-R48 PolarHBondContact O-N 3.48Å; M45-R49 WeakPolarHBondContact O-CB 3.46Å; M45-R49 VanDerWaalsContact O-CG 3.31Å; M45-R49 WeakPolarHBondContact O-CG 3.45Å; M45-R49 PolarHBondContact O-N 3.08Å
46	R	97.1	Very high	96.9	Very high	157 Å²	157	107.3 Å²	107.3	59%	0.592	51%	0.514	S	S	*	.	H	α-helix	trans	-61	-46.5	177.7	-173	-177.7	73.9	105.9	0.8	110.9	N42 E43 D44 R49 S50	N42-R46 WeakPolarHBondContact O-CB 3.48Å; N42-R46 PolarHBondContact O-N 2.88Å; E43-R46 VanDerWaalsContact CD-NE 3.32Å; E43-R46 WeakPolarHBondContact O-CB 3.41Å; E43-R46 PolarHBondContact O-N 2.9Å; E43-R46 IonicContact OE1-CZ 2.65Å; E43-R46 IonicContact OE1-NE 3.38Å; E43-R46 PolarHBondContact OE1-NE 2.93Å; E43-R46 IonicContact OE1-NH2 2.86Å; E43-R46 IonicContact OE2-CZ 3.78Å; E43-R46 IonicContact OE2-NE 3.02Å; E43-R46 PolarHBondContact OE2-NE 3.29Å; E43-R46 IonicContact OE2-NH2 3.94Å; E43-R46 PolarHBondContact OE2-NH2 3.02Å; D44-R46 PolarHBondContact O-N 2.93Å; R46-R49 PolarHBondContact O-N 2.73Å; R46-S50 WeakPolarHBondContact O-CB 3.4Å; R46-S50 PolarHBondContact O-N 3.41Å
47	V	95.8	Very high	96.9	Very high	92 Å²	92	105.3 Å²	105.3	56%	0.558	51%	0.509	S	S	*	.	H	α-helix	trans	-65.1	-45.6	178.2	171.3	0	0	0	0	110.9	E43 D44 R49 S50	E43-V47 WeakPolarHBondContact O-CB 3.36Å; E43-V47 VanDerWaalsContact O-CG2 3.32Å; E43-V47 WeakPolarHBondContact O-CG2 3.37Å; E43-V47 PolarHBondContact O-N 3.23Å; D44-V47 PolarHBondContact O-N 3.45Å; V47-R49 VanDerWaalsContact C-N 3.3Å; V47-R49 PolarHBondContact O-N 2.91Å; V47-S50 VanDerWaalsContact O-CB 3.27Å; V47-S50 WeakPolarHBondContact O-CB 3.32Å; V47-S50 PolarHBondContact O-N 3.45Å; V47-S50 VanDerWaalsContact O-N 3.09Å
48	R	94.3	Very high	96.8	Very high	171 Å²	171	104.1 Å²	104.1	65%	0.645	50%	0.502	S	S	*	.	H	α-helix	trans	-61.9	-35.5	177.8	-76.6	-170.4	-75.3	144.2	-6.9	113.3	D44 M45 S50	D44-R48 WeakPolarHBondContact O-CB 3.48Å; D44-R48 WeakPolarHBondContact O-CG 3.2Å; D44-R48 PolarHBondContact O-N 2.65Å; D44-R48 IonicContact OD1-NE 3.79Å; D44-R48 IonicContact OD2-CZ 3.13Å; D44-R48 IonicContact OD2-NE 2.77Å; D44-R48 PolarHBondContact OD2-NE 2.86Å; D44-R48 IonicContact OD2-NH2 2.72Å; D44-R48 PolarHBondContact OD2-NH2 2.82Å; M45-R48 PolarHBondContact O-N 3.48Å; R48-S50 VanDerWaalsContact C-N 3.35Å
49	R	95.8	Very high	96.8	Very high	211 Å²	211	107.9 Å²	107.9	80%	0.796	52%	0.516	S	S	*	.	H	α-helix	trans	-82	-14	176.5	-69.6	177	179.3	174.8	1.1	113.3	M45 R46 V47	M45-R49 WeakPolarHBondContact O-CB 3.46Å; M45-R49 VanDerWaalsContact O-CG 3.31Å; M45-R49 WeakPolarHBondContact O-CG 3.45Å; M45-R49 PolarHBondContact O-N 3.08Å; R46-R49 PolarHBondContact O-N 2.73Å; V47-R49 VanDerWaalsContact C-N 3.3Å; V47-R49 PolarHBondContact O-N 2.91Å
50	S	95.8	Very high	96.8	Very high	52 Å²	52	105.9 Å²	105.9	36%	0.364	52%	0.517	S	S	.	.			trans	-68.7	137.8	-177.2	-177.5	0	0	0	0	111.7	R46 V47 R48 L52	R46-S50 WeakPolarHBondContact O-CB 3.4Å; R46-S50 PolarHBondContact O-N 3.41Å; V47-S50 VanDerWaalsContact O-CB 3.27Å; V47-S50 WeakPolarHBondContact O-CB 3.32Å; V47-S50 PolarHBondContact O-N 3.45Å; V47-S50 VanDerWaalsContact O-N 3.09Å; R48-S50 VanDerWaalsContact C-N 3.35Å; S50-L52 PolarHBondContact O-N 3.35Å; S50-L52 WeakPolarHBondContact OG-CB 3.35Å; S50-L52 PolarHBondContact OG-N 2.97Å; S50-L52 VanDerWaalsContact OG-N 3.13Å
51	A	96.1	Very high	96.7	Very high	60 Å²	60	105.8 Å²	105.8	50%	0.496	51%	0.513	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.3	-9.8	170.5	0	0	0	0	0	112.9	N53 K54 L55	A51-N53 VanDerWaalsContact C-N 3.29Å; A51-N53 PolarHBondContact O-N 3.45Å; A51-K54 WeakPolarHBondContact O-CB 3.38Å; A51-K54 PolarHBondContact O-N 3.36Å; A51-L55 WeakPolarHBondContact O-CG 3.29Å; A51-L55 PolarHBondContact O-N 3.25Å
52	L	95.8	Very high	96.7	Very high	79 Å²	79	106.6 Å²	106.6	41%	0.414	52%	0.517	S	S	.	.	H	α-helix	trans	-56.3	-39.3	-172.4	-174.9	61.7	0	0	0	113.2	S50 L55 R56	S50-L52 PolarHBondContact O-N 3.35Å; S50-L52 WeakPolarHBondContact OG-CB 3.35Å; S50-L52 PolarHBondContact OG-N 2.97Å; S50-L52 VanDerWaalsContact OG-N 3.13Å; L52-L55 PolarHBondContact O-N 3Å; L52-R56 WeakPolarHBondContact O-CG 3.45Å; L52-R56 PolarHBondContact O-N 2.97Å
53	N	93.6	Very high	96.7	Very high	110 Å²	110	106.4 Å²	106.4	59%	0.588	52%	0.515	S	S	*	.	H	α-helix	trans	-65.1	-43.6	177.9	-166.3	54.7	0	0	0	111.6	A51 L55 R56 V57	A51-N53 VanDerWaalsContact C-N 3.29Å; A51-N53 PolarHBondContact O-N 3.45Å; N53-L55 VanDerWaalsContact C-N 3.34Å; N53-L55 PolarHBondContact O-N 3.3Å; N53-R56 PolarHBondContact O-N 2.83Å; N53-V57 WeakPolarHBondContact O-CG2 3.45Å; N53-V57 PolarHBondContact O-N 3.2Å
54	K	95.6	Very high	96.6	Very high	168 Å²	168	108.5 Å²	108.5	73%	0.73	53%	0.525	S	S	*	.	H	α-helix	trans	-63	-42.2	176.8	-61.4	-178.7	179.1	-178.8	0	111.3	A51 V57 G58	A51-K54 WeakPolarHBondContact O-CB 3.38Å; A51-K54 PolarHBondContact O-N 3.36Å; K54-V57 PolarHBondContact O-N 2.73Å; K54-G58 PolarHBondContact O-N 3.47Å
55	L	97.4	Very high	96.5	Very high	99 Å²	99	106.3 Å²	106.3	52%	0.518	52%	0.521	S	S	.	.	H	α-helix	trans	-61.6	-46.3	176	-69	173.6	0	0	0	111.3	A51 L52 N53 V57 G58 W59	A51-L55 WeakPolarHBondContact O-CG 3.29Å; A51-L55 PolarHBondContact O-N 3.25Å; L52-L55 PolarHBondContact O-N 3Å; N53-L55 VanDerWaalsContact C-N 3.34Å; N53-L55 PolarHBondContact O-N 3.3Å; L55-V57 VanDerWaalsContact C-N 3.34Å; L55-V57 PolarHBondContact O-N 3.39Å; L55-G58 PolarHBondContact O-N 3.46Å; L55-W59 WeakPolarHBondContact O-CB 3.38Å; L55-W59 PolarHBondContact O-N 3.43Å
56	R	96.8	Very high	96.4	Very high	159 Å²	159	110.9 Å²	110.9	60%	0.6	54%	0.535	S	S	*	.	H	α-helix	trans	-58.9	-44.9	177.5	-77	177.1	179.4	142.8	-3	112.4	L52 N53 W59 A60	L52-R56 WeakPolarHBondContact O-CG 3.45Å; L52-R56 PolarHBondContact O-N 2.97Å; N53-R56 PolarHBondContact O-N 2.83Å; R56-W59 PolarHBondContact O-N 3.1Å; R56-A60 WeakPolarHBondContact O-CB 3.4Å; R56-A60 PolarHBondContact O-N 3.33Å
57	V	97.1	Very high	96.3	Very high	68 Å²	68	107.7 Å²	107.7	41%	0.412	53%	0.53	S	S	.	.	H	α-helix	trans	-61.9	-52.2	177.3	172.7	0	0	0	0	110.6	N53 K54 L55 W59 A60 E61	N53-V57 WeakPolarHBondContact O-CG2 3.45Å; N53-V57 PolarHBondContact O-N 3.2Å; K54-V57 PolarHBondContact O-N 2.73Å; L55-V57 VanDerWaalsContact C-N 3.34Å; L55-V57 PolarHBondContact O-N 3.39Å; V57-W59 VanDerWaalsContact C-N 3.3Å; V57-W59 PolarHBondContact O-N 3.46Å; V57-A60 WeakPolarHBondContact O-CB 3.46Å; V57-A60 PolarHBondContact O-N 3.02Å; V57-A60 VanDerWaalsContact O-N 3.07Å; V57-E61 WeakPolarHBondContact CG1-OE1 3.47Å; V57-E61 WeakPolarHBondContact O-CG 3.45Å; V57-E61 PolarHBondContact O-N 3.45Å
58	G	97.8	Very high	96.2	Very high	31 Å²	31	109.4 Å²	109.4	32%	0.32	53%	0.53	S	S	.	.	H	α-helix	trans	-62.1	-36.4	-179.7	0	0	0	0	0	113.4	K54 L55 Q62	K54-G58 PolarHBondContact O-N 3.47Å; L55-G58 PolarHBondContact O-N 3.46Å; G58-Q62 WeakPolarHBondContact O-CB 3.35Å; G58-Q62 PolarHBondContact O-N 3.01Å
59	W	98.1	Very high	95.9	Very high	186 Å²	186	108.9 Å²	108.9	71%	0.705	54%	0.537	S	S	*	.	H	α-helix	trans	-66	-40.2	173.6	-85.7	65.9	0	0	0	112.4	L55 R56 V57 Q62 L63	L55-W59 WeakPolarHBondContact O-CB 3.38Å; L55-W59 PolarHBondContact O-N 3.43Å; R56-W59 PolarHBondContact O-N 3.1Å; V57-W59 VanDerWaalsContact C-N 3.3Å; V57-W59 PolarHBondContact O-N 3.46Å; W59-Q62 PolarHBondContact O-N 3.26Å; W59-L63 WeakPolarHBondContact O-CB 3.44Å; W59-L63 WeakPolarHBondContact O-CG 2.8Å; W59-L63 PolarHBondContact O-N 2.87Å
60	A	97.7	Very high	95.5	Very high	58 Å²	58	105.5 Å²	105.5	48%	0.479	53%	0.533	S	S	.	.	H	α-helix	trans	-63.1	-45.9	176.8	0	0	0	0	0	111.5	R56 V57 Q62 L63 E64	R56-A60 WeakPolarHBondContact O-CB 3.4Å; R56-A60 PolarHBondContact O-N 3.33Å; V57-A60 WeakPolarHBondContact O-CB 3.46Å; V57-A60 PolarHBondContact O-N 3.02Å; V57-A60 VanDerWaalsContact O-N 3.07Å; A60-Q62 PolarHBondContact O-N 3.14Å; A60-L63 PolarHBondContact O-N 3.14Å; A60-E64 WeakPolarHBondContact O-CB 3.22Å; A60-E64 PolarHBondContact O-N 3.49Å
61	E	97.9	Very high	94.9	Very high	124 Å²	124	111 Å²	111	58%	0.579	55%	0.554	S	S	*	*	H	α-helix	trans	-60	-44.4	176.7	-69.9	171.9	178.2	0	0	111.8	V57 L63 E64 G65	V57-E61 WeakPolarHBondContact CG1-OE1 3.47Å; V57-E61 WeakPolarHBondContact O-CG 3.45Å; V57-E61 PolarHBondContact O-N 3.45Å; E61-L63 VanDerWaalsContact C-N 3.35Å; E61-L63 PolarHBondContact O-N 3.1Å; E61-E64 PolarHBondContact O-N 3Å; E61-G65 PolarHBondContact O-N 3.26Å
62	Q	97.6	Very high	93.7	Very high	133 Å²	133	109.6 Å²	109.6	62%	0.621	54%	0.544	S	S	*	.	H	α-helix	trans	-63.3	-41.2	178.1	-175	70.6	-20.7	0	0	112	G58 W59 A60 G65 R66	G58-Q62 WeakPolarHBondContact O-CB 3.35Å; G58-Q62 PolarHBondContact O-N 3.01Å; W59-Q62 PolarHBondContact O-N 3.26Å; A60-Q62 PolarHBondContact O-N 3.14Å; Q62-G65 PolarHBondContact O-N 3.27Å; Q62-R66 WeakPolarHBondContact O-CG 3.37Å; Q62-R66 PolarHBondContact O-N 2.74Å
63	L	96.9	Very high	92.1	Very high	86 Å²	86	111.9 Å²	111.9	45%	0.45	56%	0.564	S	S	.	*	H	α-helix	trans	-67.1	-40.3	176.1	-74.2	174.2	0	0	0	111.8	W59 A60 E61 G65 R66 N67	W59-L63 WeakPolarHBondContact O-CB 3.44Å; W59-L63 WeakPolarHBondContact O-CG 2.8Å; W59-L63 PolarHBondContact O-N 2.87Å; A60-L63 PolarHBondContact O-N 3.14Å; E61-L63 VanDerWaalsContact C-N 3.35Å; E61-L63 PolarHBondContact O-N 3.1Å; L63-G65 VanDerWaalsContact C-N 3.35Å; L63-R66 PolarHBondContact O-N 3.4Å; L63-N67 WeakPolarHBondContact O-CB 3.34Å; L63-N67 PolarHBondContact O-N 3.39Å
64	E	96.3	Very high	90.4	Very high	103 Å²	103	109.9 Å²	109.9	48%	0.481	57%	0.57	S	S	.	*	H	α-helix	trans	-62	-43.8	175.2	-167.5	-174.4	168.9	0	0	111.3	A60 E61 R66 N67 K68	A60-E64 WeakPolarHBondContact O-CB 3.22Å; A60-E64 PolarHBondContact O-N 3.49Å; E61-E64 PolarHBondContact O-N 3Å; E64-R66 PolarHBondContact O-N 3.15Å; E64-N67 PolarHBondContact O-N 3.42Å; E64-K68 HydrophobicContact CG-CD 4.41Å; E64-K68 WeakPolarHBondContact O-CG 3.24Å; E64-K68 PolarHBondContact O-N 3.39Å; E64-K68 WeakPolarHBondContact OE1-CE 3.14Å; E64-K68 IonicContact OE1-NZ 2.68Å; E64-K68 PolarHBondContact OE1-NZ 2.99Å
65	G	95.1	Very high	88.1	Confident	31 Å²	31	113.4 Å²	113.4	32%	0.32	58%	0.578	S	S	.	*	H	α-helix	trans	-57.8	-47.1	174.4	0	0	0	0	0	112.4	E61 Q62 L63 K68 M69	E61-G65 PolarHBondContact O-N 3.26Å; Q62-G65 PolarHBondContact O-N 3.27Å; L63-G65 VanDerWaalsContact C-N 3.35Å; G65-K68 PolarHBondContact O-N 3.48Å; G65-M69 WeakPolarHBondContact O-CG 3.37Å; G65-M69 PolarHBondContact O-N 3.21Å; G65-M69 VanDerWaalsContact O-N 3.1Å
66	R	95.4	Very high	85.7	Confident	151 Å²	151	113.4 Å²	113.4	57%	0.57	59%	0.586	S	S	*	*	H	α-helix	trans	-62.5	-43.6	176	-71.2	177.1	67.8	-176	1.5	112.4	Q62 L63 E64 K68 M69 L70	Q62-R66 WeakPolarHBondContact O-CG 3.37Å; Q62-R66 PolarHBondContact O-N 2.74Å; L63-R66 PolarHBondContact O-N 3.4Å; E64-R66 PolarHBondContact O-N 3.15Å; R66-K68 VanDerWaalsContact C-N 3.33Å; R66-K68 PolarHBondContact O-N 3.47Å; R66-M69 PolarHBondContact O-N 2.91Å; R66-L70 WeakPolarHBondContact O-CG 3.44Å; R66-L70 PolarHBondContact O-N 3.48Å
67	N	94.9	Very high	83.6	Confident	90 Å²	90	111.8 Å²	111.8	48%	0.481	60%	0.596	S	S	.	*	H	α-helix	trans	-63	-39.7	178	-82.6	-7.9	0	0	0	112	L63 E64 M69 L70 Q71	L63-N67 WeakPolarHBondContact O-CB 3.34Å; L63-N67 PolarHBondContact O-N 3.39Å; E64-N67 PolarHBondContact O-N 3.42Å; N67-M69 VanDerWaalsContact C-N 3.35Å; N67-L70 PolarHBondContact O-N 3.11Å; N67-Q71 WeakPolarHBondContact O-CB 3.43Å; N67-Q71 WeakPolarHBondContact O-CG 3.47Å; N67-Q71 PolarHBondContact O-N 3.34Å
68	K	93.6	Very high	81.5	Confident	128 Å²	128	116.2 Å²	116.2	56%	0.557	62%	0.617	S	S	*	*	H	α-helix	trans	-63.1	-40.1	174.9	-73.8	172	-179.1	166.2	0	112	E64 G65 R66 Q71 G72	E64-K68 HydrophobicContact CG-CD 4.41Å; E64-K68 WeakPolarHBondContact O-CG 3.24Å; E64-K68 PolarHBondContact O-N 3.39Å; E64-K68 WeakPolarHBondContact OE1-CE 3.14Å; E64-K68 IonicContact OE1-NZ 2.68Å; E64-K68 PolarHBondContact OE1-NZ 2.99Å; G65-K68 PolarHBondContact O-N 3.48Å; R66-K68 VanDerWaalsContact C-N 3.33Å; R66-K68 PolarHBondContact O-N 3.47Å; K68-Q71 PolarHBondContact O-N 3.15Å; K68-G72 PolarHBondContact O-N 3.39Å
69	M	89	Confident	78.8	Confident	160 Å²	160	117.6 Å²	117.6	79%	0.788	63%	0.631	S	S	*	*	H	α-helix	trans	-64.5	-38.9	176	-70	-179.6	71.1	0	0	112.6	G65 R66 N67	G65-M69 WeakPolarHBondContact O-CG 3.37Å; G65-M69 PolarHBondContact O-N 3.21Å; G65-M69 VanDerWaalsContact O-N 3.1Å; R66-M69 PolarHBondContact O-N 2.91Å; N67-M69 VanDerWaalsContact C-N 3.35Å
70	L	87.8	Confident	76.3	Confident	139 Å²	139	115.1 Å²	115.1	73%	0.728	64%	0.636	S	S	*	*	H	α-helix	trans	-73.5	-27.7	178	-68	172.1	0	0	0	113.2	R66 N67	R66-L70 WeakPolarHBondContact O-CG 3.44Å; R66-L70 PolarHBondContact O-N 3.48Å; N67-L70 PolarHBondContact O-N 3.11Å
71	Q	82.9	Confident	73.8	Confident	169 Å²	169	118.3 Å²	118.3	79%	0.79	65%	0.652	S	S	*	*	H	α-helix	trans	-92.3	-9.5	176.9	-69.8	-164.6	76.1	0	0	113.9	N67 K68	N67-Q71 WeakPolarHBondContact O-CB 3.43Å; N67-Q71 WeakPolarHBondContact O-CG 3.47Å; N67-Q71 PolarHBondContact O-N 3.34Å; K68-Q71 PolarHBondContact O-N 3.15Å
72	G	69.9	Low	71.9	Confident	29 Å²	29	120.6 Å²	120.6	30%	0.299	66%	0.663	S	S	.	*	S	Bend	trans	-58.7	153.6	167.4	0	0	0	0	0	110.1	K68 G74	K68-G72 PolarHBondContact O-N 3.39Å; G72-G74 PolarHBondContact O-N 2.73Å
73	P	62.6	Low	69.5	Low	127 Å²	127	120.8 Å²	120.8	83%	0.825	67%	0.672	S	S	*	*			trans	-55.4	115	-179	23.2	-30.9	0	0	0	107.5	R75	P73-R75 VanDerWaalsContact C-N 3.3Å; P73-R75 PolarHBondContact O-N 2.93Å
74	G	57.7	Low	67.4	Low	69 Å²	69	120.1 Å²	120.1	71%	0.711	68%	0.679	S	S	*	*			trans	-54.2	103	172	0	0	0	0	0	106.5	G72 C76	G72-G74 PolarHBondContact O-N 2.73Å; G74-C76 PolarHBondContact O-N 2.85Å
75	R	47.1	Very low	65.5	Low	241 Å²	241	123.3 Å²	123.3	91%	0.909	69%	0.694	S	S	*	*			trans	-68	86.8	157.6	-80.9	-162.3	-103.6	-113.1	2.5	104.7	P73 P77	P73-R75 VanDerWaalsContact C-N 3.3Å; P73-R75 PolarHBondContact O-N 2.93Å; R75-P77 VanDerWaalsContact O-CD 3.25Å; R75-P77 WeakPolarHBondContact O-CD 3.48Å
76	C	47.9	Very low	63.3	Low	100 Å²	100	126.8 Å²	126.8	68%	0.676	71%	0.711	S	S	*	*			trans	-53.8	117.4	143.7	-62.9	0	0	0	0	105.1	G74 D78	G74-C76 PolarHBondContact O-N 2.85Å; C76-D78 PolarHBondContact O-N 3.13Å
77	P	52.8	Low	61.3	Low	124 Å²	124	128 Å²	128	81%	0.805	73%	0.728	S	S	*	*			trans	-67.8	89.9	157.1	25.8	-21.4	0	0	0	105.7	R75 G79	R75-P77 VanDerWaalsContact O-CD 3.25Å; R75-P77 WeakPolarHBondContact O-CD 3.48Å; P77-G79 PolarHBondContact O-N 2.78Å
78	D	53.3	Low	59.4	Low	162 Å²	162	130.9 Å²	130.9	87%	0.866	74%	0.738	S	S	*	*			trans	-58.7	119.8	155.4	-91.2	-21.9	0	0	0	106.7	C76	C76-D78 PolarHBondContact O-N 3.13Å
79	G	40.3	Very low	57.6	Low	59 Å²	59	130.2 Å²	130.2	61%	0.608	75%	0.745	S	S	*	*			trans	124.5	82.1	176.7	0	0	0	0	0	111.8	P77 P81	P77-G79 PolarHBondContact O-N 2.78Å; G79-P81 VanDerWaalsContact O-CD 3.29Å; G79-P81 WeakPolarHBondContact O-CD 3.49Å
80	V	46	Very low	56.1	Low	134 Å²	134	130.2 Å²	130.2	81%	0.812	74%	0.741	S	S	*	*			trans	-66.7	122.2	150.2	173.9	0	0	0	0	106.9	E82	V80-E82 HydrophobicContact CG1-CB 4.34Å
81	P	44.7	Very low	54.5	Low	125 Å²	125	130.6 Å²	130.6	81%	0.812	74%	0.744	S	S	*	*			trans	-91.3	97.5	146.6	9.3	11.3	0	0	0	106.4	G79 V83	G79-P81 VanDerWaalsContact O-CD 3.29Å; G79-P81 WeakPolarHBondContact O-CD 3.49Å; P81-V83 PolarHBondContact O-N 3.33Å
82	E	58.5	Low	53.6	Low	173 Å²	173	131.7 Å²	131.7	81%	0.808	75%	0.746	S	S	*	*			trans	-49.1	113.1	149.9	174.4	-175.8	167.1	0	0	107.3	V80	V80-E82 HydrophobicContact CG1-CB 4.34Å
83	V	45.9	Very low	53	Low	136 Å²	136	139.5 Å²	139.5	82%	0.824	78%	0.777	S	S	*	*			trans	-166.3	126.4	138.1	162	0	0	0	0	107.4	P81	P81-V83 PolarHBondContact O-N 3.33Å
84	A	54	Low	52.7	Low	72 Å²	72	138 Å²	138	60%	0.595	78%	0.776	S	S	*	*			trans	-62.8	159.9	176.8	0	0	0	0	0	113
85	E	56.3	Low	52.6	Low	171 Å²	171	143.3 Å²	143.3	80%	0.799	81%	0.813	S	S	*	*				167.6	157.2	123.2	-87.6	-43.5	106.3	0	0	110.7
86	P	47.9	Very low	52.9	Low	104 Å²	104	138.5 Å²	138.5	68%	0.675	81%	0.808	S	S	*	*			trans	-105.2	166.5	-135.7	1.6	23	0	0	0	113.9	H88	P86-H88 PolarHBondContact O-N 3.39Å
87	L	53.8	Low	53.1	Low	177 Å²	177	140.5 Å²	140.5	93%	0.927	82%	0.815	S	S	*	*			trans	-28	124.9	165.5	-68.7	156.4	0	0	0	114.5
88	H	54.4	Low	53.2	Low	149 Å²	149	141.4 Å²	141.4	69%	0.69	82%	0.815	S	S	*	*			trans	-128.3	97.9	155.6	-165.9	-0.4	0	0	0	110.5	P86 K90	P86-H88 PolarHBondContact O-N 3.39Å; H88-K90 PolarHBondContact O-N 2.97Å
89	T	56.5	Low	53.2	Low	115 Å²	115	140.2 Å²	140.2	71%	0.706	81%	0.812	S	S	*	*			trans	-61.7	120.7	158.9	12.5	0	0	0	0	108.6
90	K	57.8	Low	54	Low	160 Å²	160	145.3 Å²	145.3	70%	0.696	83%	0.825	S	S	*	*			trans	-107.5	92.3	162.6	-93.1	179.5	175.4	169.6	0	108.4	H88 K92	H88-K90 PolarHBondContact O-N 2.97Å; K90-K92 PolarHBondContact O-N 2.94Å
91	D	54.3	Low	54.5	Low	147 Å²	147	146 Å²	146	79%	0.786	83%	0.826	S	S	*	*			trans	-57.1	119.9	153.2	-68.7	-42.7	0	0	0	107.8
92	K	63.3	Low	55.2	Low	191 Å²	191	147.5 Å²	147.5	83%	0.83	83%	0.827	S	S	*	*			trans	-111.4	98	164.2	-84.4	-170.4	171.5	-175.1	0	107.6	K90	K90-K92 PolarHBondContact O-N 2.94Å
93	M	56.7	Low	54.9	Low	193 Å²	193	145.5 Å²	145.5	95%	0.951	83%	0.828	S	S	*	*			trans	-59	135.1	154.9	-64.4	-176.9	-160.1	0	0	108.5
94	A	58.1	Low	55.7	Low	97 Å²	97	146.3 Å²	146.3	80%	0.802	83%	0.829	S	S	*	*			trans	-137.1	110.4	165.7	0	0	0	0	0	108.5
95	A	54.9	Low	55.8	Low	180 Å²	180	153.1 Å²	153.1	100%	1.488	85%	0.85	S	S	*	*			trans	31.2	0	156.9	0	0	0	0	0	119.8

Retrieved 95 of 95 residues in 557.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).