A0A096MUV5_PAPAN Loading...

Small VCP interacting protein

AlphaFold DB , UniProt , Accession A0A096MUV5, Species PAPAN (Papio anubis, Olive baboon), Gene SVIP, Length 77 aa.

						>A0A096MUV5_PAPAN|A0A096MUV5|SVIP
MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLKWTVS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50	Low	61.9	Low	244 Å²	244	134.5 Å²	134.5	100%	1.202	82%	0.821	S	S	*	*				0	81.7	0	-63.2	-70.3	178	0	0	107.6
2	G	63.9	Low	61.8	Low	81 Å²	81	130.1 Å²	130.1	84%	0.835	81%	0.809	S	S	*	*			trans	-96.7	112.5	-179.7	0	0	0	0	0	109.3	C4	G2-C4 PolarHBondContact O-N 2.95Å
3	L	65.9	Low	61.7	Low	156 Å²	156	127.3 Å²	127.3	82%	0.817	79%	0.794	S	S	*	*			trans	-74.2	103.3	176.2	-71.8	157.5	0	0	0	108.1	F5	L3-F5 PolarHBondContact O-N 2.95Å
4	C	68.6	Low	61.6	Low	126 Å²	126	126.8 Å²	126.8	85%	0.851	79%	0.793	S	S	*	*			trans	-74	106.6	170	-162.6	0	0	0	0	107.7	G2	G2-C4 PolarHBondContact O-N 2.95Å
5	F	68	Low	61.6	Low	173 Å²	173	126.2 Å²	126.2	76%	0.759	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-71.7	134.8	172.5	-83.8	-89	0	0	0	109.6	L3 C7	L3-F5 PolarHBondContact O-N 2.95Å; F5-C7 PolarHBondContact O-N 3.04Å
6	P	70.9	Confident	61.6	Low	119 Å²	119	122.3 Å²	122.3	77%	0.773	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-62.7	127.2	173.5	-19.4	31.4	0	0	0	110.5
7	C	66.2	Low	62	Low	99 Å²	99	120.4 Å²	120.4	67%	0.669	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-61.1	130.1	172.5	-81.4	0	0	0	0	110	F5 G9 E10	F5-C7 PolarHBondContact O-N 3.04Å; C7-G9 PolarHBondContact O-N 2.93Å; C7-E10 PolarHBondContact O-N 3.38Å
8	P	58	Low	62.5	Low	148 Å²	148	120.5 Å²	120.5	96%	0.961	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73	31.1	-177.1	29.4	-35	0	0	0	114.5
9	G	56.6	Low	62.9	Low	66 Å²	66	122.2 Å²	122.2	68%	0.68	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-136.4	3.6	178.4	0	0	0	0	0	113.9	C7 S11	C7-G9 PolarHBondContact O-N 2.93Å; G9-S11 PolarHBondContact O-N 3.14Å
10	E	55.5	Low	63.5	Low	163 Å²	163	122.5 Å²	122.5	76%	0.762	73%	0.734	S	S	*	*			trans	-78.7	78.5	173.4	-160.4	117.3	131.6	0	0	108.3	C7 A12	C7-E10 PolarHBondContact O-N 3.38Å; E10-A12 PolarHBondContact O-N 3.27Å
11	S	57.7	Low	64.1	Low	104 Å²	104	120.8 Å²	120.8	73%	0.727	72%	0.717	S	S	*	*			trans	-58.9	113.6	159.7	67.6	0	0	0	0	105.6	G9 P13	G9-S11 PolarHBondContact O-N 3.14Å; S11-P13 WeakPolarHBondContact O-CD 3.06Å
12	A	59.7	Low	65.5	Low	82 Å²	82	118 Å²	118	68%	0.678	69%	0.693	S	S	*	*			trans	-48.4	120.3	177.1	0	0	0	0	0	106.9	E10	E10-A12 PolarHBondContact O-N 3.27Å
13	P	60.8	Low	66.3	Low	94 Å²	94	117.1 Å²	117.1	61%	0.61	68%	0.678	S	S	*	*			trans	-55	133.3	179.4	21.6	-31.3	0	0	0	106.3	S11 T15	S11-P13 WeakPolarHBondContact O-CD 3.06Å; P13-T15 PolarHBondContact O-N 3.04Å
14	P	61.1	Low	67.1	Low	120 Å²	120	117.2 Å²	117.2	78%	0.779	67%	0.671	S	S	*	*			trans	-50.2	111.8	-177.2	21.1	-32.5	0	0	0	106.2	P16	P14-P16 WeakPolarHBondContact O-CD 3.41Å
15	T	61.2	Low	67.9	Low	118 Å²	118	117.1 Å²	117.1	72%	0.724	66%	0.662	S	S	*	*			trans	-54.8	109.6	-169.8	34.8	0	0	0	0	106.2	P13 D17	P13-T15 PolarHBondContact O-N 3.04Å; T15-D17 PolarHBondContact O-N 3.21Å
16	P	61.9	Low	68.7	Low	63 Å²	63	111.8 Å²	111.8	41%	0.409	65%	0.65	S	S	.	*			trans	-57.2	135.5	-178.9	-12.8	18.1	0	0	0	106.4	P14 L18 K21	P14-P16 WeakPolarHBondContact O-CD 3.41Å; P16-L18 PolarHBondContact O-N 3.08Å; P16-K21 HydrophobicContact CB-CG 4.16Å; P16-K21 VanDerWaalsContact CG-CE 3.43Å; P16-K21 WeakPolarHBondContact O-CE 3.4Å; P16-K21 PolarHBondContact O-NZ 2.85Å
17	D	67.9	Low	69.3	Low	91 Å²	91	112.4 Å²	112.4	49%	0.487	64%	0.642	S	S	.	*			trans	-47.8	135.1	-176.4	-174.8	86.1	0	0	0	109.1	T15 E19 E20 K21	T15-D17 PolarHBondContact O-N 3.21Å; D17-E19 PolarHBondContact O-N 3.47Å; D17-E19 VanDerWaalsContact O-N 3.08Å; D17-E19 WeakPolarHBondContact OD2-CB 3.29Å; D17-E19 WeakPolarHBondContact OD2-CG 3.3Å; D17-E19 PolarHBondContact OD2-N 3.13Å; D17-E20 HydrophobicContact CB-CG 4.18Å; D17-E20 PolarHBondContact O-N 2.88Å; D17-K21 PolarHBondContact O-N 2.96Å
18	L	70.6	Confident	70.3	Confident	122 Å²	122	109.2 Å²	109.2	64%	0.639	62%	0.623	S	S	*	*	H	α-helix	trans	-59.5	-25.4	-172.6	-67.4	175.7	0	0	0	111.5	P16 R22	P16-L18 PolarHBondContact O-N 3.08Å; L18-R22 WeakPolarHBondContact O-CG 3.23Å; L18-R22 PolarHBondContact O-N 3.25Å
19	E	71.2	Confident	71.7	Confident	153 Å²	153	104.3 Å²	104.3	72%	0.715	60%	0.595	S	S	*	*	H	α-helix	trans	-69.3	-43.6	173.7	-61	-150.8	100.1	0	0	112.2	D17 K21 R22 A23	D17-E19 PolarHBondContact O-N 3.47Å; D17-E19 VanDerWaalsContact O-N 3.08Å; D17-E19 WeakPolarHBondContact OD2-CB 3.29Å; D17-E19 WeakPolarHBondContact OD2-CG 3.3Å; D17-E19 PolarHBondContact OD2-N 3.13Å; E19-K21 VanDerWaalsContact C-N 3.3Å; E19-K21 PolarHBondContact O-N 3.27Å; E19-R22 PolarHBondContact O-N 3.07Å; E19-R22 VanDerWaalsContact O-N 3.15Å; E19-A23 WeakPolarHBondContact O-CB 3.45Å; E19-A23 PolarHBondContact O-N 2.94Å
20	E	74.6	Confident	72.9	Confident	128 Å²	128	105.8 Å²	105.8	60%	0.598	58%	0.584	S	S	*	*	H	α-helix	trans	-63.2	-37.9	179.5	-66.3	-178.2	166.9	0	0	112	D17 A23 K24	D17-E20 HydrophobicContact CB-CG 4.18Å; D17-E20 PolarHBondContact O-N 2.88Å; E20-A23 PolarHBondContact O-N 3.1Å; E20-K24 VanDerWaalsContact O-CB 3.31Å; E20-K24 WeakPolarHBondContact O-CB 3.12Å; E20-K24 PolarHBondContact O-N 3.37Å
21	K	75.6	Confident	74.3	Confident	86 Å²	86	105.6 Å²	105.6	37%	0.374	58%	0.576	S	S	.	*	H	α-helix	trans	-64.4	-43.3	174.7	-70	177.8	-179.2	163.7	0	111.6	P16 D17 E19 L25	P16-K21 HydrophobicContact CB-CG 4.16Å; P16-K21 VanDerWaalsContact CG-CE 3.43Å; P16-K21 WeakPolarHBondContact O-CE 3.4Å; P16-K21 PolarHBondContact O-NZ 2.85Å; D17-K21 PolarHBondContact O-N 2.96Å; E19-K21 VanDerWaalsContact C-N 3.3Å; E19-K21 PolarHBondContact O-N 3.27Å; K21-L25 WeakPolarHBondContact O-CB 3.35Å; K21-L25 WeakPolarHBondContact O-CG 3.48Å; K21-L25 PolarHBondContact O-N 2.94Å
22	R	79.6	Confident	75.5	Confident	187 Å²	187	108.7 Å²	108.7	71%	0.706	57%	0.572	S	S	*	*	H	α-helix	trans	-64.8	-44.1	176.9	-74	176.3	-176.4	-174.6	3.1	111.1	L18 E19 L25 A26	L18-R22 WeakPolarHBondContact O-CG 3.23Å; L18-R22 PolarHBondContact O-N 3.25Å; E19-R22 PolarHBondContact O-N 3.07Å; E19-R22 VanDerWaalsContact O-N 3.15Å; R22-L25 PolarHBondContact O-N 3.33Å; R22-A26 WeakPolarHBondContact O-CB 2.9Å; R22-A26 PolarHBondContact O-N 2.94Å
23	A	80.8	Confident	76.5	Confident	62 Å²	62	111.6 Å²	111.6	51%	0.512	57%	0.572	S	S	.	*	H	α-helix	trans	-59.7	-47.7	177.2	0	0	0	0	0	111.5	E19 E20 L25 A26 E27	E19-A23 WeakPolarHBondContact O-CB 3.45Å; E19-A23 PolarHBondContact O-N 2.94Å; E20-A23 PolarHBondContact O-N 3.1Å; A23-L25 VanDerWaalsContact C-N 3.34Å; A23-L25 PolarHBondContact O-N 2.81Å; A23-A26 PolarHBondContact O-N 3.3Å; A23-E27 WeakPolarHBondContact O-CB 3.33Å; A23-E27 PolarHBondContact O-N 3.46Å
24	K	82.6	Confident	77.4	Confident	158 Å²	158	113.1 Å²	113.1	69%	0.687	57%	0.569	S	S	*	*	H	α-helix	trans	-65.5	-35.7	179.7	-166.5	169.7	-173.6	172.2	0	113	E20 A28	E20-K24 VanDerWaalsContact O-CB 3.31Å; E20-K24 WeakPolarHBondContact O-CB 3.12Å; E20-K24 PolarHBondContact O-N 3.37Å; K24-A28 VanDerWaalsContact O-CB 3.27Å; K24-A28 WeakPolarHBondContact O-CB 3.35Å; K24-A28 PolarHBondContact O-N 3.2Å
25	L	84.9	Confident	78.3	Confident	124 Å²	124	112 Å²	112	65%	0.649	55%	0.553	S	S	*	*	H	α-helix	trans	-68.9	-40.6	174	-72.1	171.7	0	0	0	111.9	K21 R22 A23 A28 A29	K21-L25 WeakPolarHBondContact O-CB 3.35Å; K21-L25 WeakPolarHBondContact O-CG 3.48Å; K21-L25 PolarHBondContact O-N 2.94Å; R22-L25 PolarHBondContact O-N 3.33Å; A23-L25 VanDerWaalsContact C-N 3.34Å; A23-L25 PolarHBondContact O-N 2.81Å; L25-A28 PolarHBondContact O-N 3.41Å; L25-A29 WeakPolarHBondContact O-CB 3.43Å; L25-A29 PolarHBondContact O-N 3.34Å
26	A	84.6	Confident	79.2	Confident	61 Å²	61	109.8 Å²	109.8	50%	0.504	55%	0.546	S	S	.	.	H	α-helix	trans	-63.2	-45.8	175.2	0	0	0	0	0	111.3	R22 A23 A28 A29 E30	R22-A26 WeakPolarHBondContact O-CB 2.9Å; R22-A26 PolarHBondContact O-N 2.94Å; A23-A26 PolarHBondContact O-N 3.3Å; A26-A28 PolarHBondContact O-N 2.9Å; A26-A29 PolarHBondContact O-N 2.86Å; A26-E30 WeakPolarHBondContact O-CB 3.47Å; A26-E30 PolarHBondContact O-N 3.04Å
27	E	83.6	Confident	79.9	Confident	131 Å²	131	109.2 Å²	109.2	61%	0.612	55%	0.547	S	S	*	.	H	α-helix	trans	-61.4	-44.1	176.2	-170.3	-167.8	117.1	0	0	111.5	A23 A29 E30 R31	A23-E27 WeakPolarHBondContact O-CB 3.33Å; A23-E27 PolarHBondContact O-N 3.46Å; E27-A29 VanDerWaalsContact C-N 3.32Å; E27-A29 PolarHBondContact O-N 3.36Å; E27-E30 PolarHBondContact O-N 3.46Å; E27-R31 WeakPolarHBondContact O-CB 3.29Å; E27-R31 PolarHBondContact O-N 2.97Å
28	A	88.1	Confident	80.1	Confident	33 Å²	33	108 Å²	108	27%	0.273	55%	0.546	S	S	.	.	H	α-helix	trans	-64	-36.3	176.3	0	0	0	0	0	112.4	K24 L25 A26 R32	K24-A28 VanDerWaalsContact O-CB 3.27Å; K24-A28 WeakPolarHBondContact O-CB 3.35Å; K24-A28 PolarHBondContact O-N 3.2Å; L25-A28 PolarHBondContact O-N 3.41Å; A26-A28 PolarHBondContact O-N 2.9Å; A28-R32 WeakPolarHBondContact O-CG 3.37Å; A28-R32 PolarHBondContact O-N 2.65Å
29	A	87.1	Confident	80.4	Confident	44 Å²	44	112.8 Å²	112.8	36%	0.364	56%	0.556	S	S	.	*	H	α-helix	trans	-67.9	-44.7	175.2	0	0	0	0	0	111.5	L25 A26 E27 R31 R32 Q33	L25-A29 WeakPolarHBondContact O-CB 3.43Å; L25-A29 PolarHBondContact O-N 3.34Å; A26-A29 PolarHBondContact O-N 2.86Å; E27-A29 VanDerWaalsContact C-N 3.32Å; E27-A29 PolarHBondContact O-N 3.36Å; A29-R31 VanDerWaalsContact C-N 3.33Å; A29-R31 PolarHBondContact O-N 3.38Å; A29-R32 PolarHBondContact O-N 2.88Å; A29-Q33 WeakPolarHBondContact O-CG 3.36Å; A29-Q33 PolarHBondContact O-N 3.43Å
30	E	81.8	Confident	80.5	Confident	98 Å²	98	109.5 Å²	109.5	46%	0.458	56%	0.562	S	S	.	*	H	α-helix	trans	-62.1	-41.8	177.9	-170.6	-176.9	154.2	0	0	111.4	A26 E27 Q33 K34	A26-E30 WeakPolarHBondContact O-CB 3.47Å; A26-E30 PolarHBondContact O-N 3.04Å; E27-E30 PolarHBondContact O-N 3.46Å; E30-Q33 PolarHBondContact O-N 3.2Å; E30-K34 HydrophobicContact CG-CD 4.32Å; E30-K34 WeakPolarHBondContact O-CG 3.37Å; E30-K34 PolarHBondContact O-N 3.31Å; E30-K34 WeakPolarHBondContact OE1-CE 3.24Å; E30-K34 IonicContact OE1-NZ 3.66Å; E30-K34 PolarHBondContact OE1-NZ 3.27Å
31	R	84.3	Confident	80.6	Confident	158 Å²	158	106 Å²	106	60%	0.596	55%	0.547	S	S	*	.	H	α-helix	trans	-61.6	-45.9	176.8	-172.5	172.4	176.1	158.9	-0	111.9	E27 A29 Q33 K34 E35	E27-R31 WeakPolarHBondContact O-CB 3.29Å; E27-R31 PolarHBondContact O-N 2.97Å; A29-R31 VanDerWaalsContact C-N 3.33Å; A29-R31 PolarHBondContact O-N 3.38Å; R31-Q33 VanDerWaalsContact C-N 3.32Å; R31-Q33 PolarHBondContact O-N 3.19Å; R31-K34 PolarHBondContact O-N 2.93Å; R31-E35 IonicContact NE-OE1 2.67Å; R31-E35 WeakPolarHBondContact O-CB 3.14Å; R31-E35 WeakPolarHBondContact O-CG 3.48Å; R31-E35 PolarHBondContact O-N 2.9Å
32	R	83.8	Confident	80.5	Confident	169 Å²	169	110.7 Å²	110.7	64%	0.638	58%	0.575	S	S	*	*	H	α-helix	trans	-61.6	-39.6	175.2	-72.1	179.9	-170.3	123.9	-2	112.1	A28 A29 A36	A28-R32 WeakPolarHBondContact O-CG 3.37Å; A28-R32 PolarHBondContact O-N 2.65Å; A29-R32 PolarHBondContact O-N 2.88Å; R32-A36 VanDerWaalsContact O-CB 3.24Å; R32-A36 WeakPolarHBondContact O-CB 3.23Å; R32-A36 PolarHBondContact O-N 3.25Å
33	Q	80.4	Confident	80.5	Confident	144 Å²	144	105.3 Å²	105.3	67%	0.673	56%	0.561	S	S	*	*	H	α-helix	trans	-65.6	-42.9	176.5	-74.7	-173.2	-5.8	0	0	112	A29 E30 R31 A36 A37	A29-Q33 WeakPolarHBondContact O-CG 3.36Å; A29-Q33 PolarHBondContact O-N 3.43Å; E30-Q33 PolarHBondContact O-N 3.2Å; R31-Q33 VanDerWaalsContact C-N 3.32Å; R31-Q33 PolarHBondContact O-N 3.19Å; Q33-A36 PolarHBondContact O-N 2.97Å; Q33-A37 WeakPolarHBondContact O-CB 3.4Å; Q33-A37 PolarHBondContact O-N 2.89Å
34	K	80.1	Confident	80.3	Confident	126 Å²	126	106.1 Å²	106.1	55%	0.548	56%	0.559	S	S	.	*	H	α-helix	trans	-63.1	-44.9	176.6	-74.5	173.3	179.6	170.8	0	111.8	E30 R31 A37 S38	E30-K34 HydrophobicContact CG-CD 4.32Å; E30-K34 WeakPolarHBondContact O-CG 3.37Å; E30-K34 PolarHBondContact O-N 3.31Å; E30-K34 WeakPolarHBondContact OE1-CE 3.24Å; E30-K34 IonicContact OE1-NZ 3.66Å; E30-K34 PolarHBondContact OE1-NZ 3.27Å; R31-K34 PolarHBondContact O-N 2.93Å; K34-A37 PolarHBondContact O-N 3.42Å; K34-S38 WeakPolarHBondContact O-CB 3.28Å; K34-S38 PolarHBondContact O-N 3.15Å; K34-S38 PolarHBondContact O-OG 2.84Å; K34-S38 VanDerWaalsContact O-OG 3.07Å
35	E	79.4	Confident	80.2	Confident	96 Å²	96	104.8 Å²	104.8	45%	0.449	56%	0.555	S	S	.	*	H	α-helix	trans	-65.1	-42.4	176.8	-71.7	171.1	151.5	0	0	111.4	R31 A37 S38 R39	R31-E35 IonicContact NE-OE1 2.67Å; R31-E35 WeakPolarHBondContact O-CB 3.14Å; R31-E35 WeakPolarHBondContact O-CG 3.48Å; R31-E35 PolarHBondContact O-N 2.9Å; E35-A37 VanDerWaalsContact C-N 3.34Å; E35-S38 PolarHBondContact O-N 3.43Å; E35-S38 PolarHBondContact O-OG 3.39Å; E35-R39 WeakPolarHBondContact O-CB 3.47Å; E35-R39 PolarHBondContact O-N 3.17Å
36	A	80.6	Confident	79.9	Confident	71 Å²	71	100.6 Å²	100.6	59%	0.587	54%	0.537	S	S	*	.	H	α-helix	trans	-65.4	-38.1	174.5	0	0	0	0	0	112.2	R32 Q33 S38	R32-A36 VanDerWaalsContact O-CB 3.24Å; R32-A36 WeakPolarHBondContact O-CB 3.23Å; R32-A36 PolarHBondContact O-N 3.25Å; Q33-A36 PolarHBondContact O-N 2.97Å; A36-S38 VanDerWaalsContact C-N 3.33Å
37	A	76.2	Confident	79.7	Confident	52 Å²	52	99.8 Å²	99.8	43%	0.43	53%	0.525	S	S	.	.	H	α-helix	trans	-71.5	-26.6	178.5	0	0	0	0	0	112.7	Q33 K34 E35 I41	Q33-A37 WeakPolarHBondContact O-CB 3.4Å; Q33-A37 PolarHBondContact O-N 2.89Å; K34-A37 PolarHBondContact O-N 3.42Å; E35-A37 VanDerWaalsContact C-N 3.34Å; A37-I41 WeakPolarHBondContact O-CD1 3.42Å
38	S	73.4	Confident	79.7	Confident	65 Å²	65	98.1 Å²	98.1	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-96	-21.5	178	65.9	0	0	0	0	113.6	K34 E35 A36 G40 I41	K34-S38 WeakPolarHBondContact O-CB 3.28Å; K34-S38 PolarHBondContact O-N 3.15Å; K34-S38 PolarHBondContact O-OG 2.84Å; K34-S38 VanDerWaalsContact O-OG 3.07Å; E35-S38 PolarHBondContact O-N 3.43Å; E35-S38 PolarHBondContact O-OG 3.39Å; A36-S38 VanDerWaalsContact C-N 3.33Å; S38-G40 PolarHBondContact O-N 2.81Å; S38-I41 PolarHBondContact O-N 2.98Å; S38-I41 VanDerWaalsContact O-N 3.14Å
39	R	75.4	Confident	79.5	Confident	223 Å²	223	103.1 Å²	103.1	84%	0.842	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.2	122.9	-178.5	-175.3	171.4	-177.3	167.8	0.8	111	E35 I41	E35-R39 WeakPolarHBondContact O-CB 3.47Å; E35-R39 PolarHBondContact O-N 3.17Å; R39-I41 VanDerWaalsContact C-N 3.32Å
40	G	73.3	Confident	79.4	Confident	83 Å²	83	107.7 Å²	107.7	86%	0.856	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.2	4.8	179.8	0	0	0	0	0	114.7	S38	S38-G40 PolarHBondContact O-N 2.81Å
41	I	77	Confident	79.6	Confident	55 Å²	55	110.7 Å²	110.7	28%	0.282	55%	0.554	S	S	.	*			trans	-86.9	112.3	171.2	-61.3	-176.2	0	0	0	108.9	A37 S38 R39 D43 V44 V47	A37-I41 WeakPolarHBondContact O-CD1 3.42Å; S38-I41 PolarHBondContact O-N 2.98Å; S38-I41 VanDerWaalsContact O-N 3.14Å; R39-I41 VanDerWaalsContact C-N 3.32Å; I41-D43 VanDerWaalsContact CG2-C 3.45Å; I41-D43 VanDerWaalsContact CG2-O 3.3Å; I41-D43 WeakPolarHBondContact CG2-O 3.37Å; I41-V44 HydrophobicContact CG2-CG2 4.18Å; I41-V47 HydrophobicContact CD1-CG1 4.28Å; I41-V47 HydrophobicContact CD1-CG2 4.17Å; I41-V47 HydrophobicContact CG2-CG2 3.77Å
42	L	74.7	Confident	79.7	Confident	184 Å²	184	109.2 Å²	109.2	96%	0.963	55%	0.552	S	S	*	*	S	Bend	trans	-69.2	-38	176.7	-172.4	69.9	0	0	0	112.2
43	D	78.7	Confident	79.9	Confident	74 Å²	74	108.1 Å²	108.1	40%	0.396	55%	0.552	S	S	.	*			trans	-133.3	109.2	177	174.3	28.3	0	0	0	111.7	I41 Q45 S46	I41-D43 VanDerWaalsContact CG2-C 3.45Å; I41-D43 VanDerWaalsContact CG2-O 3.3Å; I41-D43 WeakPolarHBondContact CG2-O 3.37Å; D43-Q45 VanDerWaalsContact C-N 3.3Å; D43-Q45 PolarHBondContact O-N 3.2Å; D43-Q45 WeakPolarHBondContact OD1-CB 3.27Å; D43-Q45 PolarHBondContact OD1-N 3.49Å; D43-S46 PolarHBondContact O-OG 2.97Å; D43-S46 WeakPolarHBondContact OD2-CB 3.31Å; D43-S46 PolarHBondContact OD2-N 2.91Å; D43-S46 PolarHBondContact OD2-OG 2.92Å; D43-S46 VanDerWaalsContact OD2-OG 3.08Å
44	V	76.6	Confident	80	Confident	80 Å²	80	108.7 Å²	108.7	49%	0.485	55%	0.552	S	S	.	*	H	α-helix	trans	-69.4	-29	-179.5	-178.4	0	0	0	0	111.6	I41 Q48	I41-V44 HydrophobicContact CG2-CG2 4.18Å; V44-Q48 VanDerWaalsContact O-CG 3.29Å; V44-Q48 WeakPolarHBondContact O-CG 3.45Å; V44-Q48 PolarHBondContact O-N 3.43Å; V44-Q48 VanDerWaalsContact O-N 3.13Å
45	Q	80.8	Confident	80.3	Confident	130 Å²	130	107.5 Å²	107.5	61%	0.607	55%	0.548	S	S	*	.	H	α-helix	trans	-69.9	-48.1	-178.9	-66.3	-64.9	-34.2	0	0	110.9	D43 V47 Q48 E49	D43-Q45 VanDerWaalsContact C-N 3.3Å; D43-Q45 PolarHBondContact O-N 3.2Å; D43-Q45 WeakPolarHBondContact OD1-CB 3.27Å; D43-Q45 PolarHBondContact OD1-N 3.49Å; Q45-V47 PolarHBondContact O-N 3.33Å; Q45-Q48 WeakPolarHBondContact O-CB 3.42Å; Q45-Q48 PolarHBondContact O-N 2.92Å; Q45-Q48 VanDerWaalsContact O-N 3.1Å; Q45-E49 WeakPolarHBondContact O-CG 3.27Å; Q45-E49 PolarHBondContact O-N 3.47Å
46	S	78.9	Confident	80.6	Confident	36 Å²	36	109.5 Å²	109.5	25%	0.252	56%	0.556	S	S	.	*	H	α-helix	trans	-59.3	-33.7	177.2	65.7	0	0	0	0	113.4	D43 K50	D43-S46 PolarHBondContact O-OG 2.97Å; D43-S46 WeakPolarHBondContact OD2-CB 3.31Å; D43-S46 PolarHBondContact OD2-N 2.91Å; D43-S46 PolarHBondContact OD2-OG 2.92Å; D43-S46 VanDerWaalsContact OD2-OG 3.08Å; S46-K50 WeakPolarHBondContact O-CB 3.5Å; S46-K50 VanDerWaalsContact O-CG 3.23Å; S46-K50 WeakPolarHBondContact O-CG 3.27Å; S46-K50 PolarHBondContact O-N 3.44Å
47	V	80.2	Confident	80.7	Confident	43 Å²	43	110.2 Å²	110.2	26%	0.261	55%	0.548	S	S	.	.	H	α-helix	trans	-70.2	-42.3	176.6	175.3	0	0	0	0	111	I41 Q45 K50 R51	I41-V47 HydrophobicContact CD1-CG1 4.28Å; I41-V47 HydrophobicContact CD1-CG2 4.17Å; I41-V47 HydrophobicContact CG2-CG2 3.77Å; Q45-V47 PolarHBondContact O-N 3.33Å; V47-K50 PolarHBondContact O-N 3.45Å; V47-R51 WeakPolarHBondContact O-CB 3.38Å; V47-R51 WeakPolarHBondContact O-CG 3.46Å; V47-R51 PolarHBondContact O-N 2.83Å
48	Q	82.9	Confident	81	Confident	97 Å²	97	114.4 Å²	114.4	45%	0.453	56%	0.559	S	S	.	*	H	α-helix	trans	-60.4	-45.6	173.2	-73	-97.4	28.2	0	0	111.4	V44 Q45 R51 K52	V44-Q48 VanDerWaalsContact O-CG 3.29Å; V44-Q48 WeakPolarHBondContact O-CG 3.45Å; V44-Q48 PolarHBondContact O-N 3.43Å; V44-Q48 VanDerWaalsContact O-N 3.13Å; Q45-Q48 WeakPolarHBondContact O-CB 3.42Å; Q45-Q48 PolarHBondContact O-N 2.92Å; Q45-Q48 VanDerWaalsContact O-N 3.1Å; Q48-R51 PolarHBondContact O-N 3.45Å; Q48-K52 WeakPolarHBondContact O-CG 3.42Å; Q48-K52 PolarHBondContact O-N 3.25Å
49	E	84.6	Confident	81.5	Confident	138 Å²	138	116.9 Å²	116.9	65%	0.645	56%	0.562	S	S	*	*	H	α-helix	trans	-64.3	-43.4	178.4	-69.5	-155.8	110.8	0	0	112.3	Q45 R51 K52 K53	Q45-E49 WeakPolarHBondContact O-CG 3.27Å; Q45-E49 PolarHBondContact O-N 3.47Å; E49-R51 VanDerWaalsContact C-N 3.34Å; E49-R51 PolarHBondContact O-N 2.78Å; E49-K52 PolarHBondContact O-N 3.47Å; E49-K53 WeakPolarHBondContact O-CB 3.24Å; E49-K53 PolarHBondContact O-N 2.7Å
50	K	84.5	Confident	81.7	Confident	140 Å²	140	112.7 Å²	112.7	61%	0.609	55%	0.552	S	S	*	*	H	α-helix	trans	-61.7	-41.2	174.6	-76	172	-177.5	172.8	0	111.7	S46 V47 K53 K54	S46-K50 WeakPolarHBondContact O-CB 3.5Å; S46-K50 VanDerWaalsContact O-CG 3.23Å; S46-K50 WeakPolarHBondContact O-CG 3.27Å; S46-K50 PolarHBondContact O-N 3.44Å; V47-K50 PolarHBondContact O-N 3.45Å; K50-K53 PolarHBondContact O-N 2.89Å; K50-K54 WeakPolarHBondContact O-CG 3.22Å; K50-K54 PolarHBondContact O-N 3.44Å
51	R	85.1	Confident	81.8	Confident	161 Å²	161	112.6 Å²	112.6	61%	0.608	53%	0.531	S	S	*	.	H	α-helix	trans	-62.6	-48.6	174.8	-76.5	179.9	-179.6	-161.3	1.3	111.4	V47 Q48 E49 K53 K54 E55	V47-R51 WeakPolarHBondContact O-CB 3.38Å; V47-R51 WeakPolarHBondContact O-CG 3.46Å; V47-R51 PolarHBondContact O-N 2.83Å; Q48-R51 PolarHBondContact O-N 3.45Å; E49-R51 VanDerWaalsContact C-N 3.34Å; E49-R51 PolarHBondContact O-N 2.78Å; R51-K53 VanDerWaalsContact C-N 3.3Å; R51-K53 PolarHBondContact O-N 3.41Å; R51-K54 PolarHBondContact O-N 3Å; R51-E55 PolarHBondContact O-N 2.66Å
52	K	87	Confident	81.8	Confident	126 Å²	126	114 Å²	114	55%	0.548	55%	0.55	S	S	.	*	H	α-helix	trans	-58.8	-40.5	175.9	-73.8	175.8	-178.4	177.5	0	112.1	Q48 E49 K56	Q48-K52 WeakPolarHBondContact O-CG 3.42Å; Q48-K52 PolarHBondContact O-N 3.25Å; E49-K52 PolarHBondContact O-N 3.47Å; K52-K56 WeakPolarHBondContact O-CB 3.21Å; K52-K56 VanDerWaalsContact O-CG 3.28Å; K52-K56 WeakPolarHBondContact O-CG 3.02Å; K52-K56 PolarHBondContact O-N 3.04Å
53	K	87.5	Confident	81.7	Confident	147 Å²	147	111.2 Å²	111.2	64%	0.639	54%	0.541	S	S	*	.	H	α-helix	trans	-65.6	-44.1	176.9	-170.9	172.6	-177.7	176.1	0	111.6	E49 K50 R51 K56 I57	E49-K53 WeakPolarHBondContact O-CB 3.24Å; E49-K53 PolarHBondContact O-N 2.7Å; K50-K53 PolarHBondContact O-N 2.89Å; R51-K53 VanDerWaalsContact C-N 3.3Å; R51-K53 PolarHBondContact O-N 3.41Å; K53-K56 PolarHBondContact O-N 3.1Å; K53-I57 HydrophobicContact CG-CD1 4.11Å; K53-I57 VanDerWaalsContact O-CG1 3.29Å; K53-I57 WeakPolarHBondContact O-CG1 3.47Å; K53-I57 PolarHBondContact O-N 2.92Å
54	K	83.9	Confident	81.1	Confident	156 Å²	156	112 Å²	112	68%	0.678	55%	0.552	S	S	*	*	H	α-helix	trans	-60.8	-46.6	175	-74.8	-176.6	176.5	-165.9	0	111.9	K50 R51 K56 I57 E58	K50-K54 WeakPolarHBondContact O-CG 3.22Å; K50-K54 PolarHBondContact O-N 3.44Å; R51-K54 PolarHBondContact O-N 3Å; K54-K56 VanDerWaalsContact C-N 3.33Å; K54-K56 PolarHBondContact O-N 2.89Å; K54-I57 PolarHBondContact O-N 2.58Å; K54-I57 VanDerWaalsContact O-N 3.15Å; K54-E58 PolarHBondContact O-N 2.67Å
55	E	85.1	Confident	80.5	Confident	101 Å²	101	109.5 Å²	109.5	47%	0.472	54%	0.543	S	S	.	.	H	α-helix	trans	-62.7	-39.5	178.3	-169.9	-170	98.4	0	0	111.9	R51 I57 E58 K59	R51-E55 PolarHBondContact O-N 2.66Å; E55-I57 VanDerWaalsContact C-N 3.34Å; E55-I57 PolarHBondContact O-N 3.41Å; E55-E58 PolarHBondContact O-N 2.92Å; E55-K59 HydrophobicContact CG-CD 4.18Å; E55-K59 VanDerWaalsContact O-CB 3.31Å; E55-K59 WeakPolarHBondContact O-CB 3.41Å; E55-K59 VanDerWaalsContact O-CG 3.27Å; E55-K59 WeakPolarHBondContact O-CG 3.38Å; E55-K59 PolarHBondContact O-N 3.36Å; E55-K59 WeakPolarHBondContact OE1-CE 3.02Å; E55-K59 IonicContact OE1-NZ 2.58Å; E55-K59 PolarHBondContact OE1-NZ 3.25Å
56	K	86.4	Confident	79.6	Confident	138 Å²	138	109 Å²	109	60%	0.6	55%	0.551	S	S	*	*	H	α-helix	trans	-62.6	-40.7	173.9	-75.8	175.3	-179.6	-173.6	0	112.2	K52 K53 K54 Q60	K52-K56 WeakPolarHBondContact O-CB 3.21Å; K52-K56 VanDerWaalsContact O-CG 3.28Å; K52-K56 WeakPolarHBondContact O-CG 3.02Å; K52-K56 PolarHBondContact O-N 3.04Å; K53-K56 PolarHBondContact O-N 3.1Å; K54-K56 VanDerWaalsContact C-N 3.33Å; K54-K56 PolarHBondContact O-N 2.89Å; K56-Q60 WeakPolarHBondContact O-CB 3.44Å; K56-Q60 WeakPolarHBondContact O-CG 3.31Å; K56-Q60 PolarHBondContact O-N 3.34Å
57	I	83.3	Confident	78.8	Confident	85 Å²	85	111.8 Å²	111.8	44%	0.436	57%	0.568	S	S	.	*	H	α-helix	trans	-67.8	-44	177	-67.5	164	0	0	0	110.1	K53 K54 E55 Q60 I61	K53-I57 HydrophobicContact CG-CD1 4.11Å; K53-I57 VanDerWaalsContact O-CG1 3.29Å; K53-I57 WeakPolarHBondContact O-CG1 3.47Å; K53-I57 PolarHBondContact O-N 2.92Å; K54-I57 PolarHBondContact O-N 2.58Å; K54-I57 VanDerWaalsContact O-N 3.15Å; E55-I57 VanDerWaalsContact C-N 3.34Å; E55-I57 PolarHBondContact O-N 3.41Å; I57-Q60 CarbonylContact O-C 3.58Å; I57-Q60 WeakPolarHBondContact O-CB 3.48Å; I57-Q60 PolarHBondContact O-N 2.91Å; I57-I61 HydrophobicContact CG2-CD1 3.65Å; I57-I61 HydrophobicContact CG2-CG1 4.31Å; I57-I61 VanDerWaalsContact O-CG1 3.23Å; I57-I61 WeakPolarHBondContact O-CG1 3.42Å; I57-I61 PolarHBondContact O-N 3.21Å
58	E	81	Confident	77.9	Confident	140 Å²	140	115.6 Å²	115.6	65%	0.654	59%	0.594	S	S	*	*	H	α-helix	trans	-62.8	-43.5	176.7	-171.1	179.7	98.3	0	0	111.8	K54 E55 Q60 I61 A62	K54-E58 PolarHBondContact O-N 2.67Å; E55-E58 PolarHBondContact O-N 2.92Å; E58-Q60 VanDerWaalsContact C-N 3.31Å; E58-Q60 PolarHBondContact O-N 2.87Å; E58-I61 PolarHBondContact O-N 3.26Å; E58-A62 VanDerWaalsContact O-CB 3.27Å; E58-A62 WeakPolarHBondContact O-CB 3.34Å; E58-A62 PolarHBondContact O-N 3.15Å
59	K	84.2	Confident	76.6	Confident	118 Å²	118	120.9 Å²	120.9	51%	0.513	62%	0.619	S	S	.	*	H	α-helix	trans	-60.8	-41	172.6	-76.2	172.4	174.7	172.4	0	111.7	E55 T63	E55-K59 HydrophobicContact CG-CD 4.18Å; E55-K59 VanDerWaalsContact O-CB 3.31Å; E55-K59 WeakPolarHBondContact O-CB 3.41Å; E55-K59 VanDerWaalsContact O-CG 3.27Å; E55-K59 WeakPolarHBondContact O-CG 3.38Å; E55-K59 PolarHBondContact O-N 3.36Å; E55-K59 WeakPolarHBondContact OE1-CE 3.02Å; E55-K59 IonicContact OE1-NZ 2.58Å; E55-K59 PolarHBondContact OE1-NZ 3.25Å; K59-T63 VanDerWaalsContact O-CB 3.24Å; K59-T63 WeakPolarHBondContact O-CB 3.47Å; K59-T63 PolarHBondContact O-N 3.18Å; K59-T63 PolarHBondContact O-OG1 3.33Å
60	Q	79.3	Confident	75.5	Confident	134 Å²	134	117 Å²	117	63%	0.626	62%	0.616	S	S	*	*	H	α-helix	trans	-63.4	-47.8	174.3	-81.2	-172.3	44.4	0	0	111	K56 I57 E58 A62 T63 S64	K56-Q60 WeakPolarHBondContact O-CB 3.44Å; K56-Q60 WeakPolarHBondContact O-CG 3.31Å; K56-Q60 PolarHBondContact O-N 3.34Å; I57-Q60 CarbonylContact O-C 3.58Å; I57-Q60 WeakPolarHBondContact O-CB 3.48Å; I57-Q60 PolarHBondContact O-N 2.91Å; E58-Q60 VanDerWaalsContact C-N 3.31Å; E58-Q60 PolarHBondContact O-N 2.87Å; Q60-A62 PolarHBondContact O-N 3.25Å; Q60-T63 CarbonylContact O-C 3.47Å; Q60-T63 PolarHBondContact O-N 3.34Å; Q60-T63 VanDerWaalsContact O-N 3.1Å; Q60-S64 WeakPolarHBondContact O-CB 3.35Å; Q60-S64 PolarHBondContact O-N 2.93Å; Q60-S64 PolarHBondContact O-OG 3.45Å
61	I	75.8	Confident	74.3	Confident	81 Å²	81	113.6 Å²	113.6	42%	0.415	62%	0.62	S	S	.	*	H	α-helix	trans	-61.2	-43.2	177.8	-65.3	161.7	0	0	0	111.4	I57 E58 T63 S64 G65	I57-I61 HydrophobicContact CG2-CD1 3.65Å; I57-I61 HydrophobicContact CG2-CG1 4.31Å; I57-I61 VanDerWaalsContact O-CG1 3.23Å; I57-I61 WeakPolarHBondContact O-CG1 3.42Å; I57-I61 PolarHBondContact O-N 3.21Å; E58-I61 PolarHBondContact O-N 3.26Å; I61-T63 VanDerWaalsContact C-N 3.27Å; I61-T63 PolarHBondContact O-N 2.79Å; I61-S64 PolarHBondContact O-N 3.02Å; I61-G65 CarbonylContact O-C 3.53Å; I61-G65 WeakPolarHBondContact O-CA 3.21Å; I61-G65 PolarHBondContact O-N 2.84Å
62	A	76.4	Confident	73.4	Confident	84 Å²	84	113.6 Å²	113.6	69%	0.694	63%	0.632	S	S	*	*	H	α-helix	trans	-63.6	-34	175.9	0	0	0	0	0	112.1	E58 Q60	E58-A62 VanDerWaalsContact O-CB 3.27Å; E58-A62 WeakPolarHBondContact O-CB 3.34Å; E58-A62 PolarHBondContact O-N 3.15Å; Q60-A62 PolarHBondContact O-N 3.25Å
63	T	73.6	Confident	72.4	Confident	126 Å²	126	116.7 Å²	116.7	77%	0.773	65%	0.645	S	S	*	*	H	α-helix	trans	-83	-35.4	178.7	-54.2	0	0	0	0	112.4	K59 Q60 I61	K59-T63 VanDerWaalsContact O-CB 3.24Å; K59-T63 WeakPolarHBondContact O-CB 3.47Å; K59-T63 PolarHBondContact O-N 3.18Å; K59-T63 PolarHBondContact O-OG1 3.33Å; Q60-T63 CarbonylContact O-C 3.47Å; Q60-T63 PolarHBondContact O-N 3.34Å; Q60-T63 VanDerWaalsContact O-N 3.1Å; I61-T63 VanDerWaalsContact C-N 3.27Å; I61-T63 PolarHBondContact O-N 2.79Å
64	S	66.4	Low	71.4	Confident	90 Å²	90	119.9 Å²	119.9	63%	0.629	65%	0.653	S	S	*	*	H	α-helix	trans	-92.6	-2.4	-174.4	70.7	0	0	0	0	113.6	Q60 I61	Q60-S64 WeakPolarHBondContact O-CB 3.35Å; Q60-S64 PolarHBondContact O-N 2.93Å; Q60-S64 PolarHBondContact O-OG 3.45Å; I61-S64 PolarHBondContact O-N 3.02Å
65	G	64.1	Low	70.5	Confident	28 Å²	28	118.3 Å²	118.3	29%	0.289	66%	0.657	S	S	.	*			trans	68.7	176.5	-170.5	0	0	0	0	0	112.5	I61	I61-G65 CarbonylContact O-C 3.53Å; I61-G65 WeakPolarHBondContact O-CA 3.21Å; I61-G65 PolarHBondContact O-N 2.84Å
66	P	61.5	Low	69.4	Low	120 Å²	120	118.5 Å²	118.5	78%	0.779	66%	0.664	S	S	*	*	S	Bend	trans	-47.2	134.1	177.7	-22.7	30.5	0	0	0	109.9
67	P	62.1	Low	68.2	Low	94 Å²	94	120.6 Å²	120.6	61%	0.61	70%	0.696	S	S	*	*	P	Polyproline II helix	trans	-51.8	139.5	177.5	20.2	-30	0	0	0	108.8	E69	P67-E69 PolarHBondContact O-N 2.81Å
68	P	61.1	Low	67.4	Low	123 Å²	123	122.4 Å²	122.4	80%	0.799	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-50.7	132.5	178.9	21.9	-32.5	0	0	0	108.1	G70	P68-G70 PolarHBondContact O-N 3.49Å
69	E	56.6	Low	66.7	Low	208 Å²	208	121.4 Å²	121.4	97%	0.972	71%	0.712	S	S	*	*	S	Bend	trans	-59.2	71.8	-178.3	-162.8	-167.7	177.9	0	0	110.7	P67	P67-E69 PolarHBondContact O-N 2.81Å
70	G	60.4	Low	65.7	Low	58 Å²	58	121.6 Å²	121.6	60%	0.598	72%	0.723	S	S	*	*			trans	-144.4	30.6	-169	0	0	0	0	0	111.2	P68 L72	P68-G70 PolarHBondContact O-N 3.49Å; G70-L72 PolarHBondContact O-N 3.34Å
71	G	60.4	Low	64.9	Low	67 Å²	67	120.9 Å²	120.9	69%	0.691	73%	0.729	S	S	*	*			trans	-57.3	123.8	169.9	0	0	0	0	0	109.4	K73	G71-K73 PolarHBondContact O-N 2.99Å
72	L	65.8	Low	64.2	Low	162 Å²	162	123.4 Å²	123.4	85%	0.848	75%	0.749	S	S	*	*			trans	-45.8	110.6	177.1	-94.7	74.3	0	0	0	110.4	G70 W74	G70-L72 PolarHBondContact O-N 3.34Å; L72-W74 VanDerWaalsContact C-N 3.28Å; L72-W74 PolarHBondContact O-N 3.24Å
73	K	65.1	Low	63.4	Low	191 Å²	191	126 Å²	126	83%	0.83	75%	0.752	S	S	*	*			trans	-74	87	163.3	-71.2	179	165.6	158.7	0	106.8	G71 T75	G71-K73 PolarHBondContact O-N 2.99Å; K73-T75 VanDerWaalsContact C-N 3.34Å; K73-T75 PolarHBondContact O-N 2.9Å; K73-T75 PolarHBondContact O-OG1 3.08Å
74	W	67.8	Low	62.7	Low	214 Å²	214	126 Å²	126	81%	0.811	75%	0.751	S	S	*	*			trans	-60.9	106.2	165.6	53.5	-80.4	0	0	0	106.1	L72 V76	L72-W74 VanDerWaalsContact C-N 3.28Å; L72-W74 PolarHBondContact O-N 3.24Å; W74-V76 HydrophobicContact CE3-CG2 3.35Å; W74-V76 HydrophobicContact CH2-CG2 4.18Å; W74-V76 HydrophobicContact CZ3-CG2 3.07Å
75	T	64.4	Low	62.4	Low	122 Å²	122	128.8 Å²	128.8	75%	0.748	76%	0.76	S	S	*	*			trans	-84.4	116.6	176	-45.8	0	0	0	0	105.8	K73	K73-T75 VanDerWaalsContact C-N 3.34Å; K73-T75 PolarHBondContact O-N 2.9Å; K73-T75 PolarHBondContact O-OG1 3.08Å
76	V	61.3	Low	62.3	Low	105 Å²	105	137.2 Å²	137.2	64%	0.636	80%	0.8	S	S	*	*			trans	-75.3	122.1	167.7	-174.6	0	0	0	0	106.6	W74	W74-V76 HydrophobicContact CE3-CG2 3.35Å; W74-V76 HydrophobicContact CH2-CG2 4.18Å; W74-V76 HydrophobicContact CZ3-CG2 3.07Å
77	S	61	Low	62.4	Low	182 Å²	182	138.7 Å²	138.7	100%	1.273	80%	0.801	S	S	*	*			trans	-84.2	0	164.7	-58.8	0	0	0	0	110.1

Retrieved 77 of 77 residues in 444.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).