A0A096MVN5_PAPAN Loading...

Defensin beta 136

AlphaFold DB , UniProt , Accession A0A096MVN5, Species PAPAN (Papio anubis, Olive baboon), Gene DEFB136, Length 78 aa.

						>A0A096MVN5_PAPAN|A0A096MVN5|DEFB136
MNLHLSALLLLLVILLPSGKGMFGNDGVKVRTCTSRKAVCFFGCPPGYQWIAFCHNILSCCKNMTRFQPPQAKEPWSH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.6	Low	79	Confident	228 Å²	228	118.7 Å²	118.7	100%	1.123	64%	0.635	S	S	*	*				0	77	0	-68.1	151.6	63.7	0	0	109.4
2	N	61.9	Low	79.4	Confident	130 Å²	130	116.7 Å²	116.7	70%	0.695	62%	0.623	S	S	*	*			trans	-131.8	-4.9	177.8	-78.7	-31.2	0	0	0	112.7	H4 L5 S6	N2-H4 PolarHBondContact O-N 3.21Å; N2-L5 PolarHBondContact O-N 3.29Å; N2-S6 PolarHBondContact O-N 3.43Å
3	L	67.4	Low	79.4	Confident	150 Å²	150	115.3 Å²	115.3	79%	0.785	62%	0.621	S	S	*	*	H	α-helix	trans	-65.4	-37.3	-178.6	-111.3	79.9	0	0	0	112.4	L5 S6 A7	L3-L5 VanDerWaalsContact C-N 3.34Å; L3-L5 PolarHBondContact O-N 2.76Å; L3-S6 PolarHBondContact O-N 2.91Å; L3-A7 WeakPolarHBondContact O-CB 3.29Å; L3-A7 PolarHBondContact O-N 3.3Å
4	H	79.4	Confident	79.4	Confident	166 Å²	166	116.5 Å²	116.5	77%	0.769	63%	0.625	S	S	*	*	H	α-helix	trans	-64.1	-38.5	-179.8	-70.2	-67.1	0	0	0	112.6	N2 L8	N2-H4 PolarHBondContact O-N 3.21Å; H4-L8 VanDerWaalsContact O-CB 3.25Å; H4-L8 WeakPolarHBondContact O-CB 3.19Å; H4-L8 PolarHBondContact O-N 3.02Å
5	L	84.1	Confident	79.2	Confident	104 Å²	104	117.2 Å²	117.2	55%	0.545	63%	0.628	S	S	.	*	H	α-helix	trans	-69.3	-41.5	177.8	-171	64.6	0	0	0	110.9	N2 L3 L8 L9	N2-L5 PolarHBondContact O-N 3.29Å; L3-L5 VanDerWaalsContact C-N 3.34Å; L3-L5 PolarHBondContact O-N 2.76Å; L5-L8 PolarHBondContact O-N 3.3Å; L5-L9 HydrophobicContact CG-CD1 4.2Å; L5-L9 WeakPolarHBondContact O-CB 3.31Å; L5-L9 VanDerWaalsContact O-CG 3.22Å; L5-L9 WeakPolarHBondContact O-CG 3.4Å; L5-L9 PolarHBondContact O-N 3.14Å
6	S	85.8	Confident	78.3	Confident	70 Å²	70	117.1 Å²	117.1	49%	0.49	63%	0.626	S	S	.	*	H	α-helix	trans	-65	-41.9	177.2	-166.2	0	0	0	0	112.2	N2 L3 L9 L10	N2-S6 PolarHBondContact O-N 3.43Å; L3-S6 PolarHBondContact O-N 2.91Å; S6-L9 PolarHBondContact O-N 3.49Å; S6-L10 WeakPolarHBondContact O-CG 3.41Å; S6-L10 PolarHBondContact O-N 3.49Å
7	A	86.8	Confident	77	Confident	59 Å²	59	115.5 Å²	115.5	49%	0.488	62%	0.624	S	S	.	*	H	α-helix	trans	-65	-40.7	174.7	0	0	0	0	0	112.5	L3 L10 L11	L3-A7 WeakPolarHBondContact O-CB 3.29Å; L3-A7 PolarHBondContact O-N 3.3Å; A7-L10 PolarHBondContact O-N 3.23Å; A7-L11 WeakPolarHBondContact O-CB 3.29Å; A7-L11 PolarHBondContact O-N 3.01Å
8	L	90.8	Very high	75.9	Confident	92 Å²	92	115.6 Å²	115.6	48%	0.482	64%	0.635	S	S	.	*	H	α-helix	trans	-64.1	-42.5	176.5	-176.8	66.1	0	0	0	111.8	H4 L5 L11 L12	H4-L8 VanDerWaalsContact O-CB 3.25Å; H4-L8 WeakPolarHBondContact O-CB 3.19Å; H4-L8 PolarHBondContact O-N 3.02Å; L5-L8 PolarHBondContact O-N 3.3Å; L8-L11 PolarHBondContact O-N 3.26Å; L8-L12 HydrophobicContact CG-CD1 4.15Å; L8-L12 WeakPolarHBondContact O-CB 3.36Å; L8-L12 WeakPolarHBondContact O-CG 3.35Å; L8-L12 PolarHBondContact O-N 2.78Å
9	L	86.8	Confident	74.7	Confident	98 Å²	98	111.8 Å²	111.8	51%	0.513	63%	0.625	S	S	.	*	H	α-helix	trans	-63.5	-41.9	176.7	-72.6	167.3	0	0	0	111.6	L5 S6 L12 V13	L5-L9 HydrophobicContact CG-CD1 4.2Å; L5-L9 WeakPolarHBondContact O-CB 3.31Å; L5-L9 VanDerWaalsContact O-CG 3.22Å; L5-L9 WeakPolarHBondContact O-CG 3.4Å; L5-L9 PolarHBondContact O-N 3.14Å; S6-L9 PolarHBondContact O-N 3.49Å; L9-L12 PolarHBondContact O-N 3.03Å; L9-V13 WeakPolarHBondContact O-CG2 3.42Å; L9-V13 PolarHBondContact O-N 2.92Å
10	L	85.6	Confident	73.6	Confident	108 Å²	108	115 Å²	115	57%	0.565	63%	0.632	S	S	*	*	H	α-helix	trans	-62.9	-44.2	174.3	-74.9	165.6	0	0	0	111.7	S6 A7 L12 V13 I14	S6-L10 WeakPolarHBondContact O-CG 3.41Å; S6-L10 PolarHBondContact O-N 3.49Å; A7-L10 PolarHBondContact O-N 3.23Å; L10-L12 VanDerWaalsContact C-N 3.32Å; L10-L12 PolarHBondContact O-N 3.45Å; L10-V13 PolarHBondContact O-N 3.11Å; L10-I14 WeakPolarHBondContact O-CD1 3.5Å; L10-I14 VanDerWaalsContact O-CG1 3.23Å; L10-I14 WeakPolarHBondContact O-CG1 3.33Å; L10-I14 PolarHBondContact O-N 2.97Å; L10-I14 VanDerWaalsContact O-N 3.08Å
11	L	86.6	Confident	72.8	Confident	101 Å²	101	111.9 Å²	111.9	53%	0.529	63%	0.626	S	S	.	*	H	α-helix	trans	-59.2	-44.5	176.9	-166.2	84	0	0	0	111.4	A7 L8 V13 I14 L15	A7-L11 WeakPolarHBondContact O-CB 3.29Å; A7-L11 PolarHBondContact O-N 3.01Å; L8-L11 PolarHBondContact O-N 3.26Å; L11-V13 PolarHBondContact O-N 2.82Å; L11-I14 PolarHBondContact O-N 3.07Å; L11-L15 HydrophobicContact CG-CD1 4.37Å; L11-L15 WeakPolarHBondContact O-CG 3.46Å; L11-L15 PolarHBondContact O-N 3.36Å; L11-L15 VanDerWaalsContact O-N 3.12Å
12	L	83.8	Confident	73	Confident	94 Å²	94	105.2 Å²	105.2	49%	0.492	59%	0.593	S	S	.	*	H	α-helix	trans	-60.3	-44.9	176.8	-79.1	159.8	0	0	0	111.6	L8 L9 L10 I14 L15 L16	L8-L12 HydrophobicContact CG-CD1 4.15Å; L8-L12 WeakPolarHBondContact O-CB 3.36Å; L8-L12 WeakPolarHBondContact O-CG 3.35Å; L8-L12 PolarHBondContact O-N 2.78Å; L9-L12 PolarHBondContact O-N 3.03Å; L10-L12 VanDerWaalsContact C-N 3.32Å; L10-L12 PolarHBondContact O-N 3.45Å; L12-I14 VanDerWaalsContact C-N 3.33Å; L12-I14 PolarHBondContact O-N 3.31Å; L12-L15 PolarHBondContact O-N 2.92Å; L12-L16 WeakPolarHBondContact O-CD1 3.03Å; L12-L16 PolarHBondContact O-N 2.89Å
13	V	80.3	Confident	73	Confident	99 Å²	99	102.4 Å²	102.4	60%	0.6	58%	0.575	S	S	*	*	H	α-helix	trans	-60.5	-40.2	177.9	171.9	0	0	0	0	112	L9 L10 L11 L15 L16	L9-V13 WeakPolarHBondContact O-CG2 3.42Å; L9-V13 PolarHBondContact O-N 2.92Å; L10-V13 PolarHBondContact O-N 3.11Å; L11-V13 PolarHBondContact O-N 2.82Å; V13-L15 VanDerWaalsContact C-N 3.33Å; V13-L16 PolarHBondContact O-N 2.95Å
14	I	78.4	Confident	72.8	Confident	132 Å²	132	98.7 Å²	98.7	68%	0.677	57%	0.573	S	S	*	*	H	α-helix	trans	-70.7	-31	179.9	-59.8	158.6	0	0	0	111.6	L10 L11 L12 L16	L10-I14 WeakPolarHBondContact O-CD1 3.5Å; L10-I14 VanDerWaalsContact O-CG1 3.23Å; L10-I14 WeakPolarHBondContact O-CG1 3.33Å; L10-I14 PolarHBondContact O-N 2.97Å; L10-I14 VanDerWaalsContact O-N 3.08Å; L11-I14 PolarHBondContact O-N 3.07Å; L12-I14 VanDerWaalsContact C-N 3.33Å; L12-I14 PolarHBondContact O-N 3.31Å; I14-L16 VanDerWaalsContact C-N 3.28Å; I14-L16 PolarHBondContact O-N 3.17Å
15	L	77.1	Confident	72.6	Confident	127 Å²	127	94.4 Å²	94.4	67%	0.665	56%	0.556	S	S	*	*	H	α-helix	trans	-76.1	-12.4	177.2	-71.9	170.1	0	0	0	113.5	L11 L12 V13 P17	L11-L15 HydrophobicContact CG-CD1 4.37Å; L11-L15 WeakPolarHBondContact O-CG 3.46Å; L11-L15 PolarHBondContact O-N 3.36Å; L11-L15 VanDerWaalsContact O-N 3.12Å; L12-L15 PolarHBondContact O-N 2.92Å; V13-L15 VanDerWaalsContact C-N 3.33Å; L15-P17 WeakPolarHBondContact O-CD 3.23Å
16	L	64.6	Low	72.4	Confident	115 Å²	115	96.6 Å²	96.6	60%	0.602	57%	0.568	S	S	*	*	S	Bend	trans	-64.9	126.3	172.6	-82.8	114.5	0	0	0	109.1	L12 V13 I14 S18	L12-L16 WeakPolarHBondContact O-CD1 3.03Å; L12-L16 PolarHBondContact O-N 2.89Å; V13-L16 PolarHBondContact O-N 2.95Å; I14-L16 VanDerWaalsContact C-N 3.28Å; I14-L16 PolarHBondContact O-N 3.17Å; L16-S18 PolarHBondContact O-N 2.03Å
17	P	56.8	Low	72.5	Confident	91 Å²	91	94.3 Å²	94.3	59%	0.591	56%	0.556	S	S	*	*			trans	-63.9	101.4	178.5	25.3	-32.3	0	0	0	108.9	L15 G19 K20	L15-P17 WeakPolarHBondContact O-CD 3.23Å; P17-G19 PolarHBondContact O-N 3.41Å; P17-K20 HydrophobicContact CB-CG 4.17Å; P17-K20 HydrophobicContact CG-CG 4.14Å; P17-K20 PolarHBondContact O-N 3.46Å
18	S	57.1	Low	72.6	Confident	117 Å²	117	95.1 Å²	95.1	82%	0.818	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	-14.3	176.9	13.7	0	0	0	0	112.2	L16	L16-S18 PolarHBondContact O-N 2.03Å
19	G	52.6	Low	72.7	Confident	43 Å²	43	99.1 Å²	99.1	44%	0.443	57%	0.568	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.6	-21.2	-178.1	0	0	0	0	0	116.4	P17 G21 M22	P17-G19 PolarHBondContact O-N 3.41Å; G19-G21 VanDerWaalsContact C-N 3.29Å; G19-G21 PolarHBondContact O-N 2.82Å; G19-M22 PolarHBondContact O-N 3.44Å
20	K	52.8	Low	73	Confident	175 Å²	175	95.2 Å²	95.2	76%	0.761	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.7	-15.9	-174.3	-71.7	-121.5	-177.5	-175.8	0	114.1	P17	P17-K20 HydrophobicContact CB-CG 4.17Å; P17-K20 HydrophobicContact CG-CG 4.14Å; P17-K20 PolarHBondContact O-N 3.46Å
21	G	56.1	Low	73.4	Confident	50 Å²	50	101.1 Å²	101.1	52%	0.515	56%	0.563	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.8	-19.8	177.5	0	0	0	0	0	114.4	G19 N25	G19-G21 VanDerWaalsContact C-N 3.29Å; G19-G21 PolarHBondContact O-N 2.82Å; G21-N25 WeakPolarHBondContact O-CB 3.03Å; G21-N25 PolarHBondContact O-ND2 2.97Å
22	M	59.2	Low	73.6	Confident	89 Å²	89	100.9 Å²	100.9	44%	0.438	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.6	-34.4	-172.6	-171.4	163.2	74.7	0	0	112.9	G19 P46	G19-M22 PolarHBondContact O-N 3.44Å; M22-P46 HydrophobicContact SD-CG 4.22Å
23	F	61.8	Low	74.1	Confident	70 Å²	70	96.5 Å²	96.5	31%	0.307	54%	0.543	S	S	.	.	S	Bend	trans	-120.8	138.4	-178.6	-65.8	-64.2	0	0	0	109.8	N25 E74	F23-N25 VanDerWaalsContact C-N 3.3Å; F23-N25 PolarHBondContact O-N 3.33Å; F23-E74 WeakPolarHBondContact CB-OE1 3.25Å; F23-E74 HydrophobicContact CD1-CG 3.55Å; F23-E74 HydrophobicContact CE1-CG 3.94Å; F23-E74 HydrophobicContact CG-CG 4.27Å
24	G	63.4	Low	74.8	Confident	73 Å²	73	94.9 Å²	94.9	75%	0.753	53%	0.533	S	S	*	.	S	Bend	trans	74.9	9.4	-173.8	0	0	0	0	0	115.9
25	N	73.6	Confident	75.6	Confident	76 Å²	76	93 Å²	93	41%	0.406	53%	0.532	S	S	.	.			trans	-94.5	115	171.1	-179.6	-0.5	0	0	0	109.4	G21 F23 G27 F41	G21-N25 WeakPolarHBondContact O-CB 3.03Å; G21-N25 PolarHBondContact O-ND2 2.97Å; F23-N25 VanDerWaalsContact C-N 3.3Å; F23-N25 PolarHBondContact O-N 3.33Å; N25-G27 PolarHBondContact O-N 2.83Å; N25-G27 WeakPolarHBondContact OD1-CA 3.44Å; N25-G27 PolarHBondContact OD1-N 3.49Å; N25-F41 WeakPolarHBondContact O-CE1 3.09Å
26	D	81.6	Confident	76.5	Confident	149 Å²	149	94.1 Å²	94.1	80%	0.797	53%	0.527	S	S	*	.			trans	-76.1	-4.2	178.7	-69.1	-37.5	0	0	0	113.8
27	G	86.9	Confident	77.9	Confident	22 Å²	22	97.5 Å²	97.5	23%	0.227	54%	0.537	C	S	.	.			trans	68.8	-171.2	-177.1	0	0	0	0	0	113.2	N25 C40	N25-G27 PolarHBondContact O-N 2.83Å; N25-G27 WeakPolarHBondContact OD1-CA 3.44Å; N25-G27 PolarHBondContact OD1-N 3.49Å; G27-C40 CarbonylContact C-O 3.51Å; G27-C40 WeakPolarHBondContact CA-O 3.32Å
28	V	89.6	Confident	79.8	Confident	76 Å²	76	93.3 Å²	93.3	46%	0.461	51%	0.51	S	S	.	.	B	Isolated β-bridge	trans	-113.9	129.1	-178.2	-175.8	0	0	0	0	110	V30 C40 L58	V28-V30 HydrophobicContact CG1-CG2 4.26Å; V28-V30 PolarHBondContact O-N 2.88Å; V28-C40 HydrophobicContact CB-CB 4.36Å; V28-C40 PolarHBondContact N-O 3.26Å; V28-C40 VanDerWaalsContact O-CB 3.32Å; V28-C40 WeakPolarHBondContact O-CB 3.42Å; V28-C40 PolarHBondContact O-N 3.01Å; V28-L58 HydrophobicContact CG2-CD1 4.45Å
29	K	92.8	Very high	81.5	Confident	177 Å²	177	89.7 Å²	89.7	77%	0.77	48%	0.483	S	S	*	.			trans	-83.8	112	176.9	-66.5	178.3	-176	172.7	0	110.1
30	V	92.9	Very high	83.5	Confident	16 Å²	16	87.6 Å²	87.6	10%	0.097	46%	0.462	C	S	.	.			trans	-116.1	125.6	175	178.9	0	0	0	0	108.6	V28 T32 C33 T34 C40 C54	V28-V30 HydrophobicContact CG1-CG2 4.26Å; V28-V30 PolarHBondContact O-N 2.88Å; V30-T32 PolarHBondContact O-N 3.07Å; V30-C33 HydrophobicContact CB-CB 4.35Å; V30-C33 WeakPolarHBondContact O-CA 3.42Å; V30-C33 PolarHBondContact O-N 2.03Å; V30-T34 PolarHBondContact O-N 2.75Å; V30-T34 PolarHBondContact O-OG1 3.03Å; V30-T34 VanDerWaalsContact O-OG1 3.07Å; V30-C40 HydrophobicContact CG2-CB 4.31Å; V30-C40 WeakPolarHBondContact CG2-SG 3.23Å; V30-C54 HydrophobicContact CG2-CB 4.36Å
31	R	92.9	Very high	85.3	Confident	231 Å²	231	80.2 Å²	80.2	87%	0.872	43%	0.43	S	S	*	.	H	α-helix	trans	-46.9	-43.7	-170.1	-174.9	178.4	179.6	-177.4	0.5	113.9	S35	R31-S35 PolarHBondContact O-N 3.45Å; R31-S35 VanDerWaalsContact O-N 3.07Å
32	T	91.6	Very high	86.8	Confident	96 Å²	96	85.5 Å²	85.5	59%	0.589	44%	0.439	S	S	*	.	H	α-helix	trans	-71.9	-31.4	-179.2	52.1	0	0	0	0	113.8	V30 S35	V30-T32 PolarHBondContact O-N 3.07Å; T32-S35 PolarHBondContact O-OG 3.02Å
33	C	94.2	Very high	88.2	Confident	3 Å²	3	83 Å²	83	2%	0.02	44%	0.436	C	S	.	.	H	α-helix	trans	-79.9	-44.4	174.8	-175.2	0	0	0	0	110.6	V30 S35 R36 A38 C60	V30-C33 HydrophobicContact CB-CB 4.35Å; V30-C33 WeakPolarHBondContact O-CA 3.42Å; V30-C33 PolarHBondContact O-N 2.03Å; C33-S35 VanDerWaalsContact C-N 3.29Å; C33-S35 PolarHBondContact O-N 2.03Å; C33-R36 WeakPolarHBondContact O-CB 3.46Å; C33-R36 PolarHBondContact O-N 2.87Å; C33-A38 CarbonylContact C-O 3.52Å; C33-A38 PolarHBondContact O-N 3.29Å; C33-A38 VanDerWaalsContact SG-C 3.53Å; C33-A38 VanDerWaalsContact SG-CB 3.58Å; C33-C60 VanDerWaalsContact CA-SG 3.52Å; C33-C60 HydrophobicContact CB-CB 3.97Å; C33-C60 WeakPolarHBondContact CB-SG 3.32Å; C33-C60 WeakPolarHBondContact SG-CA 3.49Å; C33-C60 WeakPolarHBondContact SG-CB 3.05Å; C33-C60 CovalentContact SG-SG 2.03Å; C33-C60 PolarHBondContact SG-SG 3.31Å
34	T	95.2	Very high	89.5	Confident	64 Å²	64	81.7 Å²	81.7	39%	0.393	44%	0.435	S	S	.	.	H	α-helix	trans	-61.3	-35.1	178.9	-52.2	0	0	0	0	112.4	V30 R36 K37 A38	V30-T34 PolarHBondContact O-N 2.75Å; V30-T34 PolarHBondContact O-OG1 3.03Å; V30-T34 VanDerWaalsContact O-OG1 3.07Å; T34-R36 PolarHBondContact O-N 2.84Å; T34-R36 VanDerWaalsContact O-N 3.11Å; T34-K37 PolarHBondContact O-N 2.88Å; T34-A38 WeakPolarHBondContact CA-O 3.06Å; T34-A38 PolarHBondContact N-O 3.34Å
35	S	95.7	Very high	90.7	Very high	93 Å²	93	79.3 Å²	79.3	65%	0.65	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61	-20.2	175	68.5	0	0	0	0	113.5	R31 T32 C33	R31-S35 PolarHBondContact O-N 3.45Å; R31-S35 VanDerWaalsContact O-N 3.07Å; T32-S35 PolarHBondContact O-OG 3.02Å; C33-S35 VanDerWaalsContact C-N 3.29Å; C33-S35 PolarHBondContact O-N 2.03Å
36	R	94.3	Very high	91.5	Very high	150 Å²	150	77.9 Å²	77.9	57%	0.566	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94	10.6	174.7	-58.9	-169.5	177	-160.8	-0.7	113.8	C33 T34 A38	C33-R36 WeakPolarHBondContact O-CB 3.46Å; C33-R36 PolarHBondContact O-N 2.87Å; T34-R36 PolarHBondContact O-N 2.84Å; T34-R36 VanDerWaalsContact O-N 3.11Å; R36-A38 VanDerWaalsContact C-N 3.31Å
37	K	95.6	Very high	91.9	Very high	186 Å²	186	70.9 Å²	70.9	81%	0.809	36%	0.364	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.8	43.1	-172.4	-52.6	-178.7	-179.9	-177.7	0	111.7	T34	T34-K37 PolarHBondContact O-N 2.88Å
38	A	95.3	Very high	92.1	Very high	3 Å²	3	73.6 Å²	73.6	3%	0.025	37%	0.368	C	S	.	.			trans	-130.3	164.6	-178.8	0	0	0	0	0	110.5	C33 T34 R36 I51 C60 C61 K62	C33-A38 CarbonylContact C-O 3.52Å; C33-A38 PolarHBondContact O-N 3.29Å; C33-A38 VanDerWaalsContact SG-C 3.53Å; C33-A38 VanDerWaalsContact SG-CB 3.58Å; T34-A38 WeakPolarHBondContact CA-O 3.06Å; T34-A38 PolarHBondContact N-O 3.34Å; R36-A38 VanDerWaalsContact C-N 3.31Å; A38-I51 HydrophobicContact CB-CD1 4.28Å; A38-C60 VanDerWaalsContact CB-SG 3.59Å; A38-C61 WeakPolarHBondContact CA-O 3.31Å; A38-C61 WeakPolarHBondContact CB-O 3.08Å; A38-K62 HydrophobicContact CB-CB 4Å
39	V	94.1	Very high	92.3	Very high	41 Å²	41	75.8 Å²	75.8	25%	0.248	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	149.8	-178.2	-177.7	0	0	0	0	109.5	F41 C61	V39-F41 HydrophobicContact CB-CE2 3.8Å; V39-F41 HydrophobicContact CB-CZ 4.22Å; V39-F41 HydrophobicContact CG1-CE2 3.97Å; V39-F41 HydrophobicContact CG1-CZ 4.04Å; V39-C61 PolarHBondContact N-O 3.04Å; V39-C61 PolarHBondContact O-N 3.49Å
40	C	93	Very high	92.4	Very high	0 Å²	0	73.1 Å²	73.1	0%	0	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.7	133.6	-179.1	-55.2	0	0	0	0	111.8	G27 V28 V30 C54 L58 S59	G27-C40 CarbonylContact C-O 3.51Å; G27-C40 WeakPolarHBondContact CA-O 3.32Å; V28-C40 HydrophobicContact CB-CB 4.36Å; V28-C40 PolarHBondContact N-O 3.26Å; V28-C40 VanDerWaalsContact O-CB 3.32Å; V28-C40 WeakPolarHBondContact O-CB 3.42Å; V28-C40 PolarHBondContact O-N 3.01Å; V30-C40 HydrophobicContact CG2-CB 4.31Å; V30-C40 WeakPolarHBondContact CG2-SG 3.23Å; C40-C54 HydrophobicContact CB-CB 3.73Å; C40-C54 WeakPolarHBondContact CB-SG 3.38Å; C40-C54 WeakPolarHBondContact SG-CB 3.37Å; C40-C54 CovalentContact SG-SG 2.03Å; C40-C54 PolarHBondContact SG-SG 3.23Å; C40-L58 HydrophobicContact CB-CB 4.31Å; C40-L58 HydrophobicContact CB-CD1 4.47Å; C40-S59 CarbonylContact C-O 3.59Å; C40-S59 VanDerWaalsContact CA-O 3.23Å; C40-S59 WeakPolarHBondContact CA-O 3.02Å
41	F	91.3	Very high	92.5	Very high	19 Å²	19	74.9 Å²	74.9	8%	0.083	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	162.9	177	-65	-85.1	0	0	0	111.5	N25 V39 G43 P45 Y48 L58 S59 C61	N25-F41 WeakPolarHBondContact O-CE1 3.09Å; V39-F41 HydrophobicContact CB-CE2 3.8Å; V39-F41 HydrophobicContact CB-CZ 4.22Å; V39-F41 HydrophobicContact CG1-CE2 3.97Å; V39-F41 HydrophobicContact CG1-CZ 4.04Å; F41-G43 VanDerWaalsContact C-N 3.28Å; F41-G43 WeakPolarHBondContact CB-O 3.44Å; F41-G43 PolarHBondContact O-N 3.38Å; F41-P45 HydrophobicContact CD1-CG 4.48Å; F41-P45 HydrophobicContact CD2-CG 4.33Å; F41-P45 HydrophobicContact CE2-CG 4.41Å; F41-P45 HydrophobicContact CG-CG 4.35Å; F41-Y48 HydrophobicContact CE2-CD1 4.21Å; F41-Y48 HydrophobicContact CE2-CE1 4.06Å; F41-Y48 HydrophobicContact CZ-CE1 4.46Å; F41-L58 CarbonylContact O-C 3.55Å; F41-L58 WeakPolarHBondContact O-CA 3.23Å; F41-S59 PolarHBondContact N-O 3.08Å; F41-S59 PolarHBondContact O-N 3.43Å; F41-C61 HydrophobicContact CD2-CB 3.83Å; F41-C61 HydrophobicContact CE2-CB 4.35Å
42	F	88.6	Confident	92.6	Very high	161 Å²	161	65.6 Å²	65.6	71%	0.706	34%	0.339	S	S	*	.	S	Bend	trans	-79.1	79.8	170.7	-167.1	-100.1	0	0	0	109.7	I57 L58	F42-I57 HydrophobicContact CD2-CD1 4.31Å; F42-I57 HydrophobicContact CD2-CG1 4.27Å; F42-I57 HydrophobicContact CE2-CB 4.45Å; F42-I57 HydrophobicContact CE2-CD1 3.73Å; F42-I57 HydrophobicContact CE2-CG1 3.99Å; F42-L58 HydrophobicContact CB-CD2 4.1Å; F42-L58 HydrophobicContact CD2-CD2 4.17Å
43	G	87.4	Confident	92.7	Very high	36 Å²	36	67.8 Å²	67.8	37%	0.371	34%	0.341	S	S	.	.	S	Bend	trans	79.5	150.5	-162.8	0	0	0	0	0	111.8	F41	F41-G43 VanDerWaalsContact C-N 3.28Å; F41-G43 WeakPolarHBondContact CB-O 3.44Å; F41-G43 PolarHBondContact O-N 3.38Å
44	C	90.1	Very high	92.5	Very high	43 Å²	43	67.9 Å²	67.9	29%	0.291	34%	0.341	S	S	.	.	P	Polyproline II helix	trans	-78.9	128.9	-178.8	-65.3	0	0	0	0	111.9	W50 C61	C44-W50 WeakPolarHBondContact SG-CA 3.4Å; C44-C61 WeakPolarHBondContact CA-SG 3.49Å; C44-C61 HydrophobicContact CB-CB 3.82Å; C44-C61 WeakPolarHBondContact CB-SG 3.45Å; C44-C61 WeakPolarHBondContact SG-CB 3.4Å; C44-C61 CovalentContact SG-SG 2.03Å; C44-C61 PolarHBondContact SG-SG 3.24Å
45	P	89.1	Confident	91.6	Very high	23 Å²	23	72.8 Å²	72.8	15%	0.149	36%	0.36	C	S	.	.	P	Polyproline II helix	trans	-67.4	158.5	174.7	25.4	-30.1	0	0	0	111.4	F41 G47 Y48	F41-P45 HydrophobicContact CD1-CG 4.48Å; F41-P45 HydrophobicContact CD2-CG 4.33Å; F41-P45 HydrophobicContact CE2-CG 4.41Å; F41-P45 HydrophobicContact CG-CG 4.35Å; P45-G47 PolarHBondContact O-N 3.05Å; P45-Y48 HydrophobicContact CB-CD2 4.38Å; P45-Y48 HydrophobicContact CG-CD2 3.6Å; P45-Y48 HydrophobicContact CG-CE2 4.03Å; P45-Y48 HydrophobicContact CG-CG 3.94Å; P45-Y48 WeakPolarHBondContact O-CB 3.48Å; P45-Y48 PolarHBondContact O-N 2.82Å
46	P	89.2	Confident	90.5	Very high	46 Å²	46	74.8 Å²	74.8	30%	0.299	36%	0.363	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.5	138.5	172.6	-24.4	34	0	0	0	111.4	M22 Y48 P69 Q71	M22-P46 HydrophobicContact SD-CG 4.22Å; P46-Y48 VanDerWaalsContact C-N 3.3Å; P46-P69 HydrophobicContact CB-CG 4.21Å; P46-Q71 HydrophobicContact CB-CB 4Å; P46-Q71 HydrophobicContact CG-CB 4.32Å
47	G	90.2	Very high	90	Very high	2 Å²	2	73.1 Å²	73.1	2%	0.021	36%	0.364	C	S	.	.	T	Hydrogen-bonded Turn	trans	87.1	-5	-174	0	0	0	0	0	114.6	P45 N63 M64 A72	P45-G47 PolarHBondContact O-N 3.05Å; G47-N63 PolarHBondContact O-OD1 3.43Å; G47-M64 VanDerWaalsContact CA-CE 3.48Å; G47-M64 VanDerWaalsContact O-CB 3.29Å; G47-M64 WeakPolarHBondContact O-CB 3.22Å; G47-M64 WeakPolarHBondContact O-CG 3.32Å; G47-M64 PolarHBondContact O-N 2.94Å; G47-A72 VanDerWaalsContact CA-CB 3.46Å
48	Y	92.3	Very high	89.7	Confident	80 Å²	80	66.4 Å²	66.4	31%	0.314	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	140.8	173.6	-68.5	-114.5	0	0	0	111.5	F41 P45 P46 C61 K62 N63	F41-Y48 HydrophobicContact CE2-CD1 4.21Å; F41-Y48 HydrophobicContact CE2-CE1 4.06Å; F41-Y48 HydrophobicContact CZ-CE1 4.46Å; P45-Y48 HydrophobicContact CB-CD2 4.38Å; P45-Y48 HydrophobicContact CG-CD2 3.6Å; P45-Y48 HydrophobicContact CG-CE2 4.03Å; P45-Y48 HydrophobicContact CG-CG 3.94Å; P45-Y48 WeakPolarHBondContact O-CB 3.48Å; P45-Y48 PolarHBondContact O-N 2.82Å; P46-Y48 VanDerWaalsContact C-N 3.3Å; Y48-C61 HydrophobicContact CD1-CB 4.07Å; Y48-C61 HydrophobicContact CG-CB 4.38Å; Y48-K62 CarbonylContact C-O 3.52Å; Y48-K62 VanDerWaalsContact CA-O 3.31Å; Y48-K62 WeakPolarHBondContact CA-O 3.39Å; Y48-N63 HydrophobicContact CD1-CB 4.19Å; Y48-N63 HydrophobicContact CE1-CB 3.88Å
49	Q	93.6	Very high	89.6	Confident	121 Å²	121	66.8 Å²	66.8	57%	0.565	34%	0.34	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.2	132.9	174.4	-176.2	177.4	6.6	0	0	110.2	C61 K62 M64	Q49-C61 CarbonylContact O-C 3.59Å; Q49-C61 WeakPolarHBondContact O-CA 3.45Å; Q49-K62 PolarHBondContact N-O 2.94Å; Q49-K62 PolarHBondContact O-N 2.77Å; Q49-M64 HydrophobicContact CB-CG 3.8Å; Q49-M64 HydrophobicContact CB-SD 4.2Å
50	W	94.8	Very high	89.7	Confident	122 Å²	122	65 Å²	65	46%	0.462	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.3	135.3	171.5	-175.1	95.6	0	0	0	111.4	C44 F53 S59	C44-W50 WeakPolarHBondContact SG-CA 3.4Å; W50-F53 HydrophobicContact CH2-CE2 4.44Å; W50-F53 AromaticContact CZ2-CD2 3.89Å; W50-F53 HydrophobicContact CZ2-CD2 3.89Å; W50-F53 HydrophobicContact CZ2-CE1 4.48Å; W50-F53 AromaticContact CZ2-CE2 3.77Å; W50-F53 HydrophobicContact CZ2-CE2 3.77Å; W50-F53 HydrophobicContact CZ2-CG 4.3Å; W50-F53 HydrophobicContact CZ2-CZ 4.08Å; W50-S59 VanDerWaalsContact CD1-CB 3.49Å; W50-S59 PolarHBondContact NE1-OG 2.76Å
51	I	95	Very high	89.7	Confident	52 Å²	52	65 Å²	65	27%	0.267	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	-42	179.9	-59.6	174.8	0	0	0	112.4	A38 C60 K62	A38-I51 HydrophobicContact CB-CD1 4.28Å; I51-C60 PolarHBondContact N-O 3.47Å; I51-K62 HydrophobicContact CD1-CB 3.36Å; I51-K62 HydrophobicContact CD1-CD 3.8Å; I51-K62 HydrophobicContact CD1-CG 4.24Å; I51-K62 HydrophobicContact CG1-CB 4.28Å
52	A	94.6	Very high	89.9	Confident	36 Å²	36	68.4 Å²	68.4	30%	0.298	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-164.7	173	-174.5	0	0	0	0	0	110.7	C60	A52-C60 HydrophobicContact CB-CB 4.32Å; A52-C60 VanDerWaalsContact O-CB 3.31Å; A52-C60 WeakPolarHBondContact O-CB 3.37Å; A52-C60 PolarHBondContact O-N 3.33Å
53	F	93.2	Very high	90.1	Very high	143 Å²	143	64.5 Å²	64.5	63%	0.627	33%	0.33	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.4	143.1	167.4	-70.3	-72.8	0	0	0	111.9	W50 N56 L58	W50-F53 HydrophobicContact CH2-CE2 4.44Å; W50-F53 AromaticContact CZ2-CD2 3.89Å; W50-F53 HydrophobicContact CZ2-CD2 3.89Å; W50-F53 HydrophobicContact CZ2-CE1 4.48Å; W50-F53 AromaticContact CZ2-CE2 3.77Å; W50-F53 HydrophobicContact CZ2-CE2 3.77Å; W50-F53 HydrophobicContact CZ2-CG 4.3Å; W50-F53 HydrophobicContact CZ2-CZ 4.08Å; F53-N56 WeakPolarHBondContact CD1-O 3.36Å; F53-L58 CarbonylContact C-O 3.58Å; F53-L58 WeakPolarHBondContact CA-O 3.4Å
54	C	90.3	Very high	90.3	Very high	4 Å²	4	65 Å²	65	3%	0.027	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	116.7	164.9	-55.8	0	0	0	0	108.5	V30 C40 N56 L58 C60	V30-C54 HydrophobicContact CG2-CB 4.36Å; C40-C54 HydrophobicContact CB-CB 3.73Å; C40-C54 WeakPolarHBondContact CB-SG 3.38Å; C40-C54 WeakPolarHBondContact SG-CB 3.37Å; C40-C54 CovalentContact SG-SG 2.03Å; C40-C54 PolarHBondContact SG-SG 3.23Å; C54-N56 VanDerWaalsContact C-N 3.26Å; C54-N56 PolarHBondContact O-N 3.12Å; C54-L58 HydrophobicContact CB-CB 3.86Å; C54-L58 PolarHBondContact N-O 3.34Å; C54-C60 VanDerWaalsContact SG-CA 3.57Å; C54-C60 VanDerWaalsContact SG-CB 3.5Å
55	H	76.5	Confident	90.3	Very high	168 Å²	168	69.4 Å²	69.4	78%	0.778	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	33	51.7	171.2	-60.9	-41	0	0	0	115.2
56	N	73.1	Confident	90.3	Very high	135 Å²	135	77.5 Å²	77.5	72%	0.722	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	106.4	-100.6	177	-146.6	-23.6	0	0	0	114.9	F53 C54	F53-N56 WeakPolarHBondContact CD1-O 3.36Å; C54-N56 VanDerWaalsContact C-N 3.26Å; C54-N56 PolarHBondContact O-N 3.12Å
57	I	82.2	Confident	90.2	Very high	114 Å²	114	84.8 Å²	84.8	59%	0.585	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.7	-11.7	-167.1	69.8	-171.4	0	0	0	114.8	F42	F42-I57 HydrophobicContact CD2-CD1 4.31Å; F42-I57 HydrophobicContact CD2-CG1 4.27Å; F42-I57 HydrophobicContact CE2-CB 4.45Å; F42-I57 HydrophobicContact CE2-CD1 3.73Å; F42-I57 HydrophobicContact CE2-CG1 3.99Å
58	L	90.4	Very high	90.1	Very high	46 Å²	46	88.8 Å²	88.8	24%	0.241	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	145.9	179.6	-65	176.3	0	0	0	110.2	V28 C40 F41 F42 F53 C54	V28-L58 HydrophobicContact CG2-CD1 4.45Å; C40-L58 HydrophobicContact CB-CB 4.31Å; C40-L58 HydrophobicContact CB-CD1 4.47Å; F41-L58 CarbonylContact O-C 3.55Å; F41-L58 WeakPolarHBondContact O-CA 3.23Å; F42-L58 HydrophobicContact CB-CD2 4.1Å; F42-L58 HydrophobicContact CD2-CD2 4.17Å; F53-L58 CarbonylContact C-O 3.58Å; F53-L58 WeakPolarHBondContact CA-O 3.4Å; C54-L58 HydrophobicContact CB-CB 3.86Å; C54-L58 PolarHBondContact N-O 3.34Å
59	S	93.1	Very high	89.8	Confident	11 Å²	11	86.9 Å²	86.9	8%	0.077	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	128.4	177.6	-70.4	0	0	0	0	110.4	C40 F41 W50 C61	C40-S59 CarbonylContact C-O 3.59Å; C40-S59 VanDerWaalsContact CA-O 3.23Å; C40-S59 WeakPolarHBondContact CA-O 3.02Å; F41-S59 PolarHBondContact N-O 3.08Å; F41-S59 PolarHBondContact O-N 3.43Å; W50-S59 VanDerWaalsContact CD1-CB 3.49Å; W50-S59 PolarHBondContact NE1-OG 2.76Å; S59-C61 PolarHBondContact O-N 2.93Å; S59-C61 PolarHBondContact O-SG 3.39Å
60	C	95.4	Very high	89.4	Confident	4 Å²	4	86.7 Å²	86.7	3%	0.027	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.9	112.7	168.6	-176	0	0	0	0	108.9	C33 A38 I51 A52 C54	C33-C60 VanDerWaalsContact CA-SG 3.52Å; C33-C60 HydrophobicContact CB-CB 3.97Å; C33-C60 WeakPolarHBondContact CB-SG 3.32Å; C33-C60 WeakPolarHBondContact SG-CA 3.49Å; C33-C60 WeakPolarHBondContact SG-CB 3.05Å; C33-C60 CovalentContact SG-SG 2.03Å; C33-C60 PolarHBondContact SG-SG 3.31Å; A38-C60 VanDerWaalsContact CB-SG 3.59Å; I51-C60 PolarHBondContact N-O 3.47Å; A52-C60 HydrophobicContact CB-CB 4.32Å; A52-C60 VanDerWaalsContact O-CB 3.31Å; A52-C60 WeakPolarHBondContact O-CB 3.37Å; A52-C60 PolarHBondContact O-N 3.33Å; C54-C60 VanDerWaalsContact SG-CA 3.57Å; C54-C60 VanDerWaalsContact SG-CB 3.5Å
61	C	94.6	Very high	89	Confident	0 Å²	0	86.6 Å²	86.6	0%	0	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	133.7	-170.3	-51.9	0	0	0	0	110.5	A38 V39 F41 C44 Y48 Q49 S59	A38-C61 WeakPolarHBondContact CA-O 3.31Å; A38-C61 WeakPolarHBondContact CB-O 3.08Å; V39-C61 PolarHBondContact N-O 3.04Å; V39-C61 PolarHBondContact O-N 3.49Å; F41-C61 HydrophobicContact CD2-CB 3.83Å; F41-C61 HydrophobicContact CE2-CB 4.35Å; C44-C61 WeakPolarHBondContact CA-SG 3.49Å; C44-C61 HydrophobicContact CB-CB 3.82Å; C44-C61 WeakPolarHBondContact CB-SG 3.45Å; C44-C61 WeakPolarHBondContact SG-CB 3.4Å; C44-C61 CovalentContact SG-SG 2.03Å; C44-C61 PolarHBondContact SG-SG 3.24Å; Y48-C61 HydrophobicContact CD1-CB 4.07Å; Y48-C61 HydrophobicContact CG-CB 4.38Å; Q49-C61 CarbonylContact O-C 3.59Å; Q49-C61 WeakPolarHBondContact O-CA 3.45Å; S59-C61 PolarHBondContact O-N 2.93Å; S59-C61 PolarHBondContact O-SG 3.39Å
62	K	95.3	Very high	88.4	Confident	89 Å²	89	85.5 Å²	85.5	39%	0.387	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	133.7	178.1	-176.9	170.3	-176.3	172.6	0	110.5	A38 Y48 Q49 I51 M64	A38-K62 HydrophobicContact CB-CB 4Å; Y48-K62 CarbonylContact C-O 3.52Å; Y48-K62 VanDerWaalsContact CA-O 3.31Å; Y48-K62 WeakPolarHBondContact CA-O 3.39Å; Q49-K62 PolarHBondContact N-O 2.94Å; Q49-K62 PolarHBondContact O-N 2.77Å; I51-K62 HydrophobicContact CD1-CB 3.36Å; I51-K62 HydrophobicContact CD1-CD 3.8Å; I51-K62 HydrophobicContact CD1-CG 4.24Å; I51-K62 HydrophobicContact CG1-CB 4.28Å; K62-M64 PolarHBondContact O-N 3.32Å
63	N	92.6	Very high	87.5	Confident	80 Å²	80	90.6 Å²	90.6	43%	0.428	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.8	126.1	177.5	-169.1	-13.6	0	0	0	110.1	G47 Y48 Q68	G47-N63 PolarHBondContact O-OD1 3.43Å; Y48-N63 HydrophobicContact CD1-CB 4.19Å; Y48-N63 HydrophobicContact CE1-CB 3.88Å; N63-Q68 PolarHBondContact OD1-NE2 3.04Å
64	M	91.4	Very high	86.4	Confident	46 Å²	46	87.8 Å²	87.8	23%	0.227	44%	0.436	C	S	.	.			trans	-76.4	129.9	177.2	-63.2	-169.2	-67.5	0	0	109.4	G47 Q49 K62 Q68 P69	G47-M64 VanDerWaalsContact CA-CE 3.48Å; G47-M64 VanDerWaalsContact O-CB 3.29Å; G47-M64 WeakPolarHBondContact O-CB 3.22Å; G47-M64 WeakPolarHBondContact O-CG 3.32Å; G47-M64 PolarHBondContact O-N 2.94Å; Q49-M64 HydrophobicContact CB-CG 3.8Å; Q49-M64 HydrophobicContact CB-SD 4.2Å; K62-M64 PolarHBondContact O-N 3.32Å; M64-Q68 HydrophobicContact CB-CG 4.35Å; M64-Q68 VanDerWaalsContact O-CG 3.29Å; M64-Q68 WeakPolarHBondContact O-CG 3.44Å; M64-Q68 PolarHBondContact O-NE2 3.43Å; M64-P69 HydrophobicContact CE-CG 4.46Å
65	T	89.3	Confident	85.1	Confident	135 Å²	135	92.2 Å²	92.2	83%	0.828	47%	0.465	S	S	*	.	S	Bend	trans	-94.7	-9.6	175.5	56.5	0	0	0	0	113
66	R	88.5	Confident	84.5	Confident	194 Å²	194	94.2 Å²	94.2	73%	0.732	47%	0.466	S	S	*	.	S	Bend	trans	-133.4	150.2	179.1	-64	-172.5	-179.9	-175.1	-0	109.6	Q68	R66-Q68 VanDerWaalsContact C-N 3.26Å; R66-Q68 PolarHBondContact O-N 3.4Å
67	F	87.8	Confident	84.1	Confident	198 Å²	198	91.5 Å²	91.5	87%	0.868	46%	0.458	S	S	*	.	S	Bend	trans	54.7	38.6	177.5	-48.1	-68.3	0	0	0	113.9
68	Q	87.8	Confident	82.6	Confident	87 Å²	87	98.3 Å²	98.3	41%	0.407	49%	0.487	S	S	.	.			trans	-62.9	128.7	175	-72.3	-174.8	-22.4	0	0	109.7	N63 M64 R66 A72	N63-Q68 PolarHBondContact OD1-NE2 3.04Å; M64-Q68 HydrophobicContact CB-CG 4.35Å; M64-Q68 VanDerWaalsContact O-CG 3.29Å; M64-Q68 WeakPolarHBondContact O-CG 3.44Å; M64-Q68 PolarHBondContact O-NE2 3.43Å; R66-Q68 VanDerWaalsContact C-N 3.26Å; R66-Q68 PolarHBondContact O-N 3.4Å; Q68-A72 HydrophobicContact CB-CB 4.27Å
69	P	87.6	Confident	82.2	Confident	40 Å²	40	101 Å²	101	26%	0.26	50%	0.499	S	S	.	.			trans	-66.4	150.2	174.8	30	-35.1	0	0	0	109.5	P46 M64 Q71 A72	P46-P69 HydrophobicContact CB-CG 4.21Å; M64-P69 HydrophobicContact CE-CG 4.46Å; P69-Q71 PolarHBondContact O-N 2.94Å; P69-A72 HydrophobicContact CG-CB 4.19Å; P69-A72 WeakPolarHBondContact O-CB 3.39Å; P69-A72 PolarHBondContact O-N 3.3Å
70	P	84.6	Confident	81.7	Confident	116 Å²	116	105.7 Å²	105.7	75%	0.753	52%	0.521	S	S	*	.	G	3₁₀ helix	trans	-50.6	-31.9	177.2	-28.2	33.7	0	0	0	113.9	A72 K73	P70-A72 PolarHBondContact O-N 3.32Å; P70-K73 PolarHBondContact O-N 3.37Å
71	Q	85.2	Confident	80.9	Confident	120 Å²	120	111.3 Å²	111.3	56%	0.561	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-72	-9.5	179.9	-55.7	91	-38.6	0	0	114.1	P46 P69 K73	P46-Q71 HydrophobicContact CB-CB 4Å; P46-Q71 HydrophobicContact CG-CB 4.32Å; P69-Q71 PolarHBondContact O-N 2.94Å; Q71-K73 PolarHBondContact O-N 2.91Å
72	A	83.5	Confident	80.1	Confident	30 Å²	30	117.9 Å²	117.9	25%	0.248	58%	0.581	C	S	.	*	G	3₁₀ helix	trans	-72.6	-19.1	176.9	0	0	0	0	0	113.1	G47 Q68 P69 P70	G47-A72 VanDerWaalsContact CA-CB 3.46Å; Q68-A72 HydrophobicContact CB-CB 4.27Å; P69-A72 HydrophobicContact CG-CB 4.19Å; P69-A72 WeakPolarHBondContact O-CB 3.39Å; P69-A72 PolarHBondContact O-N 3.3Å; P70-A72 PolarHBondContact O-N 3.32Å
73	K	75.8	Confident	79.1	Confident	143 Å²	143	119.7 Å²	119.7	62%	0.622	59%	0.593	S	S	*	*	S	Bend	trans	-93.2	138	177.2	-63.1	-176.7	179.6	-176.1	0	108.8	P70 Q71	P70-K73 PolarHBondContact O-N 3.37Å; Q71-K73 PolarHBondContact O-N 2.91Å
74	E	70.1	Confident	78.3	Confident	83 Å²	83	122.3 Å²	122.3	39%	0.388	60%	0.604	S	S	.	*			trans	-64.3	135	169.6	-75.8	-149.6	-173	0	0	109.2	F23 W76 S77	F23-E74 WeakPolarHBondContact CB-OE1 3.25Å; F23-E74 HydrophobicContact CD1-CG 3.55Å; F23-E74 HydrophobicContact CE1-CG 3.94Å; F23-E74 HydrophobicContact CG-CG 4.27Å; E74-W76 PolarHBondContact O-N 3.44Å; E74-S77 PolarHBondContact O-N 2.94Å; E74-S77 PolarHBondContact O-OG 3.46Å; E74-S77 VanDerWaalsContact O-OG 3.14Å
75	P	62.6	Low	77.3	Confident	98 Å²	98	127.8 Å²	127.8	64%	0.636	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.3	-21	178.5	-22.4	32	0	0	0	113.4
76	W	65.1	Low	76.4	Confident	210 Å²	210	127.2 Å²	127.2	80%	0.795	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.9	2.3	-172.8	-41.3	105.7	0	0	0	113.4	E74 H78	E74-W76 PolarHBondContact O-N 3.44Å; W76-H78 PolarHBondContact O-N 3.44Å
77	S	63.2	Low	75.4	Confident	78 Å²	78	121.7 Å²	121.7	55%	0.545	61%	0.606	S	S	.	*			trans	-77.1	105.1	171	65.6	0	0	0	0	108.8	E74	E74-S77 PolarHBondContact O-N 2.94Å; E74-S77 PolarHBondContact O-OG 3.46Å; E74-S77 VanDerWaalsContact O-OG 3.14Å
78	H	51.7	Low	74.3	Confident	257 Å²	257	114.7 Å²	114.7	100%	1.19	58%	0.582	S	S	*	*			trans	-73.6	0	170.4	-69.3	-64.9	0	0	0	111.4	W76	W76-H78 PolarHBondContact O-N 3.44Å

Retrieved 78 of 78 residues in 532 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).