A0A096MWU3_PAPAN Loading...

LYR motif-containing protein 2

Involved in efficient integration of the N-module into mitochondrial respiratory chain complex I.

AlphaFold DB , UniProt , Accession A0A096MWU3, Species PAPAN (Papio anubis, Olive baboon), Gene LYRM2, Length 88 aa.

						>A0A096MWU3_PAPAN|A0A096MWU3|LYRM2
MAASRLPPATLTLKQFIRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFKRNKSATEEDTIRMMITQGNMQLKELEKSLALAKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46	Very low	72.2	Confident	242 Å²	242	125.4 Å²	125.4	100%	1.192	74%	0.744	S	S	*	*				0	113	0	-69.4	-63.8	-178.9	0	0	107.8	A3	M1-A3 PolarHBondContact O-N 2.99Å
2	A	57.8	Low	73.6	Confident	109 Å²	109	121.4 Å²	121.4	90%	0.901	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-69.3	121.6	179.9	0	0	0	0	0	109.7
3	A	64.8	Low	74.8	Confident	91 Å²	91	122 Å²	122	75%	0.752	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-64.3	136.3	174.8	0	0	0	0	0	109.9	M1 R5	M1-A3 PolarHBondContact O-N 2.99Å; A3-R5 PolarHBondContact O-N 2.65Å
4	S	71.3	Confident	75.9	Confident	103 Å²	103	123.1 Å²	123.1	72%	0.72	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-60.9	129.5	175.5	53	0	0	0	0	109.7	L6	S4-L6 PolarHBondContact O-N 2.76Å
5	R	81.4	Confident	76.8	Confident	254 Å²	254	121.3 Å²	121.3	96%	0.958	69%	0.692	S	S	*	*			trans	-78.1	5.4	176	-64	-175.4	176.3	-173.8	-1.4	113.2	A3	A3-R5 PolarHBondContact O-N 2.65Å
6	L	77.7	Confident	77.7	Confident	116 Å²	116	120.2 Å²	120.2	61%	0.607	68%	0.678	S	S	*	*	S	Bend	trans	-86.5	134.8	-176.9	-65.5	176.9	0	0	0	109.7	S4 T10	S4-L6 PolarHBondContact O-N 2.76Å; L6-T10 HydrophobicContact CD1-CG2 4.34Å; L6-T10 HydrophobicContact CD2-CG2 4.4Å
7	P	79.2	Confident	78.6	Confident	80 Å²	80	117.7 Å²	117.7	52%	0.519	66%	0.661	S	S	.	*			trans	-52.9	144.9	169.5	-24	31.4	0	0	0	111.2	A9 T10	P7-A9 PolarHBondContact O-N 3.47Å; P7-T10 WeakPolarHBondContact CD-OG1 3.47Å; P7-T10 WeakPolarHBondContact O-CB 3.45Å; P7-T10 PolarHBondContact O-N 3.29Å; P7-T10 PolarHBondContact O-OG1 2.93Å; P7-T10 VanDerWaalsContact O-OG1 3.12Å
8	P	71.6	Confident	79.5	Confident	146 Å²	146	114.1 Å²	114.1	95%	0.948	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62	-16.4	179.6	22.5	-31.7	0	0	0	113.6
9	A	76.8	Confident	80.2	Confident	93 Å²	93	115.9 Å²	115.9	77%	0.769	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.8	-0	175.3	0	0	0	0	0	114.3	P7 L11	P7-A9 PolarHBondContact O-N 3.47Å; A9-L11 PolarHBondContact O-N 3.1Å
10	T	83	Confident	81	Confident	68 Å²	68	114.3 Å²	114.3	42%	0.417	62%	0.62	S	S	.	*	P	Polyproline II helix	trans	-73	125.4	-179.9	-59.8	0	0	0	0	110.8	L6 P7	L6-T10 HydrophobicContact CD1-CG2 4.34Å; L6-T10 HydrophobicContact CD2-CG2 4.4Å; P7-T10 WeakPolarHBondContact CD-OG1 3.47Å; P7-T10 WeakPolarHBondContact O-CB 3.45Å; P7-T10 PolarHBondContact O-N 3.29Å; P7-T10 PolarHBondContact O-OG1 2.93Å; P7-T10 VanDerWaalsContact O-OG1 3.12Å
11	L	84.1	Confident	81.7	Confident	77 Å²	77	112.3 Å²	112.3	40%	0.403	61%	0.606	S	S	.	*	P	Polyproline II helix	trans	-59.2	142.2	174.4	-64.1	177.7	0	0	0	110.7	A9 Q15 F16	A9-L11 PolarHBondContact O-N 3.1Å; L11-Q15 HydrophobicContact CB-CB 3.99Å; L11-Q15 HydrophobicContact CD2-CB 4.11Å; L11-Q15 HydrophobicContact CG-CB 4.48Å; L11-F16 HydrophobicContact CB-CB 4.49Å
12	T	89.5	Confident	84.1	Confident	78 Å²	78	103 Å²	103	48%	0.479	56%	0.563	S	S	.	*	P	Polyproline II helix	trans	-62.5	156.9	166.7	67.8	0	0	0	0	109.9	K14 Q15 F16	T12-K14 PolarHBondContact O-N 2.85Å; T12-Q15 PolarHBondContact O-N 3.46Å; T12-Q15 VanDerWaalsContact OG1-CG 3.3Å; T12-Q15 WeakPolarHBondContact OG1-CG 3.3Å; T12-Q15 PolarHBondContact OG1-N 3.49Å; T12-Q15 PolarHBondContact OG1-OE1 2.75Å; T12-F16 PolarHBondContact O-N 3.11Å
13	L	89.3	Confident	86	Confident	129 Å²	129	100.6 Å²	100.6	68%	0.675	53%	0.534	S	S	*	.	H	α-helix	trans	-53.3	-40.5	177.5	178.2	60.9	0	0	0	112.1	F16 I17	L13-F16 PolarHBondContact O-N 2.87Å; L13-I17 HydrophobicContact CD1-CD1 4.09Å; L13-I17 HydrophobicContact CD1-CG1 4.32Å; L13-I17 HydrophobicContact CG-CD1 4.04Å; L13-I17 WeakPolarHBondContact O-CG1 3.29Å; L13-I17 PolarHBondContact O-N 3.3Å
14	K	89.7	Confident	87.5	Confident	137 Å²	137	101.1 Å²	101.1	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-61.7	-50.3	176.3	-68.3	-175.1	178.5	-177.6	0	111.6	T12 F16 I17 R18	T12-K14 PolarHBondContact O-N 2.85Å; K14-F16 VanDerWaalsContact C-N 3.29Å; K14-F16 PolarHBondContact O-N 2.99Å; K14-I17 PolarHBondContact O-N 3.31Å; K14-R18 WeakPolarHBondContact O-CG 3.42Å; K14-R18 PolarHBondContact O-N 2.94Å
15	Q	89.9	Confident	88.8	Confident	96 Å²	96	96.6 Å²	96.6	45%	0.449	49%	0.492	S	S	.	.	H	α-helix	trans	-60.5	-38.9	177.3	-72.9	168.2	-18.1	0	0	111.9	L11 T12 R18 R19	L11-Q15 HydrophobicContact CB-CB 3.99Å; L11-Q15 HydrophobicContact CD2-CB 4.11Å; L11-Q15 HydrophobicContact CG-CB 4.48Å; T12-Q15 PolarHBondContact O-N 3.46Å; T12-Q15 VanDerWaalsContact OG1-CG 3.3Å; T12-Q15 WeakPolarHBondContact OG1-CG 3.3Å; T12-Q15 PolarHBondContact OG1-N 3.49Å; T12-Q15 PolarHBondContact OG1-OE1 2.75Å; Q15-R18 PolarHBondContact O-N 3.22Å; Q15-R19 WeakPolarHBondContact O-CB 3.42Å; Q15-R19 PolarHBondContact O-N 3.41Å
16	F	91.4	Very high	89.6	Confident	104 Å²	104	87.4 Å²	87.4	46%	0.456	46%	0.458	S	S	.	.	H	α-helix	trans	-61.5	-48.4	175.2	177.2	-96.8	0	0	0	111.7	L11 T12 L13 K14 R18 R19 Q20	L11-F16 HydrophobicContact CB-CB 4.49Å; T12-F16 PolarHBondContact O-N 3.11Å; L13-F16 PolarHBondContact O-N 2.87Å; K14-F16 VanDerWaalsContact C-N 3.29Å; K14-F16 PolarHBondContact O-N 2.99Å; F16-R18 PolarHBondContact O-N 3.24Å; F16-R19 WeakPolarHBondContact O-CB 3.39Å; F16-R19 PolarHBondContact O-N 3.06Å; F16-Q20 HydrophobicContact CD1-CG 4.45Å; F16-Q20 HydrophobicContact CE1-CG 4.02Å; F16-Q20 HydrophobicContact CZ-CG 4.08Å; F16-Q20 WeakPolarHBondContact O-CG 3.31Å; F16-Q20 PolarHBondContact O-N 3.3Å
17	I	93.4	Very high	90.5	Very high	78 Å²	78	88.9 Å²	88.9	40%	0.4	46%	0.455	S	S	.	.	H	α-helix	trans	-61.2	-45.4	177.9	-69.2	168.8	0	0	0	110.7	L13 K14 R19 Q20 Q21	L13-I17 HydrophobicContact CD1-CD1 4.09Å; L13-I17 HydrophobicContact CD1-CG1 4.32Å; L13-I17 HydrophobicContact CG-CD1 4.04Å; L13-I17 WeakPolarHBondContact O-CG1 3.29Å; L13-I17 PolarHBondContact O-N 3.3Å; K14-I17 PolarHBondContact O-N 3.31Å; I17-R19 VanDerWaalsContact C-N 3.34Å; I17-R19 PolarHBondContact O-N 2.94Å; I17-Q20 PolarHBondContact O-N 3.27Å; I17-Q21 WeakPolarHBondContact O-CG 3.24Å; I17-Q21 PolarHBondContact O-N 2.96Å
18	R	93.8	Very high	91.4	Very high	53 Å²	53	89.6 Å²	89.6	20%	0.2	45%	0.447	C	S	.	.	H	α-helix	trans	-59.9	-43.8	176.5	-65.9	-62.1	174.2	-144.4	-3.3	111.7	K14 Q15 F16 Q20 Q21 V22 E62 I65 R66	K14-R18 WeakPolarHBondContact O-CG 3.42Å; K14-R18 PolarHBondContact O-N 2.94Å; Q15-R18 PolarHBondContact O-N 3.22Å; F16-R18 PolarHBondContact O-N 3.24Å; R18-Q20 VanDerWaalsContact C-N 3.31Å; R18-Q20 PolarHBondContact O-N 3.23Å; R18-Q21 WeakPolarHBondContact O-CB 3.4Å; R18-Q21 PolarHBondContact O-N 2.84Å; R18-Q21 VanDerWaalsContact O-N 3.15Å; R18-V22 WeakPolarHBondContact O-CG2 3.42Å; R18-V22 PolarHBondContact O-N 3.23Å; R18-E62 IonicContact CZ-OE1 3.88Å; R18-E62 IonicContact NE-OE1 3.3Å; R18-E62 PolarHBondContact NE-OE1 3.5Å; R18-E62 VanDerWaalsContact NE-OE1 3.08Å; R18-E62 IonicContact NH2-OE1 3.79Å; R18-E62 PolarHBondContact NH2-OE1 3.13Å; R18-I65 HydrophobicContact CB-CG2 4.2Å; R18-R66 VanDerWaalsContact CZ-CG 3.5Å
19	R	93	Very high	92.7	Very high	148 Å²	148	83.3 Å²	83.3	56%	0.558	41%	0.406	S	S	*	.	H	α-helix	trans	-57.8	-43.3	175.5	-175.3	-177.9	-179.7	101.1	-2.6	111.8	Q15 F16 I17 V22 L23	Q15-R19 WeakPolarHBondContact O-CB 3.42Å; Q15-R19 PolarHBondContact O-N 3.41Å; F16-R19 WeakPolarHBondContact O-CB 3.39Å; F16-R19 PolarHBondContact O-N 3.06Å; I17-R19 VanDerWaalsContact C-N 3.34Å; I17-R19 PolarHBondContact O-N 2.94Å; R19-V22 PolarHBondContact O-N 2.87Å; R19-L23 HydrophobicContact CG-CD1 4.15Å; R19-L23 HydrophobicContact CG-CG 4.5Å; R19-L23 WeakPolarHBondContact O-CB 3.36Å; R19-L23 VanDerWaalsContact O-CG 3.29Å; R19-L23 WeakPolarHBondContact O-CG 3.33Å; R19-L23 PolarHBondContact O-N 3.5Å
20	Q	95.6	Very high	93.7	Very high	84 Å²	84	80.3 Å²	80.3	39%	0.393	38%	0.377	S	S	.	.	H	α-helix	trans	-62.5	-42.3	176.4	-67.2	-56.6	-42.1	0	0	112	F16 I17 R18 L23 L24	F16-Q20 HydrophobicContact CD1-CG 4.45Å; F16-Q20 HydrophobicContact CE1-CG 4.02Å; F16-Q20 HydrophobicContact CZ-CG 4.08Å; F16-Q20 WeakPolarHBondContact O-CG 3.31Å; F16-Q20 PolarHBondContact O-N 3.3Å; I17-Q20 PolarHBondContact O-N 3.27Å; R18-Q20 VanDerWaalsContact C-N 3.31Å; R18-Q20 PolarHBondContact O-N 3.23Å; Q20-L23 PolarHBondContact O-N 3.03Å; Q20-L24 WeakPolarHBondContact O-CB 3.32Å; Q20-L24 PolarHBondContact O-N 3.08Å
21	Q	96.5	Very high	94.4	Very high	73 Å²	73	82.3 Å²	82.3	34%	0.341	38%	0.381	S	S	.	.	H	α-helix	trans	-61.3	-45.3	176.9	-68.9	178.3	-32.7	0	0	112.2	I17 R18 L24 L25 I69	I17-Q21 WeakPolarHBondContact O-CG 3.24Å; I17-Q21 PolarHBondContact O-N 2.96Å; R18-Q21 WeakPolarHBondContact O-CB 3.4Å; R18-Q21 PolarHBondContact O-N 2.84Å; R18-Q21 VanDerWaalsContact O-N 3.15Å; Q21-L24 PolarHBondContact O-N 3.25Å; Q21-L25 WeakPolarHBondContact O-CB 3.35Å; Q21-L25 PolarHBondContact O-N 3.48Å; Q21-I69 HydrophobicContact CB-CD1 3.84Å
22	V	96.6	Very high	95	Very high	47 Å²	47	79 Å²	79	29%	0.285	36%	0.364	S	S	.	.	H	α-helix	trans	-61.2	-46	176.2	174.6	0	0	0	0	111.1	R18 R19 L24 L25 Y26 F53 I65 I69	R18-V22 WeakPolarHBondContact O-CG2 3.42Å; R18-V22 PolarHBondContact O-N 3.23Å; R19-V22 PolarHBondContact O-N 2.87Å; V22-L24 PolarHBondContact O-N 3.49Å; V22-L25 PolarHBondContact O-N 2.99Å; V22-Y26 WeakPolarHBondContact O-CB 3.26Å; V22-Y26 PolarHBondContact O-N 3.23Å; V22-F53 HydrophobicContact CG1-CD1 3.92Å; V22-F53 HydrophobicContact CG1-CE1 3.79Å; V22-I65 HydrophobicContact CG2-CG2 4.05Å; V22-I69 HydrophobicContact CG2-CD1 3.91Å; V22-I69 HydrophobicContact CG2-CG1 3.94Å
23	L	96.6	Very high	95.3	Very high	57 Å²	57	75.5 Å²	75.5	30%	0.298	34%	0.342	S	S	.	.	H	α-helix	trans	-64.8	-39.1	179.5	-71.4	175	0	0	0	112.4	R19 Q20 R27	R19-L23 HydrophobicContact CG-CD1 4.15Å; R19-L23 HydrophobicContact CG-CG 4.5Å; R19-L23 WeakPolarHBondContact O-CB 3.36Å; R19-L23 VanDerWaalsContact O-CG 3.29Å; R19-L23 WeakPolarHBondContact O-CG 3.33Å; R19-L23 PolarHBondContact O-N 3.5Å; Q20-L23 PolarHBondContact O-N 3.03Å; L23-R27 WeakPolarHBondContact O-CG 3.42Å; L23-R27 PolarHBondContact O-N 3.01Å; L23-R27 VanDerWaalsContact O-N 3.08Å
24	L	97.8	Very high	95.6	Very high	102 Å²	102	78 Å²	78	53%	0.534	34%	0.343	S	S	.	.	H	α-helix	trans	-63.9	-47	175.6	-179.8	62.5	0	0	0	110.9	Q20 Q21 V22 Y26 R27 R28	Q20-L24 WeakPolarHBondContact O-CB 3.32Å; Q20-L24 PolarHBondContact O-N 3.08Å; Q21-L24 PolarHBondContact O-N 3.25Å; V22-L24 PolarHBondContact O-N 3.49Å; L24-Y26 VanDerWaalsContact C-N 3.34Å; L24-Y26 PolarHBondContact O-N 3.35Å; L24-R27 PolarHBondContact O-N 3.16Å; L24-R28 HydrophobicContact CD1-CG 4.47Å; L24-R28 WeakPolarHBondContact O-CG 3.3Å; L24-R28 PolarHBondContact O-N 3.06Å
25	L	97.9	Very high	95.9	Very high	9 Å²	9	76.1 Å²	76.1	5%	0.047	34%	0.337	C	S	.	.	H	α-helix	trans	-58.2	-46.9	176.9	177.5	59.1	0	0	0	111.2	Q21 V22 R27 R28 I29 F53 L76	Q21-L25 WeakPolarHBondContact O-CB 3.35Å; Q21-L25 PolarHBondContact O-N 3.48Å; V22-L25 PolarHBondContact O-N 2.99Å; L25-R27 PolarHBondContact O-N 2.63Å; L25-R28 PolarHBondContact O-N 2.92Å; L25-I29 HydrophobicContact CD1-CD1 3.88Å; L25-I29 HydrophobicContact CD1-CG1 4.17Å; L25-I29 HydrophobicContact CG-CD1 3.9Å; L25-I29 WeakPolarHBondContact O-CG1 3.33Å; L25-I29 PolarHBondContact O-N 2.99Å; L25-F53 HydrophobicContact CD2-CZ 4.39Å; L25-F53 HydrophobicContact CG-CZ 4.2Å; L25-L76 HydrophobicContact CD1-CD2 4.12Å
26	Y	97.7	Very high	96.1	Very high	60 Å²	60	72.1 Å²	72.1	24%	0.235	32%	0.318	C	S	.	.	H	α-helix	trans	-55.8	-48.5	176.5	-179.2	-110.1	0	0	0	112.4	V22 L24 R28 I29 L30 R50 F53	V22-Y26 WeakPolarHBondContact O-CB 3.26Å; V22-Y26 PolarHBondContact O-N 3.23Å; L24-Y26 VanDerWaalsContact C-N 3.34Å; L24-Y26 PolarHBondContact O-N 3.35Å; Y26-R28 PolarHBondContact O-N 2.9Å; Y26-I29 PolarHBondContact O-N 3.36Å; Y26-L30 HydrophobicContact CD1-CD1 4.17Å; Y26-L30 HydrophobicContact CE1-CD1 3.47Å; Y26-L30 VanDerWaalsContact CE1-CD1 3.47Å; Y26-L30 HydrophobicContact CE1-CG 4.27Å; Y26-L30 HydrophobicContact CE2-CD1 4.18Å; Y26-L30 HydrophobicContact CE2-CD2 4.5Å; Y26-L30 HydrophobicContact CE2-CG 4.26Å; Y26-L30 VanDerWaalsContact CZ-CD1 3.49Å; Y26-L30 WeakPolarHBondContact O-CG 3.46Å; Y26-L30 PolarHBondContact O-N 2.92Å; Y26-R50 WeakPolarHBondContact OH-CG 3.48Å; Y26-F53 HydrophobicContact CD2-CB 4.2Å; Y26-F53 AromaticContact CD2-CD1 3.81Å; Y26-F53 HydrophobicContact CD2-CD1 3.81Å; Y26-F53 AromaticContact CD2-CD2 3.74Å; Y26-F53 HydrophobicContact CD2-CD2 3.74Å; Y26-F53 HydrophobicContact CD2-CE1 4.06Å; Y26-F53 AromaticContact CD2-CE2 3.97Å; Y26-F53 HydrophobicContact CD2-CE2 3.97Å; Y26-F53 AromaticContact CD2-CG 3.63Å; Y26-F53 HydrophobicContact CD2-CG 3.63Å; Y26-F53 HydrophobicContact CD2-CZ 4.12Å; Y26-F53 HydrophobicContact CE2-CB 4.37Å; Y26-F53 HydrophobicContact CE2-CD2 4.32Å; Y26-F53 HydrophobicContact CE2-CG 4.24Å; Y26-F53 HydrophobicContact CG-CD1 4.23Å; Y26-F53 HydrophobicContact CG-CE1 4.28Å; Y26-F53 HydrophobicContact CG-CG 4.48Å
27	R	98	Very high	96.1	Very high	148 Å²	148	71.7 Å²	71.7	56%	0.558	33%	0.326	S	S	*	.	H	α-helix	trans	-62.1	-44.1	179.3	-71.7	173.1	-170.4	167.6	3.5	111.6	L23 L24 L25 L30 Q31	L23-R27 WeakPolarHBondContact O-CG 3.42Å; L23-R27 PolarHBondContact O-N 3.01Å; L23-R27 VanDerWaalsContact O-N 3.08Å; L24-R27 PolarHBondContact O-N 3.16Å; L25-R27 PolarHBondContact O-N 2.63Å; R27-L30 PolarHBondContact O-N 3.36Å; R27-Q31 WeakPolarHBondContact O-CB 3.36Å; R27-Q31 VanDerWaalsContact O-CG 3.28Å; R27-Q31 WeakPolarHBondContact O-CG 3.29Å; R27-Q31 PolarHBondContact O-N 2.87Å
28	R	98.1	Very high	96.1	Very high	94 Å²	94	71.6 Å²	71.6	36%	0.355	33%	0.326	S	S	.	.	H	α-helix	trans	-62.2	-45.7	178.3	-72.5	-175.7	64.1	-170.5	-4.3	111.7	L24 L25 Y26 L30 Q31 T32 L76 E80	L24-R28 HydrophobicContact CD1-CG 4.47Å; L24-R28 WeakPolarHBondContact O-CG 3.3Å; L24-R28 PolarHBondContact O-N 3.06Å; L25-R28 PolarHBondContact O-N 2.92Å; Y26-R28 PolarHBondContact O-N 2.9Å; R28-L30 PolarHBondContact O-N 3.44Å; R28-Q31 WeakPolarHBondContact O-CB 3.48Å; R28-Q31 PolarHBondContact O-N 3.37Å; R28-Q31 VanDerWaalsContact O-N 3.14Å; R28-T32 PolarHBondContact O-N 3.25Å; R28-T32 PolarHBondContact O-OG1 3.49Å; R28-L76 HydrophobicContact CB-CD2 3.67Å; R28-E80 IonicContact NH2-OE1 2.88Å; R28-E80 PolarHBondContact NH2-OE1 3.48Å; R28-E80 IonicContact NH2-OE2 3.08Å
29	I	97.8	Very high	96.1	Very high	15 Å²	15	74 Å²	74	8%	0.077	34%	0.344	C	S	.	.	H	α-helix	trans	-56.6	-49.5	175.5	-70.9	167.4	0	0	0	110.8	L25 Y26 Q31 T32 I33 A49 F53 L76	L25-I29 HydrophobicContact CD1-CD1 3.88Å; L25-I29 HydrophobicContact CD1-CG1 4.17Å; L25-I29 HydrophobicContact CG-CD1 3.9Å; L25-I29 WeakPolarHBondContact O-CG1 3.33Å; L25-I29 PolarHBondContact O-N 2.99Å; Y26-I29 PolarHBondContact O-N 3.36Å; I29-Q31 VanDerWaalsContact C-N 3.29Å; I29-Q31 PolarHBondContact O-N 3.38Å; I29-T32 PolarHBondContact O-N 3.48Å; I29-I33 HydrophobicContact CG2-CD1 3.59Å; I29-I33 HydrophobicContact CG2-CG1 4.36Å; I29-I33 VanDerWaalsContact O-CG1 3.26Å; I29-I33 WeakPolarHBondContact O-CG1 3.21Å; I29-I33 PolarHBondContact O-N 3.4Å; I29-A49 HydrophobicContact CG2-CB 3.94Å; I29-F53 HydrophobicContact CD1-CE2 3.89Å; I29-F53 HydrophobicContact CD1-CZ 3.96Å; I29-L76 HydrophobicContact CG1-CB 4.32Å; I29-L76 HydrophobicContact CG1-CD1 4.06Å; I29-L76 HydrophobicContact CG1-CD2 4.43Å
30	L	97.4	Very high	96.2	Very high	29 Å²	29	71.3 Å²	71.3	15%	0.152	35%	0.347	C	S	.	.	H	α-helix	trans	-63.2	-34.4	178.4	-69.5	-171	0	0	0	113.3	Y26 R27 R28 I33 R34 K46	Y26-L30 HydrophobicContact CD1-CD1 4.17Å; Y26-L30 HydrophobicContact CE1-CD1 3.47Å; Y26-L30 VanDerWaalsContact CE1-CD1 3.47Å; Y26-L30 HydrophobicContact CE1-CG 4.27Å; Y26-L30 HydrophobicContact CE2-CD1 4.18Å; Y26-L30 HydrophobicContact CE2-CD2 4.5Å; Y26-L30 HydrophobicContact CE2-CG 4.26Å; Y26-L30 VanDerWaalsContact CZ-CD1 3.49Å; Y26-L30 WeakPolarHBondContact O-CG 3.46Å; Y26-L30 PolarHBondContact O-N 2.92Å; R27-L30 PolarHBondContact O-N 3.36Å; R28-L30 PolarHBondContact O-N 3.44Å; L30-I33 HydrophobicContact CD2-CD1 4.45Å; L30-R34 WeakPolarHBondContact O-CG 3.28Å; L30-R34 PolarHBondContact O-N 3.04Å; L30-K46 HydrophobicContact CD2-CG 4.18Å
31	Q	97.4	Very high	96.2	Very high	110 Å²	110	71.1 Å²	71.1	51%	0.514	35%	0.349	S	S	.	.	H	α-helix	trans	-67.8	-43.2	175.3	-75.6	171	-22.7	0	0	111.7	R27 R28 I29 R34	R27-Q31 WeakPolarHBondContact O-CB 3.36Å; R27-Q31 VanDerWaalsContact O-CG 3.28Å; R27-Q31 WeakPolarHBondContact O-CG 3.29Å; R27-Q31 PolarHBondContact O-N 2.87Å; R28-Q31 WeakPolarHBondContact O-CB 3.48Å; R28-Q31 PolarHBondContact O-N 3.37Å; R28-Q31 VanDerWaalsContact O-N 3.14Å; I29-Q31 VanDerWaalsContact C-N 3.29Å; I29-Q31 PolarHBondContact O-N 3.38Å; Q31-R34 WeakPolarHBondContact O-CB 3.33Å; Q31-R34 PolarHBondContact O-N 3.25Å
32	T	96.9	Very high	96.2	Very high	7 Å²	7	71.3 Å²	71.3	4%	0.043	35%	0.346	C	S	.	.	H	α-helix	trans	-65.2	-42.6	177.3	-59.6	0	0	0	0	111.2	R28 I29 R34 Q35 L76 L79 E80 L83	R28-T32 PolarHBondContact O-N 3.25Å; R28-T32 PolarHBondContact O-OG1 3.49Å; I29-T32 PolarHBondContact O-N 3.48Å; T32-R34 PolarHBondContact O-N 2.89Å; T32-Q35 WeakPolarHBondContact O-CB 3.48Å; T32-Q35 PolarHBondContact O-N 2.94Å; T32-L76 HydrophobicContact CG2-CD1 4.14Å; T32-L76 WeakPolarHBondContact OG1-CD1 3.26Å; T32-L79 HydrophobicContact CG2-CB 4.45Å; T32-L79 HydrophobicContact CG2-CD2 3.68Å; T32-L79 HydrophobicContact CG2-CG 3.76Å; T32-E80 HydrophobicContact CG2-CG 3.8Å; T32-L83 HydrophobicContact CG2-CD1 3.54Å
33	I	96.8	Very high	96.2	Very high	5 Å²	5	75.3 Å²	75.3	3%	0.026	36%	0.36	C	S	.	.	H	α-helix	trans	-57.4	-36.3	175.7	-69.9	164.9	0	0	0	111.4	I29 L30 Q35 V36 R42 L45 K46 A49 L79	I29-I33 HydrophobicContact CG2-CD1 3.59Å; I29-I33 HydrophobicContact CG2-CG1 4.36Å; I29-I33 VanDerWaalsContact O-CG1 3.26Å; I29-I33 WeakPolarHBondContact O-CG1 3.21Å; I29-I33 PolarHBondContact O-N 3.4Å; L30-I33 HydrophobicContact CD2-CD1 4.45Å; I33-Q35 PolarHBondContact O-N 3.35Å; I33-Q35 VanDerWaalsContact O-N 3.08Å; I33-V36 VanDerWaalsContact O-CB 3.26Å; I33-V36 WeakPolarHBondContact O-CB 3.29Å; I33-V36 WeakPolarHBondContact O-CG2 3.45Å; I33-V36 PolarHBondContact O-N 3.14Å; I33-R42 HydrophobicContact CG2-CG 3.85Å; I33-R42 WeakPolarHBondContact CG2-O 3.45Å; I33-R42 WeakPolarHBondContact O-CG 3.47Å; I33-L45 HydrophobicContact CD1-CB 3.96Å; I33-L45 HydrophobicContact CG1-CB 3.96Å; I33-L45 HydrophobicContact CG2-CB 3.94Å; I33-K46 HydrophobicContact CG2-CB 4.26Å; I33-A49 HydrophobicContact CD1-CB 4.06Å; I33-L79 HydrophobicContact CG1-CD2 4.15Å
34	R	95.4	Very high	96.2	Very high	181 Å²	181	80 Å²	80	68%	0.683	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60	-21.2	176.8	-70.9	169.3	-175.8	-177.8	-1.4	113.8	L30 Q31 T32 V36	L30-R34 WeakPolarHBondContact O-CG 3.28Å; L30-R34 PolarHBondContact O-N 3.04Å; Q31-R34 WeakPolarHBondContact O-CB 3.33Å; Q31-R34 PolarHBondContact O-N 3.25Å; T32-R34 PolarHBondContact O-N 2.89Å; R34-V36 VanDerWaalsContact C-N 3.32Å
35	Q	94.9	Very high	96.1	Very high	99 Å²	99	77.2 Å²	77.2	46%	0.463	36%	0.36	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.7	-6.7	178.7	-51.8	-175.1	20.6	0	0	113.3	T32 I33 P37 L83	T32-Q35 WeakPolarHBondContact O-CB 3.48Å; T32-Q35 PolarHBondContact O-N 2.94Å; I33-Q35 PolarHBondContact O-N 3.35Å; I33-Q35 VanDerWaalsContact O-N 3.08Å; Q35-P37 WeakPolarHBondContact O-CD 3.47Å; Q35-L83 HydrophobicContact CB-CD1 4.28Å
36	V	94.5	Very high	96.1	Very high	11 Å²	11	80.8 Å²	80.8	7%	0.067	38%	0.375	C	S	.	.			trans	-65.3	123.4	175	176.7	0	0	0	0	108.6	I33 R34 D41 R42 L45 L83	I33-V36 VanDerWaalsContact O-CB 3.26Å; I33-V36 WeakPolarHBondContact O-CB 3.29Å; I33-V36 WeakPolarHBondContact O-CG2 3.45Å; I33-V36 PolarHBondContact O-N 3.14Å; R34-V36 VanDerWaalsContact C-N 3.32Å; V36-D41 HydrophobicContact CG1-CB 3.92Å; V36-R42 HydrophobicContact CB-CB 4.28Å; V36-R42 HydrophobicContact CG1-CB 4.47Å; V36-R42 PolarHBondContact O-NE 3.48Å; V36-R42 VanDerWaalsContact O-NE 3.11Å; V36-R42 PolarHBondContact O-NH2 3.33Å; V36-L45 HydrophobicContact CG2-CD1 3.89Å; V36-L83 HydrophobicContact CB-CD2 4.45Å; V36-L83 HydrophobicContact CG2-CD1 4.4Å; V36-L83 HydrophobicContact CG2-CD2 3.94Å
37	P	91.2	Very high	96.1	Very high	96 Å²	96	80.7 Å²	80.7	62%	0.623	38%	0.379	S	S	*	.	S	Bend	trans	-64.9	-43	-176	-24.1	34.2	0	0	0	113.7	Q35 D39 R42	Q35-P37 WeakPolarHBondContact O-CD 3.47Å; P37-D39 PolarHBondContact O-N 3.35Å; P37-R42 PolarHBondContact O-NH2 2.95Å
38	N	94	Very high	96	Very high	75 Å²	75	78.4 Å²	78.4	40%	0.401	37%	0.37	S	S	.	.			trans	-75	124.1	-178.7	-177.1	-46.4	0	0	0	111.2	S40 D41 R42	N38-S40 WeakPolarHBondContact OD1-CA 3.49Å; N38-S40 VanDerWaalsContact OD1-CB 3.29Å; N38-S40 WeakPolarHBondContact OD1-CB 3.47Å; N38-S40 PolarHBondContact OD1-N 3.48Å; N38-D41 HydrophobicContact CB-CB 4.05Å; N38-D41 VanDerWaalsContact CB-OD2 3.3Å; N38-D41 WeakPolarHBondContact CB-OD2 3.28Å; N38-D41 PolarHBondContact O-N 2.94Å; N38-D41 PolarHBondContact OD1-N 3.15Å; N38-D41 VanDerWaalsContact OD1-N 3.1Å; N38-R42 VanDerWaalsContact O-CB 3.32Å; N38-R42 WeakPolarHBondContact O-CB 3.4Å; N38-R42 PolarHBondContact O-N 3.3Å
39	D	94.6	Very high	95.9	Very high	105 Å²	105	74 Å²	74	56%	0.561	35%	0.354	S	S	*	.	H	α-helix	trans	-67.7	-36.8	-177.5	-74.7	-15.1	0	0	0	113.3	P37 R42 K43	P37-D39 PolarHBondContact O-N 3.35Å; D39-R42 PolarHBondContact O-N 3.42Å; D39-R42 IonicContact OD1-CZ 2.63Å; D39-R42 IonicContact OD1-NH1 3.24Å; D39-R42 PolarHBondContact OD1-NH1 3.24Å; D39-R42 IonicContact OD1-NH2 3.98Å; D39-R42 PolarHBondContact OD1-NH2 3.23Å; D39-K43 WeakPolarHBondContact O-CB 3.49Å; D39-K43 PolarHBondContact O-N 3.37Å
40	S	95.4	Very high	95.9	Very high	90 Å²	90	78.4 Å²	78.4	63%	0.629	37%	0.37	S	S	*	.	H	α-helix	trans	-64.8	-46	176.4	-61.6	0	0	0	0	110.8	N38 K43 Y44	N38-S40 WeakPolarHBondContact OD1-CA 3.49Å; N38-S40 VanDerWaalsContact OD1-CB 3.29Å; N38-S40 WeakPolarHBondContact OD1-CB 3.47Å; N38-S40 PolarHBondContact OD1-N 3.48Å; S40-K43 PolarHBondContact O-N 3.47Å; S40-Y44 WeakPolarHBondContact O-CB 3.27Å; S40-Y44 PolarHBondContact O-N 3.25Å
41	D	94.2	Very high	95.9	Very high	81 Å²	81	81.1 Å²	81.1	43%	0.433	38%	0.381	S	S	.	.	H	α-helix	trans	-65.5	-41.6	177.4	-63.8	-24.5	0	0	0	111.1	V36 N38 K43 Y44 L45	V36-D41 HydrophobicContact CG1-CB 3.92Å; N38-D41 HydrophobicContact CB-CB 4.05Å; N38-D41 VanDerWaalsContact CB-OD2 3.3Å; N38-D41 WeakPolarHBondContact CB-OD2 3.28Å; N38-D41 PolarHBondContact O-N 2.94Å; N38-D41 PolarHBondContact OD1-N 3.15Å; N38-D41 VanDerWaalsContact OD1-N 3.1Å; D41-K43 VanDerWaalsContact C-N 3.32Å; D41-K43 PolarHBondContact O-N 3.42Å; D41-Y44 PolarHBondContact O-N 3.44Å; D41-L45 WeakPolarHBondContact O-CB 3.19Å; D41-L45 VanDerWaalsContact O-CG 3.31Å; D41-L45 WeakPolarHBondContact O-CG 3.38Å; D41-L45 PolarHBondContact O-N 2.92Å
42	R	96.1	Very high	95.7	Very high	76 Å²	76	79 Å²	79	29%	0.287	37%	0.371	S	S	.	.	H	α-helix	trans	-58.2	-45.3	175.1	-172	-174.3	-52.2	132.1	13.1	111.3	I33 V36 P37 N38 D39 K46	I33-R42 HydrophobicContact CG2-CG 3.85Å; I33-R42 WeakPolarHBondContact CG2-O 3.45Å; I33-R42 WeakPolarHBondContact O-CG 3.47Å; V36-R42 HydrophobicContact CB-CB 4.28Å; V36-R42 HydrophobicContact CG1-CB 4.47Å; V36-R42 PolarHBondContact O-NE 3.48Å; V36-R42 VanDerWaalsContact O-NE 3.11Å; V36-R42 PolarHBondContact O-NH2 3.33Å; P37-R42 PolarHBondContact O-NH2 2.95Å; N38-R42 VanDerWaalsContact O-CB 3.32Å; N38-R42 WeakPolarHBondContact O-CB 3.4Å; N38-R42 PolarHBondContact O-N 3.3Å; D39-R42 PolarHBondContact O-N 3.42Å; D39-R42 IonicContact OD1-CZ 2.63Å; D39-R42 IonicContact OD1-NH1 3.24Å; D39-R42 PolarHBondContact OD1-NH1 3.24Å; D39-R42 IonicContact OD1-NH2 3.98Å; D39-R42 PolarHBondContact OD1-NH2 3.23Å; R42-K46 VanDerWaalsContact O-CB 3.24Å; R42-K46 WeakPolarHBondContact O-CB 3.47Å; R42-K46 PolarHBondContact O-N 3.29Å
43	K	97.4	Very high	95.7	Very high	132 Å²	132	81.2 Å²	81.2	57%	0.574	38%	0.381	S	S	*	.	H	α-helix	trans	-63.7	-48.6	177.7	-174.9	-174.7	177.5	-59.4	0	110.7	D39 S40 D41 L45 K46 D47	D39-K43 WeakPolarHBondContact O-CB 3.49Å; D39-K43 PolarHBondContact O-N 3.37Å; S40-K43 PolarHBondContact O-N 3.47Å; D41-K43 VanDerWaalsContact C-N 3.32Å; D41-K43 PolarHBondContact O-N 3.42Å; K43-L45 PolarHBondContact O-N 3.09Å; K43-K46 PolarHBondContact O-N 3.18Å; K43-D47 IonicContact NZ-OD2 3.11Å; K43-D47 PolarHBondContact NZ-OD2 2.89Å; K43-D47 PolarHBondContact O-N 3.36Å
44	Y	96.9	Very high	95.6	Very high	154 Å²	154	87.5 Å²	87.5	60%	0.604	41%	0.408	S	S	*	.	H	α-helix	trans	-56.4	-52.4	178.7	171.7	-100.6	0	0	0	111.9	S40 D41 K46 D47 W48	S40-Y44 WeakPolarHBondContact O-CB 3.27Å; S40-Y44 PolarHBondContact O-N 3.25Å; D41-Y44 PolarHBondContact O-N 3.44Å; Y44-K46 VanDerWaalsContact C-N 3.31Å; Y44-K46 PolarHBondContact O-N 2.98Å; Y44-D47 PolarHBondContact O-N 3.3Å; Y44-W48 WeakPolarHBondContact O-CB 3.41Å; Y44-W48 PolarHBondContact O-N 3.12Å
45	L	96.1	Very high	95.6	Very high	44 Å²	44	85.2 Å²	85.2	23%	0.23	40%	0.399	C	S	.	.	H	α-helix	trans	-62.3	-38.3	-179.5	-71	170.3	0	0	0	112.3	I33 V36 D41 K43 A49	I33-L45 HydrophobicContact CD1-CB 3.96Å; I33-L45 HydrophobicContact CG1-CB 3.96Å; I33-L45 HydrophobicContact CG2-CB 3.94Å; V36-L45 HydrophobicContact CG2-CD1 3.89Å; D41-L45 WeakPolarHBondContact O-CB 3.19Å; D41-L45 VanDerWaalsContact O-CG 3.31Å; D41-L45 WeakPolarHBondContact O-CG 3.38Å; D41-L45 PolarHBondContact O-N 2.92Å; K43-L45 PolarHBondContact O-N 3.09Å; L45-A49 VanDerWaalsContact O-CB 3.29Å; L45-A49 WeakPolarHBondContact O-CB 3.29Å; L45-A49 PolarHBondContact O-N 2.99Å
46	K	97.3	Very high	95.5	Very high	85 Å²	85	83.2 Å²	83.2	37%	0.37	39%	0.391	S	S	.	.	H	α-helix	trans	-64.4	-44.7	176.9	177.3	-177.7	174.3	-171.2	0	111.8	L30 I33 R42 K43 Y44 R50	L30-K46 HydrophobicContact CD2-CG 4.18Å; I33-K46 HydrophobicContact CG2-CB 4.26Å; R42-K46 VanDerWaalsContact O-CB 3.24Å; R42-K46 WeakPolarHBondContact O-CB 3.47Å; R42-K46 PolarHBondContact O-N 3.29Å; K43-K46 PolarHBondContact O-N 3.18Å; Y44-K46 VanDerWaalsContact C-N 3.31Å; Y44-K46 PolarHBondContact O-N 2.98Å; K46-R50 VanDerWaalsContact CE-CZ 3.43Å; K46-R50 VanDerWaalsContact O-CG 3.3Å; K46-R50 WeakPolarHBondContact O-CG 3.43Å; K46-R50 PolarHBondContact O-N 3.35Å
47	D	97.6	Very high	95.3	Very high	58 Å²	58	91.3 Å²	91.3	31%	0.31	43%	0.426	S	S	.	.	H	α-helix	trans	-69.1	-42.7	179.6	-68.9	-19.8	0	0	0	110.3	K43 Y44 A49 R50 E51	K43-D47 IonicContact NZ-OD2 3.11Å; K43-D47 PolarHBondContact NZ-OD2 2.89Å; K43-D47 PolarHBondContact O-N 3.36Å; Y44-D47 PolarHBondContact O-N 3.3Å; D47-A49 PolarHBondContact O-N 2.98Å; D47-R50 WeakPolarHBondContact O-CB 3.49Å; D47-R50 PolarHBondContact O-N 2.93Å; D47-E51 PolarHBondContact O-N 3.48Å
48	W	95.9	Very high	95.2	Very high	100 Å²	100	91.7 Å²	91.7	38%	0.379	43%	0.43	S	S	.	.	H	α-helix	trans	-56.6	-50.5	172.8	174.6	85.2	0	0	0	112.2	Y44 R50 E51 E52	Y44-W48 WeakPolarHBondContact O-CB 3.41Å; Y44-W48 PolarHBondContact O-N 3.12Å; W48-R50 VanDerWaalsContact C-N 3.3Å; W48-R50 PolarHBondContact O-N 3.25Å; W48-E51 PolarHBondContact O-N 2.93Å; W48-E52 WeakPolarHBondContact O-CB 3.32Å; W48-E52 PolarHBondContact O-N 3.4Å
49	A	96.6	Very high	95	Very high	0 Å²	0	89.9 Å²	89.9	0%	0	43%	0.426	C	S	.	.	H	α-helix	trans	-62.7	-36.6	179.4	0	0	0	0	0	112	I29 I33 L45 D47 F53	I29-A49 HydrophobicContact CG2-CB 3.94Å; I33-A49 HydrophobicContact CD1-CB 4.06Å; L45-A49 VanDerWaalsContact O-CB 3.29Å; L45-A49 WeakPolarHBondContact O-CB 3.29Å; L45-A49 PolarHBondContact O-N 2.99Å; D47-A49 PolarHBondContact O-N 2.98Å; A49-F53 WeakPolarHBondContact O-CD2 3.34Å; A49-F53 PolarHBondContact O-N 2.97Å
50	R	96.8	Very high	94.7	Very high	109 Å²	109	90.1 Å²	90.1	41%	0.411	43%	0.432	S	S	.	.	H	α-helix	trans	-63.3	-47.7	175	-80	168	168.2	-162.6	-8.8	111.9	Y26 K46 D47 W48 E52 F53 K54	Y26-R50 WeakPolarHBondContact OH-CG 3.48Å; K46-R50 VanDerWaalsContact CE-CZ 3.43Å; K46-R50 VanDerWaalsContact O-CG 3.3Å; K46-R50 WeakPolarHBondContact O-CG 3.43Å; K46-R50 PolarHBondContact O-N 3.35Å; D47-R50 WeakPolarHBondContact O-CB 3.49Å; D47-R50 PolarHBondContact O-N 2.93Å; W48-R50 VanDerWaalsContact C-N 3.3Å; W48-R50 PolarHBondContact O-N 3.25Å; R50-E52 VanDerWaalsContact C-N 3.34Å; R50-F53 PolarHBondContact O-N 3.34Å; R50-K54 WeakPolarHBondContact O-CB 3.14Å; R50-K54 PolarHBondContact O-N 2.99Å
51	E	97.1	Very high	94.6	Very high	85 Å²	85	91.8 Å²	91.8	40%	0.397	43%	0.429	S	S	.	.	H	α-helix	trans	-67	-37	-179.4	-70.7	-56.8	136.4	0	0	111.8	D47 W48 F53 K54 R55	D47-E51 PolarHBondContact O-N 3.48Å; W48-E51 PolarHBondContact O-N 2.93Å; E51-F53 PolarHBondContact O-N 3.35Å; E51-K54 PolarHBondContact O-N 3.27Å; E51-K54 IonicContact OE1-NZ 3.45Å; E51-R55 WeakPolarHBondContact O-CB 3.3Å; E51-R55 WeakPolarHBondContact O-CG 3.42Å; E51-R55 PolarHBondContact O-N 3.08Å
52	E	95.2	Very high	94.4	Very high	66 Å²	66	91.1 Å²	91.1	31%	0.308	42%	0.424	S	S	.	.	H	α-helix	trans	-61.4	-46.2	177	-169.4	60.5	-157.6	0	0	112.4	W48 R50 K54 R55 N56	W48-E52 WeakPolarHBondContact O-CB 3.32Å; W48-E52 PolarHBondContact O-N 3.4Å; R50-E52 VanDerWaalsContact C-N 3.34Å; E52-K54 VanDerWaalsContact C-N 3.32Å; E52-K54 PolarHBondContact O-N 3.46Å; E52-R55 PolarHBondContact O-N 3.06Å; E52-R55 IonicContact OE2-CZ 2.99Å; E52-R55 VanDerWaalsContact OE2-CZ 3.3Å; E52-R55 IonicContact OE2-NE 2.65Å; E52-R55 PolarHBondContact OE2-NE 3.28Å; E52-R55 VanDerWaalsContact OE2-NE 3.16Å; E52-R55 IonicContact OE2-NH2 2.76Å; E52-R55 PolarHBondContact OE2-NH2 3.16Å; E52-N56 PolarHBondContact O-N 3.24Å; E52-N56 PolarHBondContact O-ND2 3.47Å; E52-N56 PolarHBondContact OE1-ND2 2.87Å
53	F	95.9	Very high	94.2	Very high	54 Å²	54	93 Å²	93	24%	0.237	44%	0.44	C	S	.	.	H	α-helix	trans	-70.5	-30.2	176.8	-80.8	-106.2	0	0	0	112.4	V22 L25 Y26 I29 A49 R50 E51 K57	V22-F53 HydrophobicContact CG1-CD1 3.92Å; V22-F53 HydrophobicContact CG1-CE1 3.79Å; L25-F53 HydrophobicContact CD2-CZ 4.39Å; L25-F53 HydrophobicContact CG-CZ 4.2Å; Y26-F53 HydrophobicContact CD2-CB 4.2Å; Y26-F53 AromaticContact CD2-CD1 3.81Å; Y26-F53 HydrophobicContact CD2-CD1 3.81Å; Y26-F53 AromaticContact CD2-CD2 3.74Å; Y26-F53 HydrophobicContact CD2-CD2 3.74Å; Y26-F53 HydrophobicContact CD2-CE1 4.06Å; Y26-F53 AromaticContact CD2-CE2 3.97Å; Y26-F53 HydrophobicContact CD2-CE2 3.97Å; Y26-F53 AromaticContact CD2-CG 3.63Å; Y26-F53 HydrophobicContact CD2-CG 3.63Å; Y26-F53 HydrophobicContact CD2-CZ 4.12Å; Y26-F53 HydrophobicContact CE2-CB 4.37Å; Y26-F53 HydrophobicContact CE2-CD2 4.32Å; Y26-F53 HydrophobicContact CE2-CG 4.24Å; Y26-F53 HydrophobicContact CG-CD1 4.23Å; Y26-F53 HydrophobicContact CG-CE1 4.28Å; Y26-F53 HydrophobicContact CG-CG 4.48Å; I29-F53 HydrophobicContact CD1-CE2 3.89Å; I29-F53 HydrophobicContact CD1-CZ 3.96Å; A49-F53 WeakPolarHBondContact O-CD2 3.34Å; A49-F53 PolarHBondContact O-N 2.97Å; R50-F53 PolarHBondContact O-N 3.34Å; E51-F53 PolarHBondContact O-N 3.35Å; F53-K57 PolarHBondContact O-N 2.99Å
54	K	95.5	Very high	94.1	Very high	136 Å²	136	89.4 Å²	89.4	59%	0.591	43%	0.429	S	S	*	.	H	α-helix	trans	-69.9	-43.4	175.8	-171.6	-173.6	-179.5	-167.7	0	111.5	R50 E51 E52 N56 K57	R50-K54 WeakPolarHBondContact O-CB 3.14Å; R50-K54 PolarHBondContact O-N 2.99Å; E51-K54 PolarHBondContact O-N 3.27Å; E51-K54 IonicContact OE1-NZ 3.45Å; E52-K54 VanDerWaalsContact C-N 3.32Å; E52-K54 PolarHBondContact O-N 3.46Å; K54-N56 VanDerWaalsContact C-N 3.26Å; K54-N56 PolarHBondContact O-N 2.99Å; K54-K57 VanDerWaalsContact O-CB 3.27Å; K54-K57 WeakPolarHBondContact O-CB 3.5Å; K54-K57 PolarHBondContact O-N 3.26Å
55	R	94.4	Very high	94	Very high	134 Å²	134	83.5 Å²	83.5	51%	0.506	41%	0.407	S	S	.	.	H	α-helix	trans	-55.9	-41.4	174.9	-79.6	-172	-74.5	-91.9	6.3	111.8	E51 E52	E51-R55 WeakPolarHBondContact O-CB 3.3Å; E51-R55 WeakPolarHBondContact O-CG 3.42Å; E51-R55 PolarHBondContact O-N 3.08Å; E52-R55 PolarHBondContact O-N 3.06Å; E52-R55 IonicContact OE2-CZ 2.99Å; E52-R55 VanDerWaalsContact OE2-CZ 3.3Å; E52-R55 IonicContact OE2-NE 2.65Å; E52-R55 PolarHBondContact OE2-NE 3.28Å; E52-R55 VanDerWaalsContact OE2-NE 3.16Å; E52-R55 IonicContact OE2-NH2 2.76Å; E52-R55 PolarHBondContact OE2-NH2 3.16Å
56	N	92.5	Very high	93.9	Very high	56 Å²	56	87.3 Å²	87.3	30%	0.299	42%	0.418	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.7	6.2	-176.5	-64.7	-57.8	0	0	0	114.3	E52 K54 S58 A59 M68	E52-N56 PolarHBondContact O-N 3.24Å; E52-N56 PolarHBondContact O-ND2 3.47Å; E52-N56 PolarHBondContact OE1-ND2 2.87Å; K54-N56 VanDerWaalsContact C-N 3.26Å; K54-N56 PolarHBondContact O-N 2.99Å; N56-S58 PolarHBondContact O-N 3.25Å; N56-S58 VanDerWaalsContact O-N 3.16Å; N56-A59 VanDerWaalsContact O-CB 3.3Å; N56-A59 WeakPolarHBondContact O-CB 3.3Å; N56-A59 PolarHBondContact O-N 2.93Å; N56-M68 HydrophobicContact CB-CE 4.39Å; N56-M68 HydrophobicContact CB-SD 4.14Å; N56-M68 WeakPolarHBondContact OD1-CE 3.46Å
57	K	90.3	Very high	93.9	Very high	182 Å²	182	87.8 Å²	87.8	79%	0.791	42%	0.423	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	-30.1	-174.7	-176.4	-176.7	174.8	-171.4	0	113.6	F53 K54	F53-K57 PolarHBondContact O-N 2.99Å; K54-K57 VanDerWaalsContact O-CB 3.27Å; K54-K57 WeakPolarHBondContact O-CB 3.5Å; K54-K57 PolarHBondContact O-N 3.26Å
58	S	89.9	Confident	93.8	Very high	103 Å²	103	87.7 Å²	87.7	72%	0.72	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	6.2	-179.4	55.8	0	0	0	0	113.8	N56 T60	N56-S58 PolarHBondContact O-N 3.25Å; N56-S58 VanDerWaalsContact O-N 3.16Å; S58-T60 PolarHBondContact O-N 3.38Å
59	A	90.6	Very high	93.8	Very high	38 Å²	38	83.8 Å²	83.8	31%	0.314	41%	0.408	S	S	.	.			trans	-63.4	123.7	175.2	0	0	0	0	0	110.2	N56 I65	N56-A59 VanDerWaalsContact O-CB 3.3Å; N56-A59 WeakPolarHBondContact O-CB 3.3Å; N56-A59 PolarHBondContact O-N 2.93Å; A59-I65 HydrophobicContact CB-CG1 4.19Å
60	T	87.4	Confident	93.9	Very high	110 Å²	110	87.8 Å²	87.8	68%	0.675	43%	0.432	S	S	*	.			trans	-108.5	-27.7	-179.5	50	0	0	0	0	112.9	S58 E62	S58-T60 PolarHBondContact O-N 3.38Å; T60-E62 PolarHBondContact O-N 3.47Å
61	E	92.2	Very high	93.9	Very high	124 Å²	124	87 Å²	87	58%	0.579	43%	0.434	S	S	*	.			trans	-70.8	119.7	-175.5	-60.2	-46.6	113.9	0	0	111.4	D63 T64 I65	E61-D63 PolarHBondContact O-N 3.05Å; E61-T64 WeakPolarHBondContact O-CB 3.3Å; E61-T64 PolarHBondContact O-N 3.12Å; E61-I65 WeakPolarHBondContact O-CG1 3.31Å; E61-I65 PolarHBondContact O-N 3.26Å
62	E	90.2	Very high	93.9	Very high	67 Å²	67	83.4 Å²	83.4	31%	0.313	42%	0.419	S	S	.	.	H	α-helix	trans	-61.2	-43.4	-172.9	-178	173.9	-179.6	0	0	112	R18 T60 T64 I65 R66	R18-E62 IonicContact CZ-OE1 3.88Å; R18-E62 IonicContact NE-OE1 3.3Å; R18-E62 PolarHBondContact NE-OE1 3.5Å; R18-E62 VanDerWaalsContact NE-OE1 3.08Å; R18-E62 IonicContact NH2-OE1 3.79Å; R18-E62 PolarHBondContact NH2-OE1 3.13Å; T60-E62 PolarHBondContact O-N 3.47Å; E62-T64 VanDerWaalsContact C-N 3.33Å; E62-T64 PolarHBondContact O-N 3.39Å; E62-I65 PolarHBondContact O-N 2.92Å; E62-R66 HydrophobicContact CG-CG 4.37Å; E62-R66 WeakPolarHBondContact O-CG 3.48Å; E62-R66 PolarHBondContact O-N 3.05Å
63	D	93.3	Very high	94	Very high	117 Å²	117	83.3 Å²	83.3	63%	0.626	42%	0.42	S	S	*	.	H	α-helix	trans	-66.9	-36.8	-178.1	-70.9	-31.3	0	0	0	111.9	E61 R66 M67	E61-D63 PolarHBondContact O-N 3.05Å; D63-R66 PolarHBondContact O-N 3.43Å; D63-R66 IonicContact OD1-NH1 3.16Å; D63-M67 WeakPolarHBondContact O-CB 3.46Å; D63-M67 PolarHBondContact O-N 2.9Å
64	T	93.9	Very high	94.1	Very high	55 Å²	55	86 Å²	86	34%	0.337	44%	0.435	S	S	.	.	H	α-helix	trans	-61.9	-47.1	171.8	-53.4	0	0	0	0	111	E61 E62 R66 M67 M68	E61-T64 WeakPolarHBondContact O-CB 3.3Å; E61-T64 PolarHBondContact O-N 3.12Å; E62-T64 VanDerWaalsContact C-N 3.33Å; E62-T64 PolarHBondContact O-N 3.39Å; T64-R66 VanDerWaalsContact C-N 3.33Å; T64-R66 PolarHBondContact O-N 3.47Å; T64-M67 PolarHBondContact O-N 2.99Å; T64-M68 HydrophobicContact CG2-CE 3.67Å; T64-M68 HydrophobicContact CG2-SD 4.1Å; T64-M68 WeakPolarHBondContact O-CB 3.38Å; T64-M68 VanDerWaalsContact O-CG 3.3Å; T64-M68 WeakPolarHBondContact O-CG 3.45Å; T64-M68 PolarHBondContact O-N 3Å
65	I	94.9	Very high	94.1	Very high	30 Å²	30	84.3 Å²	84.3	15%	0.154	43%	0.43	C	S	.	.	H	α-helix	trans	-61.5	-42.9	178.2	-65.6	164.6	0	0	0	110.8	R18 V22 A59 E61 E62 M68 I69	R18-I65 HydrophobicContact CB-CG2 4.2Å; V22-I65 HydrophobicContact CG2-CG2 4.05Å; A59-I65 HydrophobicContact CB-CG1 4.19Å; E61-I65 WeakPolarHBondContact O-CG1 3.31Å; E61-I65 PolarHBondContact O-N 3.26Å; E62-I65 PolarHBondContact O-N 2.92Å; I65-M68 PolarHBondContact O-N 3.37Å; I65-I69 HydrophobicContact CG2-CD1 3.81Å; I65-I69 HydrophobicContact CG2-CG1 4.44Å; I65-I69 WeakPolarHBondContact O-CD1 3.49Å; I65-I69 VanDerWaalsContact O-CG1 3.25Å; I65-I69 WeakPolarHBondContact O-CG1 3.39Å; I65-I69 PolarHBondContact O-N 3.39Å
66	R	95.1	Very high	94.2	Very high	124 Å²	124	78.1 Å²	78.1	47%	0.468	41%	0.407	S	S	.	.	H	α-helix	trans	-61.4	-46.4	176.6	-74.9	175.4	65.6	-174.6	-2.5	111.7	R18 E62 D63 T64 I69 T70	R18-R66 VanDerWaalsContact CZ-CG 3.5Å; E62-R66 HydrophobicContact CG-CG 4.37Å; E62-R66 WeakPolarHBondContact O-CG 3.48Å; E62-R66 PolarHBondContact O-N 3.05Å; D63-R66 PolarHBondContact O-N 3.43Å; D63-R66 IonicContact OD1-NH1 3.16Å; T64-R66 VanDerWaalsContact C-N 3.33Å; T64-R66 PolarHBondContact O-N 3.47Å; R66-I69 PolarHBondContact O-N 2.97Å; R66-T70 PolarHBondContact O-N 3.03Å; R66-T70 PolarHBondContact O-OG1 3.15Å; R66-T70 VanDerWaalsContact O-OG1 3.1Å
67	M	96.5	Very high	94.4	Very high	95 Å²	95	81.5 Å²	81.5	47%	0.468	42%	0.419	S	S	.	.	H	α-helix	trans	-59.7	-47.1	177.5	-179	-172.6	70.3	0	0	110.8	D63 T64 I69 T70 Q71	D63-M67 WeakPolarHBondContact O-CB 3.46Å; D63-M67 PolarHBondContact O-N 2.9Å; T64-M67 PolarHBondContact O-N 2.99Å; M67-I69 VanDerWaalsContact C-N 3.35Å; M67-I69 PolarHBondContact O-N 3.01Å; M67-T70 WeakPolarHBondContact O-CB 3.46Å; M67-T70 PolarHBondContact O-N 3.22Å; M67-T70 VanDerWaalsContact O-N 3.16Å; M67-Q71 HydrophobicContact CG-CG 4.47Å; M67-Q71 WeakPolarHBondContact O-CG 3.48Å; M67-Q71 PolarHBondContact O-N 3.18Å
68	M	96.3	Very high	94.7	Very high	57 Å²	57	78.3 Å²	78.3	28%	0.281	41%	0.406	S	S	.	.	H	α-helix	trans	-60.8	-41.4	177.4	-72.3	174.2	171.8	0	0	112.3	N56 T64 I65 Q71 G72	N56-M68 HydrophobicContact CB-CE 4.39Å; N56-M68 HydrophobicContact CB-SD 4.14Å; N56-M68 WeakPolarHBondContact OD1-CE 3.46Å; T64-M68 HydrophobicContact CG2-CE 3.67Å; T64-M68 HydrophobicContact CG2-SD 4.1Å; T64-M68 WeakPolarHBondContact O-CB 3.38Å; T64-M68 VanDerWaalsContact O-CG 3.3Å; T64-M68 WeakPolarHBondContact O-CG 3.45Å; T64-M68 PolarHBondContact O-N 3Å; I65-M68 PolarHBondContact O-N 3.37Å; M68-Q71 PolarHBondContact O-N 3.02Å; M68-G72 PolarHBondContact O-N 3.42Å
69	I	96.4	Very high	94.9	Very high	18 Å²	18	75.4 Å²	75.4	9%	0.092	38%	0.383	C	S	.	.	H	α-helix	trans	-61.3	-45.4	174.7	-70.2	162.9	0	0	0	110.5	Q21 V22 I65 R66 M67 N73	Q21-I69 HydrophobicContact CB-CD1 3.84Å; V22-I69 HydrophobicContact CG2-CD1 3.91Å; V22-I69 HydrophobicContact CG2-CG1 3.94Å; I65-I69 HydrophobicContact CG2-CD1 3.81Å; I65-I69 HydrophobicContact CG2-CG1 4.44Å; I65-I69 WeakPolarHBondContact O-CD1 3.49Å; I65-I69 VanDerWaalsContact O-CG1 3.25Å; I65-I69 WeakPolarHBondContact O-CG1 3.39Å; I65-I69 PolarHBondContact O-N 3.39Å; R66-I69 PolarHBondContact O-N 2.97Å; M67-I69 VanDerWaalsContact C-N 3.35Å; M67-I69 PolarHBondContact O-N 3.01Å; I69-N73 WeakPolarHBondContact CG2-ND2 3.39Å; I69-N73 WeakPolarHBondContact O-CB 3.39Å; I69-N73 PolarHBondContact O-N 3.38Å; I69-N73 PolarHBondContact O-ND2 2.94Å
70	T	97.6	Very high	95.1	Very high	83 Å²	83	77 Å²	77	51%	0.509	38%	0.383	S	S	.	.	H	α-helix	trans	-61.4	-50	178.7	-60.5	0	0	0	0	111.1	R66 M67 G72 N73 M74	R66-T70 PolarHBondContact O-N 3.03Å; R66-T70 PolarHBondContact O-OG1 3.15Å; R66-T70 VanDerWaalsContact O-OG1 3.1Å; M67-T70 WeakPolarHBondContact O-CB 3.46Å; M67-T70 PolarHBondContact O-N 3.22Å; M67-T70 VanDerWaalsContact O-N 3.16Å; T70-G72 PolarHBondContact O-N 2.91Å; T70-N73 PolarHBondContact O-N 3.28Å; T70-M74 HydrophobicContact CG2-SD 4.42Å; T70-M74 WeakPolarHBondContact O-CG 3.25Å; T70-M74 PolarHBondContact O-N 3.43Å
71	Q	96.4	Very high	95.5	Very high	94 Å²	94	77.6 Å²	77.6	44%	0.439	38%	0.377	S	S	.	.	H	α-helix	trans	-59.4	-47.2	178.4	-72.2	173.4	-9.8	0	0	111.6	M67 M68 N73 M74 Q75	M67-Q71 HydrophobicContact CG-CG 4.47Å; M67-Q71 WeakPolarHBondContact O-CG 3.48Å; M67-Q71 PolarHBondContact O-N 3.18Å; M68-Q71 PolarHBondContact O-N 3.02Å; Q71-N73 VanDerWaalsContact C-N 3.32Å; Q71-N73 PolarHBondContact O-N 3.32Å; Q71-M74 WeakPolarHBondContact O-CB 3.41Å; Q71-M74 PolarHBondContact O-N 3.39Å; Q71-M74 VanDerWaalsContact O-N 3.13Å; Q71-Q75 WeakPolarHBondContact O-CG 3.49Å; Q71-Q75 PolarHBondContact O-N 3.42Å
72	G	96.6	Very high	95.6	Very high	9 Å²	9	75.2 Å²	75.2	9%	0.093	37%	0.374	C	S	.	.	H	α-helix	trans	-64.8	-33.7	178.8	0	0	0	0	0	113.3	M68 T70 L76	M68-G72 PolarHBondContact O-N 3.42Å; T70-G72 PolarHBondContact O-N 2.91Å; G72-L76 VanDerWaalsContact O-CB 3.3Å; G72-L76 WeakPolarHBondContact O-CB 3.35Å; G72-L76 PolarHBondContact O-N 3.27Å
73	N	97.8	Very high	95.7	Very high	63 Å²	63	72.7 Å²	72.7	34%	0.337	36%	0.362	S	S	.	.	H	α-helix	trans	-67.9	-36.5	172.6	-80.9	-64.8	0	0	0	112.4	I69 T70 Q71 K77	I69-N73 WeakPolarHBondContact CG2-ND2 3.39Å; I69-N73 WeakPolarHBondContact O-CB 3.39Å; I69-N73 PolarHBondContact O-N 3.38Å; I69-N73 PolarHBondContact O-ND2 2.94Å; T70-N73 PolarHBondContact O-N 3.28Å; Q71-N73 VanDerWaalsContact C-N 3.32Å; Q71-N73 PolarHBondContact O-N 3.32Å; N73-K77 WeakPolarHBondContact O-CB 3.49Å; N73-K77 PolarHBondContact O-N 3.12Å
74	M	97.6	Very high	95.7	Very high	112 Å²	112	70 Å²	70	55%	0.552	36%	0.356	S	S	*	.	H	α-helix	trans	-63.8	-49.5	174.6	-69.1	175.2	64.8	0	0	110.8	T70 Q71 L76 K77 E78	T70-M74 HydrophobicContact CG2-SD 4.42Å; T70-M74 WeakPolarHBondContact O-CG 3.25Å; T70-M74 PolarHBondContact O-N 3.43Å; Q71-M74 WeakPolarHBondContact O-CB 3.41Å; Q71-M74 PolarHBondContact O-N 3.39Å; Q71-M74 VanDerWaalsContact O-N 3.13Å; M74-L76 VanDerWaalsContact C-N 3.32Å; M74-L76 PolarHBondContact O-N 3.16Å; M74-K77 WeakPolarHBondContact O-CB 3.48Å; M74-K77 PolarHBondContact O-N 2.95Å; M74-K77 VanDerWaalsContact O-N 3.12Å; M74-E78 PolarHBondContact O-N 2.91Å
75	Q	95.3	Very high	95.6	Very high	100 Å²	100	73.4 Å²	73.4	47%	0.467	37%	0.372	S	S	.	.	H	α-helix	trans	-60	-40.8	176.9	-69.6	174.5	-8.8	0	0	112.2	Q71 K77 E78 L79	Q71-Q75 WeakPolarHBondContact O-CG 3.49Å; Q71-Q75 PolarHBondContact O-N 3.42Å; Q75-K77 VanDerWaalsContact C-N 3.35Å; Q75-K77 PolarHBondContact O-N 3.1Å; Q75-E78 PolarHBondContact O-N 2.99Å; Q75-L79 PolarHBondContact O-N 2.81Å
76	L	96.7	Very high	95.3	Very high	4 Å²	4	75.5 Å²	75.5	2%	0.021	39%	0.394	C	S	.	.	H	α-helix	trans	-60.3	-44.5	174.9	176	60.4	0	0	0	111.6	L25 R28 I29 T32 G72 M74 E78 L79 E80	L25-L76 HydrophobicContact CD1-CD2 4.12Å; R28-L76 HydrophobicContact CB-CD2 3.67Å; I29-L76 HydrophobicContact CG1-CB 4.32Å; I29-L76 HydrophobicContact CG1-CD1 4.06Å; I29-L76 HydrophobicContact CG1-CD2 4.43Å; T32-L76 HydrophobicContact CG2-CD1 4.14Å; T32-L76 WeakPolarHBondContact OG1-CD1 3.26Å; G72-L76 VanDerWaalsContact O-CB 3.3Å; G72-L76 WeakPolarHBondContact O-CB 3.35Å; G72-L76 PolarHBondContact O-N 3.27Å; M74-L76 VanDerWaalsContact C-N 3.32Å; M74-L76 PolarHBondContact O-N 3.16Å; L76-E78 VanDerWaalsContact C-N 3.32Å; L76-E78 PolarHBondContact O-N 2.9Å; L76-L79 PolarHBondContact O-N 3.44Å; L76-E80 HydrophobicContact CD1-CG 4.28Å; L76-E80 WeakPolarHBondContact O-CG 3.35Å; L76-E80 PolarHBondContact O-N 3.23Å
77	K	97.5	Very high	94.7	Very high	127 Å²	127	75.6 Å²	75.6	55%	0.552	40%	0.397	S	S	*	.	H	α-helix	trans	-64.5	-37.4	178.7	-174.3	177.1	-176.7	177.6	0	111.9	N73 M74 Q75 K81	N73-K77 WeakPolarHBondContact O-CB 3.49Å; N73-K77 PolarHBondContact O-N 3.12Å; M74-K77 WeakPolarHBondContact O-CB 3.48Å; M74-K77 PolarHBondContact O-N 2.95Å; M74-K77 VanDerWaalsContact O-N 3.12Å; Q75-K77 VanDerWaalsContact C-N 3.35Å; Q75-K77 PolarHBondContact O-N 3.1Å; K77-K81 VanDerWaalsContact O-CG 3.31Å; K77-K81 WeakPolarHBondContact O-CG 3.38Å; K77-K81 PolarHBondContact O-N 3.37Å; K77-K81 VanDerWaalsContact O-N 3.09Å
78	E	96	Very high	93.4	Very high	115 Å²	115	77.9 Å²	77.9	54%	0.537	42%	0.423	S	S	.	.	H	α-helix	trans	-64.6	-46.8	174	-72.1	171.6	177.8	0	0	111.2	M74 Q75 L76 E80 K81 S82	M74-E78 PolarHBondContact O-N 2.91Å; Q75-E78 PolarHBondContact O-N 2.99Å; L76-E78 VanDerWaalsContact C-N 3.32Å; L76-E78 PolarHBondContact O-N 2.9Å; E78-E80 PolarHBondContact O-N 2.97Å; E78-K81 WeakPolarHBondContact O-CB 3.44Å; E78-K81 PolarHBondContact O-N 3.36Å; E78-S82 PolarHBondContact O-N 3.45Å; E78-S82 PolarHBondContact O-OG 3.27Å
79	L	94.3	Very high	93.3	Very high	42 Å²	42	79 Å²	79	22%	0.22	43%	0.43	C	S	.	.	H	α-helix	trans	-59.4	-45.3	175.9	-179.3	63.7	0	0	0	112	T32 I33 Q75 L76 K81 S82 L83	T32-L79 HydrophobicContact CG2-CB 4.45Å; T32-L79 HydrophobicContact CG2-CD2 3.68Å; T32-L79 HydrophobicContact CG2-CG 3.76Å; I33-L79 HydrophobicContact CG1-CD2 4.15Å; Q75-L79 PolarHBondContact O-N 2.81Å; L76-L79 PolarHBondContact O-N 3.44Å; L79-K81 VanDerWaalsContact C-N 3.31Å; L79-K81 PolarHBondContact O-N 2.86Å; L79-S82 PolarHBondContact O-N 3.02Å; L79-L83 HydrophobicContact CD1-CD1 4.23Å; L79-L83 HydrophobicContact CD1-CG 4.36Å; L79-L83 HydrophobicContact CG-CD1 4.06Å; L79-L83 WeakPolarHBondContact O-CB 3.41Å; L79-L83 VanDerWaalsContact O-CG 3.29Å; L79-L83 WeakPolarHBondContact O-CG 3.3Å; L79-L83 PolarHBondContact O-N 3.39Å
80	E	95.6	Very high	93.1	Very high	70 Å²	70	82.2 Å²	82.2	33%	0.327	45%	0.448	S	S	.	.	H	α-helix	trans	-58.1	-42.3	176	-74.9	171.7	174	0	0	111.5	R28 T32 L76 E78 A84	R28-E80 IonicContact NH2-OE1 2.88Å; R28-E80 PolarHBondContact NH2-OE1 3.48Å; R28-E80 IonicContact NH2-OE2 3.08Å; T32-E80 HydrophobicContact CG2-CG 3.8Å; L76-E80 HydrophobicContact CD1-CG 4.28Å; L76-E80 WeakPolarHBondContact O-CG 3.35Å; L76-E80 PolarHBondContact O-N 3.23Å; E78-E80 PolarHBondContact O-N 2.97Å; E80-A84 WeakPolarHBondContact O-CB 3.36Å; E80-A84 PolarHBondContact O-N 3.08Å
81	K	96.1	Very high	92.8	Very high	123 Å²	123	82.1 Å²	82.1	54%	0.535	45%	0.445	S	S	.	.	H	α-helix	trans	-65.6	-47.9	176.3	-74.7	173.7	177	-173.7	0	112.4	K77 E78 L79 L83 A84 L85	K77-K81 VanDerWaalsContact O-CG 3.31Å; K77-K81 WeakPolarHBondContact O-CG 3.38Å; K77-K81 PolarHBondContact O-N 3.37Å; K77-K81 VanDerWaalsContact O-N 3.09Å; E78-K81 WeakPolarHBondContact O-CB 3.44Å; E78-K81 PolarHBondContact O-N 3.36Å; L79-K81 VanDerWaalsContact C-N 3.31Å; L79-K81 PolarHBondContact O-N 2.86Å; K81-L83 PolarHBondContact O-N 2.96Å; K81-A84 WeakPolarHBondContact O-CB 3.46Å; K81-A84 PolarHBondContact O-N 3.46Å; K81-A84 VanDerWaalsContact O-N 3.12Å; K81-L85 WeakPolarHBondContact O-CG 3.47Å; K81-L85 PolarHBondContact O-N 2.87Å
82	S	93.5	Very high	92.6	Very high	75 Å²	75	81.4 Å²	81.4	52%	0.524	45%	0.445	S	S	.	.	H	α-helix	trans	-59.5	-39.3	178.5	-64	0	0	0	0	111.5	E78 L79 L85 A86	E78-S82 PolarHBondContact O-N 3.45Å; E78-S82 PolarHBondContact O-OG 3.27Å; L79-S82 PolarHBondContact O-N 3.02Å; S82-L85 PolarHBondContact O-N 3.07Å; S82-A86 WeakPolarHBondContact O-CB 3.35Å; S82-A86 PolarHBondContact O-N 3.37Å
83	L	93.2	Very high	92.4	Very high	13 Å²	13	85.9 Å²	85.9	7%	0.068	47%	0.467	C	S	.	.	H	α-helix	trans	-69.2	-35.1	175.4	-71.5	171.1	0	0	0	113.1	T32 Q35 V36 L79 K81 A86 K87	T32-L83 HydrophobicContact CG2-CD1 3.54Å; Q35-L83 HydrophobicContact CB-CD1 4.28Å; V36-L83 HydrophobicContact CB-CD2 4.45Å; V36-L83 HydrophobicContact CG2-CD1 4.4Å; V36-L83 HydrophobicContact CG2-CD2 3.94Å; L79-L83 HydrophobicContact CD1-CD1 4.23Å; L79-L83 HydrophobicContact CD1-CG 4.36Å; L79-L83 HydrophobicContact CG-CD1 4.06Å; L79-L83 WeakPolarHBondContact O-CB 3.41Å; L79-L83 VanDerWaalsContact O-CG 3.29Å; L79-L83 WeakPolarHBondContact O-CG 3.3Å; L79-L83 PolarHBondContact O-N 3.39Å; K81-L83 PolarHBondContact O-N 2.96Å; L83-A86 PolarHBondContact O-N 3.26Å; L83-K87 VanDerWaalsContact O-CG 3.28Å; L83-K87 WeakPolarHBondContact O-CG 3.33Å; L83-K87 PolarHBondContact O-N 3.37Å
84	A	93	Very high	92	Very high	61 Å²	61	87.5 Å²	87.5	50%	0.504	48%	0.476	S	S	.	.	H	α-helix	trans	-64.7	-42.9	174.3	0	0	0	0	0	111.3	E80 K81 K87 S88	E80-A84 WeakPolarHBondContact O-CB 3.36Å; E80-A84 PolarHBondContact O-N 3.08Å; K81-A84 WeakPolarHBondContact O-CB 3.46Å; K81-A84 PolarHBondContact O-N 3.46Å; K81-A84 VanDerWaalsContact O-N 3.12Å; A84-K87 PolarHBondContact O-N 3.18Å; A84-S88 PolarHBondContact O-N 3.36Å
85	L	92.1	Very high	91.6	Very high	126 Å²	126	85.7 Å²	85.7	66%	0.66	47%	0.47	S	S	*	.	H	α-helix	trans	-67.3	-33.5	176.7	-67.1	171.9	0	0	0	113	K81 S82 K87 S88	K81-L85 WeakPolarHBondContact O-CG 3.47Å; K81-L85 PolarHBondContact O-N 2.87Å; S82-L85 PolarHBondContact O-N 3.07Å; L85-K87 PolarHBondContact O-N 2.88Å; L85-S88 PolarHBondContact O-OG 3.36Å
86	A	88.5	Confident	91.3	Very high	74 Å²	74	84.6 Å²	84.6	61%	0.612	47%	0.47	S	S	*	.	H	α-helix	trans	-72.6	-15.4	176.5	0	0	0	0	0	113.4	S82 L83	S82-A86 WeakPolarHBondContact O-CB 3.35Å; S82-A86 PolarHBondContact O-N 3.37Å; L83-A86 PolarHBondContact O-N 3.26Å
87	K	82.3	Confident	90.9	Very high	126 Å²	126	91.3 Å²	91.3	55%	0.548	51%	0.508	S	S	.	.	H	α-helix	trans	-97.1	-14.9	179.1	-70.1	174	-170.7	176.1	0	113.5	L83 A84 L85	L83-K87 VanDerWaalsContact O-CG 3.28Å; L83-K87 WeakPolarHBondContact O-CG 3.33Å; L83-K87 PolarHBondContact O-N 3.37Å; A84-K87 PolarHBondContact O-N 3.18Å; L85-K87 PolarHBondContact O-N 2.88Å
88	S	68.9	Low	90.3	Very high	144 Å²	144	88.1 Å²	88.1	100%	1.007	50%	0.504	S	S	*	.			trans	-85.3	0	175.7	59.6	0	0	0	0	111.2	A84 L85	A84-S88 PolarHBondContact O-N 3.36Å; L85-S88 PolarHBondContact O-OG 3.36Å

Retrieved 88 of 88 residues in 527 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).