A0A096MV22_PAPAN Loading...

Beta-defensin

Has antibacterial activity.

AlphaFold DB , UniProt , Accession A0A096MV22, Species PAPAN (Papio anubis, Olive baboon), Gene DEFB135, Length 76 aa.

						>A0A096MV22_PAPAN|A0A096MV22|DEFB135
MATRSVLLALVVLDLLFYVPPGRSGPNIYIQKLFASCWRLRGSCRQKCLKKEEYHILCDTTRLCCVNPQHLPILTG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.6	Low	78.9	Confident	232 Å²	232	112.4 Å²	112.4	100%	1.143	63%	0.626	S	S	*	*				0	-6.7	0	-71.4	-175.6	-112.2	0	0	114.3
2	A	58.6	Low	79.8	Confident	74 Å²	74	109.9 Å²	109.9	61%	0.612	62%	0.616	S	S	*	*	H	α-helix	trans	-81.7	-25.9	-179.8	0	0	0	0	0	115	R4 S5 V6	A2-R4 PolarHBondContact O-N 2.99Å; A2-S5 PolarHBondContact O-N 3.14Å; A2-V6 VanDerWaalsContact O-CG2 3.31Å; A2-V6 WeakPolarHBondContact O-CG2 3.3Å; A2-V6 PolarHBondContact O-N 2.84Å; A2-V6 VanDerWaalsContact O-N 3.16Å
3	T	70.8	Confident	80.2	Confident	107 Å²	107	108.4 Å²	108.4	66%	0.656	61%	0.605	S	S	*	*	H	α-helix	trans	-68.7	-37.8	-172.2	51.6	0	0	0	0	113.9	L7	T3-L7 WeakPolarHBondContact O-CB 3.45Å; T3-L7 WeakPolarHBondContact O-CD1 3.13Å; T3-L7 WeakPolarHBondContact O-CG 2.98Å; T3-L7 PolarHBondContact O-N 3.01Å
4	R	75.6	Confident	80.5	Confident	202 Å²	202	108.7 Å²	108.7	76%	0.762	61%	0.605	S	S	*	*	H	α-helix	trans	-69	-37.5	177.1	-81	-174.3	148	-168.9	-6.3	112.9	A2 L7 L8	A2-R4 PolarHBondContact O-N 2.99Å; R4-L7 PolarHBondContact O-N 2.81Å; R4-L8 VanDerWaalsContact O-CG 3.31Å; R4-L8 WeakPolarHBondContact O-CG 3.26Å; R4-L8 PolarHBondContact O-N 3.49Å
5	S	81.6	Confident	80.7	Confident	82 Å²	82	109.3 Å²	109.3	57%	0.573	61%	0.606	S	S	*	*	H	α-helix	trans	-69	-39.4	178	-178.3	0	0	0	0	111.3	A2 L8 A9	A2-S5 PolarHBondContact O-N 3.14Å; S5-L8 PolarHBondContact O-N 2.88Å; S5-A9 PolarHBondContact O-N 3.02Å
6	V	85.9	Confident	80.5	Confident	84 Å²	84	109.9 Å²	109.9	51%	0.509	61%	0.606	S	S	.	*	H	α-helix	trans	-64.6	-44.6	174.1	174.2	0	0	0	0	111.3	A2 L8 A9 L10	A2-V6 VanDerWaalsContact O-CG2 3.31Å; A2-V6 WeakPolarHBondContact O-CG2 3.3Å; A2-V6 PolarHBondContact O-N 2.84Å; A2-V6 VanDerWaalsContact O-N 3.16Å; V6-L8 VanDerWaalsContact C-N 3.33Å; V6-L8 PolarHBondContact O-N 3.13Å; V6-A9 PolarHBondContact O-N 3.47Å; V6-L10 HydrophobicContact CG1-CD1 4.2Å; V6-L10 WeakPolarHBondContact O-CG 3.17Å; V6-L10 PolarHBondContact O-N 3.13Å
7	L	86.1	Confident	80.3	Confident	107 Å²	107	113.1 Å²	113.1	56%	0.56	61%	0.613	S	S	*	*	H	α-helix	trans	-59	-42.4	175.6	-84.1	160	0	0	0	112.4	T3 R4 L10 V11	T3-L7 WeakPolarHBondContact O-CB 3.45Å; T3-L7 WeakPolarHBondContact O-CD1 3.13Å; T3-L7 WeakPolarHBondContact O-CG 2.98Å; T3-L7 PolarHBondContact O-N 3.01Å; R4-L7 PolarHBondContact O-N 2.81Å; L7-L10 PolarHBondContact O-N 2.92Å; L7-V11 VanDerWaalsContact O-CG2 3.31Å; L7-V11 WeakPolarHBondContact O-CG2 3.47Å; L7-V11 PolarHBondContact O-N 2.95Å
8	L	88.4	Confident	79.9	Confident	118 Å²	118	117.4 Å²	117.4	62%	0.618	62%	0.621	S	S	*	*	H	α-helix	trans	-65.4	-41.1	176.4	-72.6	170.2	0	0	0	112	R4 S5 V6 L10 V11 V12	R4-L8 VanDerWaalsContact O-CG 3.31Å; R4-L8 WeakPolarHBondContact O-CG 3.26Å; R4-L8 PolarHBondContact O-N 3.49Å; S5-L8 PolarHBondContact O-N 2.88Å; V6-L8 VanDerWaalsContact C-N 3.33Å; V6-L8 PolarHBondContact O-N 3.13Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 3.16Å; L8-V11 PolarHBondContact O-N 3.05Å; L8-V12 VanDerWaalsContact O-CG2 3.27Å; L8-V12 WeakPolarHBondContact O-CG2 3.48Å; L8-V12 PolarHBondContact O-N 3.2Å
9	A	90.8	Very high	79	Confident	61 Å²	61	116.7 Å²	116.7	50%	0.504	62%	0.621	S	S	.	*	H	α-helix	trans	-62.4	-40.2	176.7	0	0	0	0	0	112	S5 V6 V12 L13	S5-A9 PolarHBondContact O-N 3.02Å; V6-A9 PolarHBondContact O-N 3.47Å; A9-V12 PolarHBondContact O-N 2.82Å; A9-L13 WeakPolarHBondContact O-CB 3.47Å; A9-L13 PolarHBondContact O-N 2.85Å
10	L	87.3	Confident	78.1	Confident	91 Å²	91	115.5 Å²	115.5	48%	0.476	62%	0.62	S	S	.	*	H	α-helix	trans	-64.7	-45.6	175.4	-69.1	172.3	0	0	0	111.8	V6 L7 L8 V12 L13 D14	V6-L10 HydrophobicContact CG1-CD1 4.2Å; V6-L10 WeakPolarHBondContact O-CG 3.17Å; V6-L10 PolarHBondContact O-N 3.13Å; L7-L10 PolarHBondContact O-N 2.92Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 3.16Å; L10-V12 VanDerWaalsContact C-N 3.3Å; L10-V12 PolarHBondContact O-N 2.72Å; L10-L13 WeakPolarHBondContact O-CB 3.46Å; L10-L13 PolarHBondContact O-N 2.72Å; L10-L13 VanDerWaalsContact O-N 3.1Å; L10-D14 PolarHBondContact O-N 2.96Å
11	V	90.2	Very high	77.2	Confident	78 Å²	78	115.9 Å²	115.9	47%	0.473	63%	0.629	S	S	.	*	H	α-helix	trans	-60.4	-40.4	176.3	171.3	0	0	0	0	111.8	L7 L8 D14 L15	L7-V11 VanDerWaalsContact O-CG2 3.31Å; L7-V11 WeakPolarHBondContact O-CG2 3.47Å; L7-V11 PolarHBondContact O-N 2.95Å; L8-V11 PolarHBondContact O-N 3.05Å; V11-D14 PolarHBondContact O-N 2.02Å; V11-L15 HydrophobicContact CG1-CD1 4.1Å; V11-L15 VanDerWaalsContact O-CG 3.31Å; V11-L15 WeakPolarHBondContact O-CG 3.14Å; V11-L15 PolarHBondContact O-N 3.39Å
12	V	89.3	Confident	77.3	Confident	83 Å²	83	107.2 Å²	107.2	50%	0.503	60%	0.599	S	S	.	*	H	α-helix	trans	-65.5	-40.2	175.5	171.6	0	0	0	0	111	L8 A9 L10 L15 L16	L8-V12 VanDerWaalsContact O-CG2 3.27Å; L8-V12 WeakPolarHBondContact O-CG2 3.48Å; L8-V12 PolarHBondContact O-N 3.2Å; A9-V12 PolarHBondContact O-N 2.82Å; L10-V12 VanDerWaalsContact C-N 3.3Å; L10-V12 PolarHBondContact O-N 2.72Å; V12-L15 PolarHBondContact O-N 2.95Å; V12-L16 HydrophobicContact CG1-CD1 4.12Å; V12-L16 VanDerWaalsContact O-CG 3.32Å; V12-L16 WeakPolarHBondContact O-CG 3.4Å; V12-L16 PolarHBondContact O-N 3.45Å
13	L	85.8	Confident	77.4	Confident	90 Å²	90	116.1 Å²	116.1	47%	0.471	62%	0.617	S	S	.	*	H	α-helix	trans	-63.6	-46.2	176.7	-170.2	68.2	0	0	0	111.4	A9 L10 L15 L16 F17	A9-L13 WeakPolarHBondContact O-CB 3.47Å; A9-L13 PolarHBondContact O-N 2.85Å; L10-L13 WeakPolarHBondContact O-CB 3.46Å; L10-L13 PolarHBondContact O-N 2.72Å; L10-L13 VanDerWaalsContact O-N 3.1Å; L13-L15 VanDerWaalsContact C-N 3.33Å; L13-L15 PolarHBondContact O-N 3.37Å; L13-L16 PolarHBondContact O-N 2.04Å; L13-F17 HydrophobicContact CD1-CD2 4.13Å; L13-F17 HydrophobicContact CD1-CE2 3.88Å; L13-F17 HydrophobicContact CG-CD2 4.05Å; L13-F17 HydrophobicContact CG-CE2 4.1Å; L13-F17 WeakPolarHBondContact O-CD2 3.45Å; L13-F17 PolarHBondContact O-N 3Å
14	D	84.9	Confident	76.9	Confident	113 Å²	113	116.3 Å²	116.3	60%	0.604	62%	0.622	S	S	*	*	H	α-helix	trans	-58.5	-43.7	175.5	-82.3	-58.3	0	0	0	111.6	L10 V11 L16 F17 Y18	L10-D14 PolarHBondContact O-N 2.96Å; V11-D14 PolarHBondContact O-N 2.02Å; D14-L16 VanDerWaalsContact C-N 3.33Å; D14-L16 PolarHBondContact O-N 2.97Å; D14-F17 PolarHBondContact O-N 3.3Å; D14-Y18 VanDerWaalsContact O-CB 3.3Å; D14-Y18 WeakPolarHBondContact O-CB 3.32Å; D14-Y18 PolarHBondContact O-N 3.35Å
15	L	82.7	Confident	76.7	Confident	118 Å²	118	109.1 Å²	109.1	62%	0.618	61%	0.612	S	S	*	*	H	α-helix	trans	-64.2	-34.5	176.6	-74.1	167.3	0	0	0	113.1	V11 V12 L13	V11-L15 HydrophobicContact CG1-CD1 4.1Å; V11-L15 VanDerWaalsContact O-CG 3.31Å; V11-L15 WeakPolarHBondContact O-CG 3.14Å; V11-L15 PolarHBondContact O-N 3.39Å; V12-L15 PolarHBondContact O-N 2.95Å; L13-L15 VanDerWaalsContact C-N 3.33Å; L13-L15 PolarHBondContact O-N 3.37Å
16	L	77.2	Confident	76.3	Confident	118 Å²	118	109.1 Å²	109.1	62%	0.618	61%	0.609	S	S	*	*	H	α-helix	trans	-73.2	-32.1	175.6	-72.2	169.9	0	0	0	112.6	V12 L13 D14 V19	V12-L16 HydrophobicContact CG1-CD1 4.12Å; V12-L16 VanDerWaalsContact O-CG 3.32Å; V12-L16 WeakPolarHBondContact O-CG 3.4Å; V12-L16 PolarHBondContact O-N 3.45Å; L13-L16 PolarHBondContact O-N 2.04Å; D14-L16 VanDerWaalsContact C-N 3.33Å; D14-L16 PolarHBondContact O-N 2.97Å; L16-V19 VanDerWaalsContact O-CG2 3.32Å; L16-V19 WeakPolarHBondContact O-CG2 3.02Å
17	F	77.2	Confident	76	Confident	164 Å²	164	109.3 Å²	109.3	72%	0.719	61%	0.608	S	S	*	*	H	α-helix	trans	-77.8	-28.4	172.6	-89.7	-82.9	0	0	0	112.4	L13 D14 V19	L13-F17 HydrophobicContact CD1-CD2 4.13Å; L13-F17 HydrophobicContact CD1-CE2 3.88Å; L13-F17 HydrophobicContact CG-CD2 4.05Å; L13-F17 HydrophobicContact CG-CE2 4.1Å; L13-F17 WeakPolarHBondContact O-CD2 3.45Å; L13-F17 PolarHBondContact O-N 3Å; D14-F17 PolarHBondContact O-N 3.3Å; F17-V19 PolarHBondContact O-N 3.48Å
18	Y	73	Confident	75.8	Confident	191 Å²	191	109.9 Å²	109.9	75%	0.749	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.7	30	173.5	-151.1	-93.7	0	0	0	112.3	D14 P20	D14-Y18 VanDerWaalsContact O-CB 3.3Å; D14-Y18 WeakPolarHBondContact O-CB 3.32Å; D14-Y18 PolarHBondContact O-N 3.35Å; Y18-P20 WeakPolarHBondContact O-CD 3.04Å; Y18-P20 VanDerWaalsContact O-N 3.13Å
19	V	63.7	Low	75.5	Confident	105 Å²	105	112.4 Å²	112.4	64%	0.636	61%	0.612	S	S	*	*			trans	-69.4	103.5	160.2	175.1	0	0	0	0	105.4	L16 F17	L16-V19 VanDerWaalsContact O-CG2 3.32Å; L16-V19 WeakPolarHBondContact O-CG2 3.02Å; F17-V19 PolarHBondContact O-N 3.48Å
20	P	59.6	Low	75.1	Confident	91 Å²	91	113.3 Å²	113.3	59%	0.591	61%	0.608	S	S	*	*			trans	-60.9	133.7	175.5	28.3	-30.4	0	0	0	106	Y18 G22	Y18-P20 WeakPolarHBondContact O-CD 3.04Å; Y18-P20 VanDerWaalsContact O-N 3.13Å; P20-G22 PolarHBondContact O-N 2.03Å
21	P	59.1	Low	74.8	Confident	124 Å²	124	114.2 Å²	114.2	81%	0.805	61%	0.61	S	S	*	*			trans	-53.1	112.8	172.1	22.9	-31.6	0	0	0	105.8	R23	P21-R23 PolarHBondContact O-N 2.98Å
22	G	56.5	Low	74.4	Confident	51 Å²	51	118.3 Å²	118.3	53%	0.526	62%	0.621	S	S	.	*			trans	-50.4	134	-178.9	0	0	0	0	0	107.4	P20 S24	P20-G22 PolarHBondContact O-N 2.03Å; G22-S24 PolarHBondContact O-N 2.82Å
23	R	59	Low	74.2	Confident	261 Å²	261	119.2 Å²	119.2	99%	0.985	62%	0.623	S	S	*	*	S	Bend	trans	-56.4	2.7	177.6	-78.2	-168	179.8	166.6	0.4	114.3	P21 G25	P21-R23 PolarHBondContact O-N 2.98Å; R23-G25 PolarHBondContact O-N 3.29Å
24	S	61.6	Low	74	Confident	110 Å²	110	122.8 Å²	122.8	77%	0.769	64%	0.635	S	S	*	*			trans	-61.2	79.2	163.2	-31.6	0	0	0	0	109.6	G22	G22-S24 PolarHBondContact O-N 2.82Å
25	G	70.1	Confident	74.1	Confident	52 Å²	52	119.2 Å²	119.2	54%	0.536	62%	0.621	S	S	.	*	P	Polyproline II helix	trans	-52.5	159.6	164.4	0	0	0	0	0	110.7	R23 N27	R23-G25 PolarHBondContact O-N 3.29Å; G25-N27 PolarHBondContact O-N 3.15Å
26	P	73.6	Confident	74.4	Confident	81 Å²	81	115 Å²	115	53%	0.526	60%	0.602	S	S	.	*	P	Polyproline II helix	trans	-52.6	133.5	-179.6	18.7	-29.2	0	0	0	110.2	I30 Q31	P26-I30 HydrophobicContact CB-CB 4.47Å; P26-I30 HydrophobicContact CB-CG2 4.36Å; P26-Q31 HydrophobicContact CB-CG 4.26Å; P26-Q31 HydrophobicContact CG-CG 4.05Å; P26-Q31 PolarHBondContact O-NE2 3.08Å
27	N	80.9	Confident	75	Confident	89 Å²	89	110.1 Å²	110.1	48%	0.476	58%	0.577	S	S	.	*	P	Polyproline II helix	trans	-50.9	143.9	179.5	-172	-12.6	0	0	0	110.2	G25 Y29 I30 Q31	G25-N27 PolarHBondContact O-N 3.15Å; N27-Y29 PolarHBondContact O-N 3.22Å; N27-Y29 VanDerWaalsContact OD1-CD2 3.27Å; N27-Y29 WeakPolarHBondContact OD1-CD2 2.98Å; N27-I30 HydrophobicContact CB-CD1 4.04Å; N27-I30 HydrophobicContact CB-CG1 4.21Å; N27-I30 WeakPolarHBondContact O-CA 3.19Å; N27-I30 WeakPolarHBondContact O-CB 3.46Å; N27-I30 PolarHBondContact O-N 3.35Å; N27-Q31 PolarHBondContact O-N 3.13Å; N27-Q31 VanDerWaalsContact O-N 3.08Å
28	I	81.2	Confident	75.6	Confident	118 Å²	118	106.6 Å²	106.6	61%	0.605	56%	0.559	S	S	*	*	H	α-helix	trans	-51.4	-32.5	-179.3	62.9	157.7	0	0	0	112.4	Q31 K32	I28-Q31 PolarHBondContact O-N 3.33Å; I28-K32 WeakPolarHBondContact O-CB 3.44Å; I28-K32 PolarHBondContact O-N 2.65Å
29	Y	81.6	Confident	76.2	Confident	171 Å²	171	108.8 Å²	108.8	67%	0.671	57%	0.566	S	S	*	*	H	α-helix	trans	-66.6	-40.1	177.2	-63.2	-76.3	0	0	0	112	N27 K32 L33	N27-Y29 PolarHBondContact O-N 3.22Å; N27-Y29 VanDerWaalsContact OD1-CD2 3.27Å; N27-Y29 WeakPolarHBondContact OD1-CD2 2.98Å; Y29-K32 PolarHBondContact O-N 3.06Å; Y29-L33 PolarHBondContact O-N 3.08Å
30	I	82	Confident	77.3	Confident	80 Å²	80	109.6 Å²	109.6	41%	0.41	57%	0.566	S	S	.	*	H	α-helix	trans	-69.1	-43.9	178.3	-59.6	172.1	0	0	0	109.6	P26 N27 K32 L33 F34	P26-I30 HydrophobicContact CB-CB 4.47Å; P26-I30 HydrophobicContact CB-CG2 4.36Å; N27-I30 HydrophobicContact CB-CD1 4.04Å; N27-I30 HydrophobicContact CB-CG1 4.21Å; N27-I30 WeakPolarHBondContact O-CA 3.19Å; N27-I30 WeakPolarHBondContact O-CB 3.46Å; N27-I30 PolarHBondContact O-N 3.35Å; I30-K32 VanDerWaalsContact C-N 3.28Å; I30-K32 PolarHBondContact O-N 2.95Å; I30-L33 WeakPolarHBondContact O-CB 3.03Å; I30-L33 PolarHBondContact O-N 3.39Å; I30-F34 HydrophobicContact CG2-CD2 3.83Å; I30-F34 HydrophobicContact CG2-CE2 3.53Å; I30-F34 WeakPolarHBondContact O-CD2 3.18Å; I30-F34 PolarHBondContact O-N 3.49Å; I30-F34 VanDerWaalsContact O-N 3.13Å
31	Q	80.9	Confident	78.7	Confident	110 Å²	110	112.2 Å²	112.2	51%	0.514	56%	0.564	S	S	.	*	H	α-helix	trans	-59.5	-41.3	175.1	-66.9	-171.2	-0.4	0	0	112	P26 N27 I28 L33 F34 A35	P26-Q31 HydrophobicContact CB-CG 4.26Å; P26-Q31 HydrophobicContact CG-CG 4.05Å; P26-Q31 PolarHBondContact O-NE2 3.08Å; N27-Q31 PolarHBondContact O-N 3.13Å; N27-Q31 VanDerWaalsContact O-N 3.08Å; I28-Q31 PolarHBondContact O-N 3.33Å; Q31-L33 VanDerWaalsContact C-N 3.3Å; Q31-L33 PolarHBondContact O-N 3.2Å; Q31-F34 PolarHBondContact O-N 3.18Å; Q31-A35 WeakPolarHBondContact O-CB 3.27Å; Q31-A35 PolarHBondContact O-N 3.37Å
32	K	82.6	Confident	80.2	Confident	165 Å²	165	106.5 Å²	106.5	72%	0.717	53%	0.528	S	S	*	.	H	α-helix	trans	-66.3	-33.6	179	-151.5	172.6	-170.2	176.2	0	112.2	I28 Y29 I30 A35 S36	I28-K32 WeakPolarHBondContact O-CB 3.44Å; I28-K32 PolarHBondContact O-N 2.65Å; Y29-K32 PolarHBondContact O-N 3.06Å; I30-K32 VanDerWaalsContact C-N 3.28Å; I30-K32 PolarHBondContact O-N 2.95Å; K32-A35 PolarHBondContact O-N 2.99Å; K32-S36 PolarHBondContact O-N 3.44Å
33	L	84.2	Confident	81.9	Confident	101 Å²	101	106.6 Å²	106.6	53%	0.529	52%	0.52	S	S	.	.	H	α-helix	trans	-63.8	-48.8	173.6	-172.4	69.8	0	0	0	111.2	Y29 I30 Q31 A35 S36 L40	Y29-L33 PolarHBondContact O-N 3.08Å; I30-L33 WeakPolarHBondContact O-CB 3.03Å; I30-L33 PolarHBondContact O-N 3.39Å; Q31-L33 VanDerWaalsContact C-N 3.3Å; Q31-L33 PolarHBondContact O-N 3.2Å; L33-A35 VanDerWaalsContact C-N 3.25Å; L33-A35 PolarHBondContact O-N 3.4Å; L33-S36 PolarHBondContact O-N 3.43Å; L33-S36 VanDerWaalsContact O-N 3.08Å; L33-S36 PolarHBondContact O-OG 2.85Å; L33-L40 HydrophobicContact CD1-CD2 3.55Å
34	F	83.3	Confident	83.4	Confident	165 Å²	165	95.2 Å²	95.2	72%	0.724	48%	0.48	S	S	*	.	H	α-helix	trans	-68.1	-24.1	177	-72.9	-69.8	0	0	0	113.6	I30 Q31 S36	I30-F34 HydrophobicContact CG2-CD2 3.83Å; I30-F34 HydrophobicContact CG2-CE2 3.53Å; I30-F34 WeakPolarHBondContact O-CD2 3.18Å; I30-F34 PolarHBondContact O-N 3.49Å; I30-F34 VanDerWaalsContact O-N 3.13Å; Q31-F34 PolarHBondContact O-N 3.18Å; F34-S36 VanDerWaalsContact C-N 3.28Å
35	A	86.3	Confident	84.9	Confident	39 Å²	39	95.2 Å²	95.2	32%	0.322	46%	0.464	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.2	-2.9	173.5	0	0	0	0	0	113.6	Q31 K32 L33 C44	Q31-A35 WeakPolarHBondContact O-CB 3.27Å; Q31-A35 PolarHBondContact O-N 3.37Å; K32-A35 PolarHBondContact O-N 2.99Å; L33-A35 VanDerWaalsContact C-N 3.25Å; L33-A35 PolarHBondContact O-N 3.4Å; A35-C44 WeakPolarHBondContact O-CB 3.42Å; A35-C44 PolarHBondContact O-N 3.49Å
36	S	89.7	Confident	85.9	Confident	30 Å²	30	99.5 Å²	99.5	21%	0.21	47%	0.47	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	149.5	178	71.4	0	0	0	0	111	K32 L33 F34 L40 G42	K32-S36 PolarHBondContact O-N 3.44Å; L33-S36 PolarHBondContact O-N 3.43Å; L33-S36 VanDerWaalsContact O-N 3.08Å; L33-S36 PolarHBondContact O-OG 2.85Å; F34-S36 VanDerWaalsContact C-N 3.28Å; S36-L40 WeakPolarHBondContact OG-CD2 3.29Å; S36-G42 WeakPolarHBondContact CA-O 3.03Å
37	C	89.1	Confident	86.7	Confident	15 Å²	15	104.1 Å²	104.1	10%	0.101	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	176.7	180	64.8	0	0	0	0	110.1	R39 L40 R41 G42 C64	C37-R39 PolarHBondContact O-N 3.26Å; C37-L40 PolarHBondContact O-N 3.01Å; C37-L40 VanDerWaalsContact O-N 3.15Å; C37-R41 PolarHBondContact O-N 3.27Å; C37-G42 PolarHBondContact N-O 2.83Å; C37-G42 PolarHBondContact O-N 3.42Å; C37-C64 HydrophobicContact CB-CB 3.77Å; C37-C64 WeakPolarHBondContact CB-SG 3.27Å; C37-C64 WeakPolarHBondContact SG-CA 3.39Å; C37-C64 WeakPolarHBondContact SG-CB 3.31Å; C37-C64 CovalentContact SG-SG 2.02Å; C37-C64 PolarHBondContact SG-SG 2.95Å
38	W	89	Confident	87.1	Confident	89 Å²	89	101.7 Å²	101.7	34%	0.337	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.6	56.1	177.9	-161	-115.8	0	0	0	113.5	L40 R41 H55 V66 H70	W38-L40 VanDerWaalsContact C-N 3.32Å; W38-L40 PolarHBondContact O-N 2.73Å; W38-R41 VanDerWaalsContact O-CB 3.29Å; W38-R41 WeakPolarHBondContact O-CB 3.45Å; W38-R41 PolarHBondContact O-N 2.86Å; W38-H55 AromaticContact CD2-CD2 3.96Å; W38-H55 AromaticContact CE3-CD2 3.34Å; W38-H55 AromaticContact CE3-NE2 3.61Å; W38-H55 AromaticContact CH2-CD2 3.79Å; W38-H55 AromaticContact CH2-CE1 3.99Å; W38-H55 AromaticContact CH2-NE2 3.13Å; W38-H55 WeakPolarHBondContact CH2-NE2 3.46Å; W38-H55 AromaticContact CZ2-NE2 3.88Å; W38-H55 AromaticContact CZ3-CD2 3.26Å; W38-H55 WeakPolarHBondContact CZ3-CD2 2.96Å; W38-H55 AromaticContact CZ3-NE2 2.98Å; W38-H55 WeakPolarHBondContact CZ3-NE2 3.27Å; W38-V66 HydrophobicContact CB-CG2 3.65Å; W38-V66 HydrophobicContact CG-CG1 4.23Å; W38-V66 HydrophobicContact CG-CG2 3.9Å; W38-H70 PolarHBondContact NE1-O 3.03Å
39	R	87.2	Confident	87.5	Confident	237 Å²	237	100.6 Å²	100.6	89%	0.894	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.6	47	-176.3	-60.9	-177.6	176.6	-178.3	-0.7	113.3	C37 R41	C37-R39 PolarHBondContact O-N 3.26Å; R39-R41 PolarHBondContact O-N 2.97Å
40	L	86.7	Confident	87.7	Confident	122 Å²	122	103.1 Å²	103.1	64%	0.639	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	68	6.1	-178.5	-44.3	175.1	0	0	0	115.3	L33 S36 C37 W38	L33-L40 HydrophobicContact CD1-CD2 3.55Å; S36-L40 WeakPolarHBondContact OG-CD2 3.29Å; C37-L40 PolarHBondContact O-N 3.01Å; C37-L40 VanDerWaalsContact O-N 3.15Å; W38-L40 VanDerWaalsContact C-N 3.32Å; W38-L40 PolarHBondContact O-N 2.73Å
41	R	88.4	Confident	87.9	Confident	147 Å²	147	108 Å²	108	56%	0.555	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.9	-9.3	178.5	-60.1	178.8	172.8	-146.7	-3.3	113.1	C37 W38 R39 H70	C37-R41 PolarHBondContact O-N 3.27Å; W38-R41 VanDerWaalsContact O-CB 3.29Å; W38-R41 WeakPolarHBondContact O-CB 3.45Å; W38-R41 PolarHBondContact O-N 2.86Å; R39-R41 PolarHBondContact O-N 2.97Å; R41-H70 HydrophobicContact CB-CB 4.27Å
42	G	90.1	Very high	88.3	Confident	4 Å²	4	105.1 Å²	105.1	4%	0.041	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	167.5	175.9	0	0	0	0	0	112.7	S36 C37 C65	S36-G42 WeakPolarHBondContact CA-O 3.03Å; C37-G42 PolarHBondContact N-O 2.83Å; C37-G42 PolarHBondContact O-N 3.42Å; G42-C65 CarbonylContact C-O 3.54Å; G42-C65 WeakPolarHBondContact CA-O 3.32Å
43	S	91.8	Very high	88.6	Confident	52 Å²	52	102.1 Å²	102.1	36%	0.364	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	140.5	175	-67.7	0	0	0	0	111	R45 C65	S43-R45 PolarHBondContact O-N 2.87Å; S43-C65 PolarHBondContact N-O 3.43Å; S43-C65 PolarHBondContact O-N 3.36Å
44	C	92.1	Very high	88.9	Confident	22 Å²	22	102.9 Å²	102.9	15%	0.149	47%	0.47	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.4	117.1	175.2	-59.8	0	0	0	0	110	A35 C58 L63	A35-C44 WeakPolarHBondContact O-CB 3.42Å; A35-C44 PolarHBondContact O-N 3.49Å; C44-C58 VanDerWaalsContact CA-SG 3.58Å; C44-C58 HydrophobicContact CB-CB 3.65Å; C44-C58 WeakPolarHBondContact CB-SG 3.3Å; C44-C58 WeakPolarHBondContact SG-CB 3.41Å; C44-C58 CovalentContact SG-SG 2.03Å; C44-C58 PolarHBondContact SG-SG 3.4Å; C44-L63 CarbonylContact C-O 3.55Å; C44-L63 WeakPolarHBondContact CA-O 3.32Å
45	R	91.4	Very high	89	Confident	110 Å²	110	98.3 Å²	98.3	42%	0.415	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	159.4	-179.6	-60.7	179.5	-178.7	-95.1	0.1	109.9	S43 K47 E52 R62 L63	S43-R45 PolarHBondContact O-N 2.87Å; R45-K47 VanDerWaalsContact C-N 3.33Å; R45-K47 WeakPolarHBondContact CB-O 3.39Å; R45-E52 IonicContact NE-OE1 3.98Å; R45-E52 IonicContact NE-OE2 3.71Å; R45-R62 CarbonylContact O-C 3.57Å; R45-R62 WeakPolarHBondContact O-CA 3.02Å; R45-L63 PolarHBondContact N-O 2.99Å; R45-L63 PolarHBondContact O-N 3.22Å; R45-L63 VanDerWaalsContact O-O 3.14Å
46	Q	91.4	Very high	89.1	Confident	143 Å²	143	100.3 Å²	100.3	67%	0.668	46%	0.455	S	S	*	.	S	Bend	trans	-70	-31.7	172.7	-75.7	-161	-15.7	0	0	113.1	L63	Q46-L63 WeakPolarHBondContact O-CD1 3.45Å
47	K	90.6	Very high	89.1	Confident	178 Å²	178	103.5 Å²	103.5	77%	0.774	47%	0.47	S	S	*	.	S	Bend	trans	-140.2	140.5	173.2	-74.3	-174.8	177.2	178.8	0	109.3	R45	R45-K47 VanDerWaalsContact C-N 3.33Å; R45-K47 WeakPolarHBondContact CB-O 3.39Å
48	C	90.1	Very high	89.1	Confident	37 Å²	37	104.8 Å²	104.8	25%	0.25	48%	0.478	C	S	.	.			trans	-76.8	149.7	175	-57.3	0	0	0	0	111.3	E52 C65	C48-E52 HydrophobicContact CB-CB 4.26Å; C48-C65 WeakPolarHBondContact CA-SG 3.07Å; C48-C65 HydrophobicContact CB-CB 3.7Å; C48-C65 WeakPolarHBondContact CB-SG 3.19Å; C48-C65 VanDerWaalsContact SG-CA 3.52Å; C48-C65 WeakPolarHBondContact SG-CB 3.37Å; C48-C65 CovalentContact SG-SG 2.04Å; C48-C65 PolarHBondContact SG-SG 3.43Å
49	L	89.1	Confident	88.9	Confident	95 Å²	95	105.1 Å²	105.1	50%	0.497	49%	0.487	S	S	.	.			trans	-71.7	157.2	172.8	-73.8	146.2	0	0	0	110	K51 E52	L49-K51 PolarHBondContact O-N 3.17Å; L49-E52 HydrophobicContact CB-CG 4.26Å; L49-E52 PolarHBondContact N-OE2 2.81Å; L49-E52 PolarHBondContact O-N 2.97Å; L49-E52 VanDerWaalsContact O-O 3.09Å
50	K	85	Confident	88.8	Confident	225 Å²	225	100.4 Å²	100.4	98%	0.978	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.7	-18.7	179	-69	-174	178.4	-175.5	0	114.8
51	K	86.4	Confident	88.8	Confident	183 Å²	183	98.6 Å²	98.6	80%	0.796	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.2	-1.3	179.9	-62	-177.5	179.6	-178.3	0	113.1	L49 P68	L49-K51 PolarHBondContact O-N 3.17Å; K51-P68 WeakPolarHBondContact O-CD 3.44Å
52	E	89.3	Confident	88.9	Confident	49 Å²	49	97.4 Å²	97.4	23%	0.229	47%	0.474	C	S	.	.	S	Bend	trans	-110.9	147.6	177.4	-66.4	174.4	156.5	0	0	108.4	R45 C48 L49 C65 V66	R45-E52 IonicContact NE-OE1 3.98Å; R45-E52 IonicContact NE-OE2 3.71Å; C48-E52 HydrophobicContact CB-CB 4.26Å; L49-E52 HydrophobicContact CB-CG 4.26Å; L49-E52 PolarHBondContact N-OE2 2.81Å; L49-E52 PolarHBondContact O-N 2.97Å; L49-E52 VanDerWaalsContact O-O 3.09Å; E52-C65 HydrophobicContact CB-CB 4.04Å; E52-C65 VanDerWaalsContact OE2-CB 3.27Å; E52-C65 WeakPolarHBondContact OE2-CB 3.31Å; E52-V66 WeakPolarHBondContact CA-O 3.36Å
53	E	89.6	Confident	89	Confident	101 Å²	101	99.3 Å²	99.3	47%	0.472	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	141.9	177.3	-163	164.2	-169.6	0	0	109.8	V66 L71	E53-V66 PolarHBondContact N-O 3.22Å; E53-V66 PolarHBondContact O-N 3.48Å; E53-L71 HydrophobicContact CB-CD1 3.91Å
54	Y	90.1	Very high	89.1	Confident	118 Å²	118	96.9 Å²	96.9	46%	0.463	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	129.4	173.4	164.4	-103.8	0	0	0	109.2	I56 L63	Y54-I56 VanDerWaalsContact CE2-C 3.46Å; Y54-I56 VanDerWaalsContact CE2-O 3.3Å; Y54-I56 WeakPolarHBondContact CE2-O 3.4Å; Y54-L63 HydrophobicContact CD2-CB 3.96Å; Y54-L63 HydrophobicContact CD2-CD2 3.62Å; Y54-L63 HydrophobicContact CD2-CG 4.24Å; Y54-L63 HydrophobicContact CE2-CB 4.26Å; Y54-L63 HydrophobicContact CE2-CD2 3.35Å; Y54-L63 HydrophobicContact CE2-CG 4.35Å
55	H	85.1	Confident	89.1	Confident	68 Å²	68	95.8 Å²	95.8	32%	0.315	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	-55.9	176.5	-160.3	54.4	0	0	0	113.3	W38 C64 V66 L71	W38-H55 AromaticContact CD2-CD2 3.96Å; W38-H55 AromaticContact CE3-CD2 3.34Å; W38-H55 AromaticContact CE3-NE2 3.61Å; W38-H55 AromaticContact CH2-CD2 3.79Å; W38-H55 AromaticContact CH2-CE1 3.99Å; W38-H55 AromaticContact CH2-NE2 3.13Å; W38-H55 WeakPolarHBondContact CH2-NE2 3.46Å; W38-H55 AromaticContact CZ2-NE2 3.88Å; W38-H55 AromaticContact CZ3-CD2 3.26Å; W38-H55 WeakPolarHBondContact CZ3-CD2 2.96Å; W38-H55 AromaticContact CZ3-NE2 2.98Å; W38-H55 WeakPolarHBondContact CZ3-NE2 3.27Å; H55-C64 PolarHBondContact N-O 3.02Å; H55-C64 VanDerWaalsContact N-O 3.13Å; H55-V66 HydrophobicContact CB-CG2 4.21Å; H55-L71 WeakPolarHBondContact ND1-CD2 3.31Å
56	I	88.9	Confident	89.1	Confident	81 Å²	81	90.6 Å²	90.6	42%	0.415	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.2	167.2	-177.4	60.9	172.3	0	0	0	111	Y54 C64	Y54-I56 VanDerWaalsContact CE2-C 3.46Å; Y54-I56 VanDerWaalsContact CE2-O 3.3Å; Y54-I56 WeakPolarHBondContact CE2-O 3.4Å; I56-C64 HydrophobicContact CG1-CB 3.54Å; I56-C64 WeakPolarHBondContact O-CA 3.4Å; I56-C64 WeakPolarHBondContact O-CB 3.44Å; I56-C64 PolarHBondContact O-N 3.1Å
57	L	89.7	Confident	89	Confident	98 Å²	98	86.5 Å²	86.5	51%	0.513	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.2	131.7	168.7	-75.3	158.2	0	0	0	110	L63	L57-L63 HydrophobicContact CD2-CD2 3.49Å; L57-L63 VanDerWaalsContact CD2-CD2 3.49Å; L57-L63 HydrophobicContact CD2-CG 4.49Å; L57-L63 HydrophobicContact CG-CD2 4.33Å
58	C	88.2	Confident	88.8	Confident	42 Å²	42	81 Å²	81	28%	0.284	40%	0.404	S	S	.	.	S	Bend	trans	-82.3	-31.6	170.7	-63.7	0	0	0	0	112.2	C44 R62	C44-C58 VanDerWaalsContact CA-SG 3.58Å; C44-C58 HydrophobicContact CB-CB 3.65Å; C44-C58 WeakPolarHBondContact CB-SG 3.3Å; C44-C58 WeakPolarHBondContact SG-CB 3.41Å; C44-C58 CovalentContact SG-SG 2.03Å; C44-C58 PolarHBondContact SG-SG 3.4Å; C58-R62 HydrophobicContact CB-CB 4.27Å; C58-R62 PolarHBondContact N-O 3.03Å
59	D	84.9	Confident	88.5	Confident	96 Å²	96	87 Å²	87	51%	0.513	43%	0.429	S	S	.	.	S	Bend	trans	-154.5	-174	-176.3	-105.5	-33.2	0	0	0	108.6	T61 R62	D59-T61 PolarHBondContact O-N 2.98Å; D59-R62 HydrophobicContact CB-CB 4.26Å; D59-R62 PolarHBondContact N-O 3.47Å
60	T	85.3	Confident	88.1	Confident	137 Å²	137	86.2 Å²	86.2	84%	0.84	42%	0.422	S	S	*	.	S	Bend	trans	-59.5	-27.8	177.6	53.7	0	0	0	0	114.5
61	T	87.6	Confident	88	Confident	85 Å²	85	76.7 Å²	76.7	52%	0.521	38%	0.382	S	S	.	.	S	Bend	trans	-127.4	-4.6	-175.2	58.9	0	0	0	0	114.3	D59	D59-T61 PolarHBondContact O-N 2.98Å
62	R	90.9	Very high	87.6	Confident	121 Å²	121	72.2 Å²	72.2	46%	0.457	37%	0.372	S	S	.	.			trans	-112.4	130.7	-175.1	-63.1	177.9	-179.9	170.6	-0.8	110.3	R45 C58 D59	R45-R62 CarbonylContact O-C 3.57Å; R45-R62 WeakPolarHBondContact O-CA 3.02Å; C58-R62 HydrophobicContact CB-CB 4.27Å; C58-R62 PolarHBondContact N-O 3.03Å; D59-R62 HydrophobicContact CB-CB 4.26Å; D59-R62 PolarHBondContact N-O 3.47Å
63	L	92.1	Very high	86.9	Confident	45 Å²	45	77.1 Å²	77.1	24%	0.236	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	138.9	177.9	-57.8	169.1	0	0	0	109.5	C44 R45 Q46 Y54 L57 C65	C44-L63 CarbonylContact C-O 3.55Å; C44-L63 WeakPolarHBondContact CA-O 3.32Å; R45-L63 PolarHBondContact N-O 2.99Å; R45-L63 PolarHBondContact O-N 3.22Å; R45-L63 VanDerWaalsContact O-O 3.14Å; Q46-L63 WeakPolarHBondContact O-CD1 3.45Å; Y54-L63 HydrophobicContact CD2-CB 3.96Å; Y54-L63 HydrophobicContact CD2-CD2 3.62Å; Y54-L63 HydrophobicContact CD2-CG 4.24Å; Y54-L63 HydrophobicContact CE2-CB 4.26Å; Y54-L63 HydrophobicContact CE2-CD2 3.35Å; Y54-L63 HydrophobicContact CE2-CG 4.35Å; L57-L63 HydrophobicContact CD2-CD2 3.49Å; L57-L63 VanDerWaalsContact CD2-CD2 3.49Å; L57-L63 HydrophobicContact CD2-CG 4.49Å; L57-L63 HydrophobicContact CG-CD2 4.33Å; L63-C65 PolarHBondContact O-N 3.41Å
64	C	92.4	Very high	85.7	Confident	0 Å²	0	79.9 Å²	79.9	0%	0	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	112.6	166.7	177.1	0	0	0	0	108.9	C37 H55 I56	C37-C64 HydrophobicContact CB-CB 3.77Å; C37-C64 WeakPolarHBondContact CB-SG 3.27Å; C37-C64 WeakPolarHBondContact SG-CA 3.39Å; C37-C64 WeakPolarHBondContact SG-CB 3.31Å; C37-C64 CovalentContact SG-SG 2.02Å; C37-C64 PolarHBondContact SG-SG 2.95Å; H55-C64 PolarHBondContact N-O 3.02Å; H55-C64 VanDerWaalsContact N-O 3.13Å; I56-C64 HydrophobicContact CG1-CB 3.54Å; I56-C64 WeakPolarHBondContact O-CA 3.4Å; I56-C64 WeakPolarHBondContact O-CB 3.44Å; I56-C64 PolarHBondContact O-N 3.1Å
65	C	92.8	Very high	83.8	Confident	0 Å²	0	80.7 Å²	80.7	0%	0	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	121.9	179.5	-53.4	0	0	0	0	108.9	G42 S43 C48 E52 L63	G42-C65 CarbonylContact C-O 3.54Å; G42-C65 WeakPolarHBondContact CA-O 3.32Å; S43-C65 PolarHBondContact N-O 3.43Å; S43-C65 PolarHBondContact O-N 3.36Å; C48-C65 WeakPolarHBondContact CA-SG 3.07Å; C48-C65 HydrophobicContact CB-CB 3.7Å; C48-C65 WeakPolarHBondContact CB-SG 3.19Å; C48-C65 VanDerWaalsContact SG-CA 3.52Å; C48-C65 WeakPolarHBondContact SG-CB 3.37Å; C48-C65 CovalentContact SG-SG 2.04Å; C48-C65 PolarHBondContact SG-SG 3.43Å; E52-C65 HydrophobicContact CB-CB 4.04Å; E52-C65 VanDerWaalsContact OE2-CB 3.27Å; E52-C65 WeakPolarHBondContact OE2-CB 3.31Å; L63-C65 PolarHBondContact O-N 3.41Å
66	V	92	Very high	81.8	Confident	0 Å²	0	84.3 Å²	84.3	0%	0	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	141.9	-176.1	-173.2	0	0	0	0	108.7	W38 E52 E53 H55 H70 L71	W38-V66 HydrophobicContact CB-CG2 3.65Å; W38-V66 HydrophobicContact CG-CG1 4.23Å; W38-V66 HydrophobicContact CG-CG2 3.9Å; E52-V66 WeakPolarHBondContact CA-O 3.36Å; E53-V66 PolarHBondContact N-O 3.22Å; E53-V66 PolarHBondContact O-N 3.48Å; H55-V66 HydrophobicContact CB-CG2 4.21Å; V66-H70 HydrophobicContact CG1-CB 4.17Å; V66-L71 HydrophobicContact CB-CD1 3.98Å; V66-L71 HydrophobicContact CB-CG 4.34Å; V66-L71 HydrophobicContact CG1-CD1 4.09Å; V66-L71 HydrophobicContact CG1-CG 4.05Å
67	N	89.3	Confident	81.4	Confident	58 Å²	58	84.5 Å²	84.5	31%	0.31	49%	0.492	S	S	.	.			trans	-69.5	129.6	172.6	-177.6	-34.9	0	0	0	109.4	Q69 H70	N67-Q69 PolarHBondContact O-N 2.96Å; N67-Q69 WeakPolarHBondContact OD1-CB 3.46Å; N67-Q69 WeakPolarHBondContact OD1-CG 3.31Å; N67-Q69 PolarHBondContact OD1-N 3.39Å; N67-H70 WeakPolarHBondContact O-CB 3.48Å; N67-H70 PolarHBondContact O-N 3.35Å
68	P	85.4	Confident	81	Confident	62 Å²	62	83.8 Å²	83.8	40%	0.403	49%	0.491	S	S	.	.	G	3₁₀ helix	trans	-54	-27.2	-177.9	21.3	-34	0	0	0	113.9	K51 H70 L71	K51-P68 WeakPolarHBondContact O-CD 3.44Å; P68-H70 PolarHBondContact O-N 3.03Å; P68-H70 VanDerWaalsContact O-N 3.16Å; P68-L71 PolarHBondContact O-N 3.49Å; P68-L71 VanDerWaalsContact O-N 3.13Å
69	Q	83.8	Confident	80.6	Confident	162 Å²	162	86.1 Å²	86.1	76%	0.757	50%	0.503	S	S	*	.	G	3₁₀ helix	trans	-62.4	-21.9	175.4	-63.7	174.6	2.9	0	0	113.9	N67	N67-Q69 PolarHBondContact O-N 2.96Å; N67-Q69 WeakPolarHBondContact OD1-CB 3.46Å; N67-Q69 WeakPolarHBondContact OD1-CG 3.31Å; N67-Q69 PolarHBondContact OD1-N 3.39Å
70	H	82.4	Confident	80.3	Confident	79 Å²	79	85.5 Å²	85.5	37%	0.366	50%	0.502	S	S	.	.	G	3₁₀ helix	trans	-101	-4.9	-179.4	-62.2	79.4	0	0	0	112.6	W38 R41 V66 N67 P68	W38-H70 PolarHBondContact NE1-O 3.03Å; R41-H70 HydrophobicContact CB-CB 4.27Å; V66-H70 HydrophobicContact CG1-CB 4.17Å; N67-H70 WeakPolarHBondContact O-CB 3.48Å; N67-H70 PolarHBondContact O-N 3.35Å; P68-H70 PolarHBondContact O-N 3.03Å; P68-H70 VanDerWaalsContact O-N 3.16Å
71	L	81.2	Confident	80	Confident	25 Å²	25	82.3 Å²	82.3	13%	0.131	48%	0.481	C	S	.	.	S	Bend	trans	-86.5	144	172.4	-78.2	143.3	0	0	0	108.4	E53 H55 V66 P68 I73	E53-L71 HydrophobicContact CB-CD1 3.91Å; H55-L71 WeakPolarHBondContact ND1-CD2 3.31Å; V66-L71 HydrophobicContact CB-CD1 3.98Å; V66-L71 HydrophobicContact CB-CG 4.34Å; V66-L71 HydrophobicContact CG1-CD1 4.09Å; V66-L71 HydrophobicContact CG1-CG 4.05Å; P68-L71 PolarHBondContact O-N 3.49Å; P68-L71 VanDerWaalsContact O-N 3.13Å; L71-I73 PolarHBondContact O-N 3.42Å
72	P	79.7	Confident	79.5	Confident	89 Å²	89	82.1 Å²	82.1	58%	0.578	48%	0.478	S	S	*	.			trans	-60.4	140.4	170.1	26.8	-32	0	0	0	108.8	L74	P72-L74 PolarHBondContact O-N 3.16Å
73	I	73.2	Confident	78.7	Confident	153 Å²	153	79.4 Å²	79.4	79%	0.785	48%	0.48	S	S	*	.			trans	-60.7	112.1	172.3	-53.7	165.7	0	0	0	105.9	L71 T75	L71-I73 PolarHBondContact O-N 3.42Å; I73-T75 HydrophobicContact CG2-CG2 4.29Å; I73-T75 PolarHBondContact O-N 3.03Å
74	L	65.4	Low	77.6	Confident	159 Å²	159	82 Å²	82	83%	0.832	50%	0.498	S	S	*	.			trans	-68.5	85.8	171.5	-74.7	161	0	0	0	107.3	P72 G76	P72-L74 PolarHBondContact O-N 3.16Å; L74-G76 VanDerWaalsContact C-N 3.35Å; L74-G76 PolarHBondContact O-N 3.39Å; L74-G76 VanDerWaalsContact O-N 3.14Å
75	T	50.3	Low	76.4	Confident	134 Å²	134	88.8 Å²	88.8	82%	0.822	54%	0.54	S	S	*	.			trans	-73.2	93.3	163.4	46.5	0	0	0	0	107.5	I73	I73-T75 HydrophobicContact CG2-CG2 4.29Å; I73-T75 PolarHBondContact O-N 3.03Å
76	G	41.3	Very low	74.9	Confident	145 Å²	145	96.9 Å²	96.9	100%	1.495	59%	0.589	S	S	*	*			trans	-122.3	0	171.5	0	0	0	0	0	109.9	L74	L74-G76 VanDerWaalsContact C-N 3.35Å; L74-G76 PolarHBondContact O-N 3.39Å; L74-G76 VanDerWaalsContact O-N 3.14Å

Retrieved 76 of 76 residues in 41.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).