A0A096MWZ7_PAPAN Loading...

Heat shock factor-binding protein 1-like protein 1

AlphaFold DB , UniProt , Accession A0A096MWZ7, Species PAPAN (Papio anubis, Olive baboon), Gene HSBP1L1, Length 74 aa.

						>A0A096MWZ7_PAPAN|A0A096MWZ7|HSBP1L1
MDARGPEAPGGRALRDAAENLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVSDLMVQAGIENSIKQQMLKI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.7	Very low	61	Low	237 Å²	237	111.5 Å²	111.5	100%	1.167	69%	0.693	S	S	*	*				0	91.7	0	-80	173.7	170.3	0	0	106.4	A3	M1-A3 PolarHBondContact O-N 3.22Å; M1-A3 VanDerWaalsContact O-N 3.13Å
2	D	48.2	Very low	63.1	Low	162 Å²	162	113.3 Å²	113.3	87%	0.866	68%	0.677	S	S	*	*			trans	-70.6	102.7	-178.1	-62	-82.9	0	0	0	109.9	R4	D2-R4 PolarHBondContact O-N 2.82Å
3	A	51.3	Low	65	Low	106 Å²	106	109.2 Å²	109.2	88%	0.876	66%	0.664	S	S	*	*			trans	-76.5	60.8	172.3	0	0	0	0	0	110.2	M1 G5	M1-A3 PolarHBondContact O-N 3.22Å; M1-A3 VanDerWaalsContact O-N 3.13Å; A3-G5 PolarHBondContact O-N 3.42Å; A3-G5 VanDerWaalsContact O-N 3.17Å
4	R	54.7	Low	66.9	Low	183 Å²	183	110.5 Å²	110.5	69%	0.691	66%	0.664	S	S	*	*			trans	-81.4	90.9	165.2	-167	173.4	-176.6	-179.3	0.6	107.3	D2 E7	D2-R4 PolarHBondContact O-N 2.82Å; R4-E7 IonicContact CZ-OE2 2.82Å; R4-E7 IonicContact NE-OE2 3.74Å; R4-E7 IonicContact NH2-OE2 3.28Å; R4-E7 PolarHBondContact NH2-OE2 3.35Å
5	G	64.1	Low	68.6	Low	50 Å²	50	112.1 Å²	112.1	52%	0.515	65%	0.653	S	S	.	*			trans	-54.9	153.7	167.8	0	0	0	0	0	110.7	A3 E7	A3-G5 PolarHBondContact O-N 3.42Å; A3-G5 VanDerWaalsContact O-N 3.17Å; G5-E7 PolarHBondContact O-N 3.23Å
6	P	60.8	Low	70.2	Confident	131 Å²	131	110.3 Å²	110.3	85%	0.851	64%	0.64	S	S	*	*			trans	-59.7	114.4	-175.6	24.2	-32	0	0	0	109.5	A8	P6-A8 PolarHBondContact O-N 3.48Å; P6-A8 VanDerWaalsContact O-N 3.1Å
7	E	61.1	Low	71.6	Confident	82 Å²	82	107 Å²	107	38%	0.383	63%	0.629	S	S	.	*			trans	-58.4	119.8	178.2	-59.4	-127.1	97.2	0	0	108.6	R4 G5 R12	R4-E7 IonicContact CZ-OE2 2.82Å; R4-E7 IonicContact NE-OE2 3.74Å; R4-E7 IonicContact NH2-OE2 3.28Å; R4-E7 PolarHBondContact NH2-OE2 3.35Å; G5-E7 PolarHBondContact O-N 3.23Å; E7-R12 PolarHBondContact O-NH2 2.98Å
8	A	65.4	Low	73	Confident	67 Å²	67	103.2 Å²	103.2	55%	0.554	61%	0.612	S	S	*	*			trans	-52.7	137.4	-179.4	0	0	0	0	0	109.1	P6 G10 G11	P6-A8 PolarHBondContact O-N 3.48Å; P6-A8 VanDerWaalsContact O-N 3.1Å; A8-G10 PolarHBondContact O-N 2.93Å; A8-G11 PolarHBondContact O-N 3.38Å
9	P	64.3	Low	74.2	Confident	111 Å²	111	102.4 Å²	102.4	72%	0.721	60%	0.601	S	S	*	*	H	α-helix	trans	-50.1	-35.1	-174.9	-24	27.4	0	0	0	113.8	A13	P9-A13 PolarHBondContact O-N 3.32Å
10	G	73.9	Confident	75.3	Confident	52 Å²	52	102.6 Å²	102.6	54%	0.536	60%	0.6	S	S	.	*	H	α-helix	trans	-70.1	-27.3	177.9	0	0	0	0	0	115.2	A8 L14	A8-G10 PolarHBondContact O-N 2.93Å; G10-L14 WeakPolarHBondContact O-CB 3.47Å; G10-L14 PolarHBondContact O-N 3.31Å
11	G	82.5	Confident	76.3	Confident	45 Å²	45	102.8 Å²	102.8	46%	0.464	60%	0.598	S	S	.	*	H	α-helix	trans	-70.8	-35.3	178.9	0	0	0	0	0	112.9	A8 R15	A8-G11 PolarHBondContact O-N 3.38Å; G11-R15 WeakPolarHBondContact O-CB 3.38Å; G11-R15 PolarHBondContact O-N 3.14Å; G11-R15 VanDerWaalsContact O-N 3.14Å
12	R	85.7	Confident	78.9	Confident	134 Å²	134	98.3 Å²	98.3	51%	0.506	57%	0.572	S	S	.	*	H	α-helix	trans	-67.8	-48.3	173.4	-79.3	-178.3	-86	-149.2	-8.6	111.6	E7 L14 R15 D16	E7-R12 PolarHBondContact O-NH2 2.98Å; R12-L14 VanDerWaalsContact C-N 3.3Å; R12-L14 PolarHBondContact O-N 2.98Å; R12-R15 WeakPolarHBondContact O-CB 3.47Å; R12-R15 PolarHBondContact O-N 3.46Å; R12-R15 VanDerWaalsContact O-N 3.1Å; R12-D16 PolarHBondContact O-N 3.32Å
13	A	88.2	Confident	81.2	Confident	60 Å²	60	96.1 Å²	96.1	50%	0.496	56%	0.556	S	S	.	*	H	α-helix	trans	-59.5	-39.6	178.2	0	0	0	0	0	112.9	P9 A17	P9-A13 PolarHBondContact O-N 3.32Å; A13-A17 WeakPolarHBondContact O-CB 3.32Å; A13-A17 PolarHBondContact O-N 3.12Å
14	L	91.9	Very high	83.4	Confident	127 Å²	127	96.3 Å²	96.3	67%	0.665	54%	0.539	S	S	*	.	H	α-helix	trans	-65	-42.5	175.4	177.6	61.6	0	0	0	111.9	G10 R12 A17 A18	G10-L14 WeakPolarHBondContact O-CB 3.47Å; G10-L14 PolarHBondContact O-N 3.31Å; R12-L14 VanDerWaalsContact C-N 3.3Å; R12-L14 PolarHBondContact O-N 2.98Å; L14-A17 PolarHBondContact O-N 2.92Å; L14-A18 PolarHBondContact O-N 3.17Å
15	R	92.9	Very high	85.5	Confident	134 Å²	134	91.5 Å²	91.5	51%	0.506	53%	0.527	S	S	.	.	H	α-helix	trans	-63.4	-46.6	177.6	-179.8	-177.8	150.3	-145.1	-13.7	111.1	G11 R12 A17 A18 E19	G11-R15 WeakPolarHBondContact O-CB 3.38Å; G11-R15 PolarHBondContact O-N 3.14Å; G11-R15 VanDerWaalsContact O-N 3.14Å; R12-R15 WeakPolarHBondContact O-CB 3.47Å; R12-R15 PolarHBondContact O-N 3.46Å; R12-R15 VanDerWaalsContact O-N 3.1Å; R15-A17 VanDerWaalsContact C-N 3.3Å; R15-A17 PolarHBondContact O-N 3.02Å; R15-A18 PolarHBondContact O-N 3.34Å; R15-A18 VanDerWaalsContact O-N 3.14Å; R15-E19 HydrophobicContact CG-CG 4.49Å; R15-E19 WeakPolarHBondContact CG-OE2 3.28Å; R15-E19 IonicContact CZ-OE2 2.8Å; R15-E19 VanDerWaalsContact CZ-OE2 3.28Å; R15-E19 IonicContact NE-OE2 3.63Å; R15-E19 PolarHBondContact NE-OE2 3.31Å; R15-E19 IonicContact NH2-OE1 2.71Å; R15-E19 IonicContact NH2-OE2 3.8Å; R15-E19 PolarHBondContact NH2-OE2 3.41Å; R15-E19 WeakPolarHBondContact O-CG 3.46Å; R15-E19 PolarHBondContact O-N 2.92Å
16	D	93.9	Very high	87.1	Confident	83 Å²	83	94.6 Å²	94.6	44%	0.444	53%	0.528	S	S	.	.	H	α-helix	trans	-61.2	-40.9	178	-61.2	-23.5	0	0	0	111.1	R12 A18 E19 N20	R12-D16 PolarHBondContact O-N 3.32Å; D16-A18 PolarHBondContact O-N 3.19Å; D16-E19 PolarHBondContact O-N 3.32Å; D16-N20 WeakPolarHBondContact O-CB 3.37Å; D16-N20 PolarHBondContact O-N 3.07Å; D16-N20 PolarHBondContact O-ND2 2.96Å
17	A	94.4	Very high	88.8	Confident	55 Å²	55	93.9 Å²	93.9	46%	0.455	51%	0.513	S	S	.	.	H	α-helix	trans	-63.4	-39.4	175	0	0	0	0	0	112.6	A13 L14 R15 L21	A13-A17 WeakPolarHBondContact O-CB 3.32Å; A13-A17 PolarHBondContact O-N 3.12Å; L14-A17 PolarHBondContact O-N 2.92Å; R15-A17 VanDerWaalsContact C-N 3.3Å; R15-A17 PolarHBondContact O-N 3.02Å; A17-L21 WeakPolarHBondContact O-CB 3.32Å; A17-L21 PolarHBondContact O-N 2.87Å; A17-L21 VanDerWaalsContact O-N 3.08Å
18	A	95.7	Very high	90.6	Very high	38 Å²	38	95.8 Å²	95.8	31%	0.314	52%	0.522	S	S	.	.	H	α-helix	trans	-67.5	-44.5	175.5	0	0	0	0	0	111.6	L14 R15 D16 N20 L21 F22	L14-A18 PolarHBondContact O-N 3.17Å; R15-A18 PolarHBondContact O-N 3.34Å; R15-A18 VanDerWaalsContact O-N 3.14Å; D16-A18 PolarHBondContact O-N 3.19Å; A18-N20 VanDerWaalsContact C-N 3.34Å; A18-N20 PolarHBondContact O-N 3.24Å; A18-L21 PolarHBondContact O-N 3.11Å; A18-F22 HydrophobicContact CB-CE2 4.49Å; A18-F22 WeakPolarHBondContact O-CD2 3.43Å; A18-F22 PolarHBondContact O-N 3.33Å
19	E	96	Very high	92.2	Very high	89 Å²	89	98.1 Å²	98.1	42%	0.416	52%	0.52	S	S	.	.	H	α-helix	trans	-58.9	-45.2	176.7	-71.5	-173.9	88.4	0	0	111	R15 D16 L21 F22 Q23	R15-E19 HydrophobicContact CG-CG 4.49Å; R15-E19 WeakPolarHBondContact CG-OE2 3.28Å; R15-E19 IonicContact CZ-OE2 2.8Å; R15-E19 VanDerWaalsContact CZ-OE2 3.28Å; R15-E19 IonicContact NE-OE2 3.63Å; R15-E19 PolarHBondContact NE-OE2 3.31Å; R15-E19 IonicContact NH2-OE1 2.71Å; R15-E19 IonicContact NH2-OE2 3.8Å; R15-E19 PolarHBondContact NH2-OE2 3.41Å; R15-E19 WeakPolarHBondContact O-CG 3.46Å; R15-E19 PolarHBondContact O-N 2.92Å; D16-E19 PolarHBondContact O-N 3.32Å; E19-L21 PolarHBondContact O-N 3.34Å; E19-F22 PolarHBondContact O-N 3.42Å; E19-Q23 WeakPolarHBondContact O-CB 3.49Å; E19-Q23 PolarHBondContact O-N 2.93Å
20	N	96.5	Very high	93.8	Very high	106 Å²	106	98.2 Å²	98.2	57%	0.567	51%	0.511	S	S	*	.	H	α-helix	trans	-61.4	-43.2	175.9	-70.3	-22.5	0	0	0	112.8	D16 A18 Q23 E24	D16-N20 WeakPolarHBondContact O-CB 3.37Å; D16-N20 PolarHBondContact O-N 3.07Å; D16-N20 PolarHBondContact O-ND2 2.96Å; A18-N20 VanDerWaalsContact C-N 3.34Å; A18-N20 PolarHBondContact O-N 3.24Å; N20-Q23 PolarHBondContact O-N 3.43Å; N20-E24 PolarHBondContact O-N 3.29Å
21	L	97.1	Very high	94.9	Very high	107 Å²	107	98.4 Å²	98.4	56%	0.56	51%	0.507	S	S	*	.	H	α-helix	trans	-63.9	-41.7	178.4	178.8	63	0	0	0	111.7	A17 A18 E19 Q23 E24 L25	A17-L21 WeakPolarHBondContact O-CB 3.32Å; A17-L21 PolarHBondContact O-N 2.87Å; A17-L21 VanDerWaalsContact O-N 3.08Å; A18-L21 PolarHBondContact O-N 3.11Å; E19-L21 PolarHBondContact O-N 3.34Å; L21-Q23 VanDerWaalsContact C-N 3.31Å; L21-E24 PolarHBondContact O-N 2.97Å; L21-L25 VanDerWaalsContact O-CB 3.32Å; L21-L25 WeakPolarHBondContact O-CB 3.27Å; L21-L25 PolarHBondContact O-N 2.86Å
22	F	97.4	Very high	95.7	Very high	143 Å²	143	100.9 Å²	100.9	63%	0.627	51%	0.509	S	S	*	.	H	α-helix	trans	-65.3	-37.7	176.4	-78.1	-61.7	0	0	0	112	A18 E19 L25 Q26	A18-F22 HydrophobicContact CB-CE2 4.49Å; A18-F22 WeakPolarHBondContact O-CD2 3.43Å; A18-F22 PolarHBondContact O-N 3.33Å; E19-F22 PolarHBondContact O-N 3.42Å; F22-L25 PolarHBondContact O-N 3.47Å; F22-Q26 WeakPolarHBondContact O-CB 3.5Å; F22-Q26 PolarHBondContact O-N 3.27Å
23	Q	97.3	Very high	96.3	Very high	115 Å²	115	98 Å²	98	54%	0.537	51%	0.507	S	S	.	.	H	α-helix	trans	-64.6	-48.4	176.8	-172.1	158.7	7.8	0	0	111.4	E19 N20 L21 L25 Q26 E27	E19-Q23 WeakPolarHBondContact O-CB 3.49Å; E19-Q23 PolarHBondContact O-N 2.93Å; N20-Q23 PolarHBondContact O-N 3.43Å; L21-Q23 VanDerWaalsContact C-N 3.31Å; Q23-L25 VanDerWaalsContact C-N 3.32Å; Q23-L25 PolarHBondContact O-N 3.41Å; Q23-Q26 WeakPolarHBondContact O-CB 3.4Å; Q23-Q26 PolarHBondContact O-N 3.25Å; Q23-Q26 VanDerWaalsContact O-N 3.16Å; Q23-E27 WeakPolarHBondContact O-CG 3.46Å; Q23-E27 PolarHBondContact O-N 3.36Å
24	E	97.6	Very high	96.8	Very high	111 Å²	111	97.7 Å²	97.7	52%	0.519	50%	0.503	S	S	.	.	H	α-helix	trans	-58.6	-44.4	175.9	-174.7	-175.5	84	0	0	111.4	N20 L21 Q26 E27 H28	N20-E24 PolarHBondContact O-N 3.29Å; L21-E24 PolarHBondContact O-N 2.97Å; E24-Q26 VanDerWaalsContact C-N 3.33Å; E24-Q26 PolarHBondContact O-N 3.49Å; E24-E27 PolarHBondContact O-N 3.19Å; E24-H28 PolarHBondContact O-CD2 2.92Å; E24-H28 PolarHBondContact O-N 2.86Å
25	L	97.9	Very high	97.1	Very high	82 Å²	82	95.1 Å²	95.1	43%	0.429	49%	0.493	S	S	.	.	H	α-helix	trans	-61.8	-41.8	177.6	-174.5	64.1	0	0	0	111.8	L21 F22 Q23 H28 F29	L21-L25 VanDerWaalsContact O-CB 3.32Å; L21-L25 WeakPolarHBondContact O-CB 3.27Å; L21-L25 PolarHBondContact O-N 2.86Å; F22-L25 PolarHBondContact O-N 3.47Å; Q23-L25 VanDerWaalsContact C-N 3.32Å; Q23-L25 PolarHBondContact O-N 3.41Å; L25-H28 PolarHBondContact O-N 2.97Å; L25-F29 HydrophobicContact CD1-CD2 3.91Å; L25-F29 HydrophobicContact CD1-CE2 3.46Å; L25-F29 VanDerWaalsContact CD1-CE2 3.46Å; L25-F29 HydrophobicContact CD1-CZ 4.33Å; L25-F29 HydrophobicContact CD2-CE2 4.12Å; L25-F29 HydrophobicContact CG-CD2 3.8Å; L25-F29 HydrophobicContact CG-CE2 3.62Å; L25-F29 WeakPolarHBondContact O-CD2 3.45Å; L25-F29 PolarHBondContact O-N 3.37Å
26	Q	98	Very high	97.3	Very high	115 Å²	115	93.1 Å²	93.1	54%	0.537	49%	0.492	S	S	.	.	H	α-helix	trans	-64.2	-45.7	177.4	-176.6	176.1	9.5	0	0	111.4	F22 Q23 E24 H28 F29 Q30	F22-Q26 WeakPolarHBondContact O-CB 3.5Å; F22-Q26 PolarHBondContact O-N 3.27Å; Q23-Q26 WeakPolarHBondContact O-CB 3.4Å; Q23-Q26 PolarHBondContact O-N 3.25Å; Q23-Q26 VanDerWaalsContact O-N 3.16Å; E24-Q26 VanDerWaalsContact C-N 3.33Å; E24-Q26 PolarHBondContact O-N 3.49Å; Q26-H28 VanDerWaalsContact C-N 3.31Å; Q26-H28 PolarHBondContact O-N 3.12Å; Q26-F29 PolarHBondContact O-N 3.17Å; Q26-Q30 WeakPolarHBondContact O-CB 3.23Å; Q26-Q30 VanDerWaalsContact O-CG 3.29Å; Q26-Q30 WeakPolarHBondContact O-CG 3.35Å; Q26-Q30 PolarHBondContact O-N 3.1Å
27	E	98.1	Very high	97.5	Very high	116 Å²	116	93.5 Å²	93.5	54%	0.542	49%	0.494	S	S	.	.	H	α-helix	trans	-59.6	-43	176.5	-71.4	-179.7	100.3	0	0	111.2	Q23 E24 Q30 A31	Q23-E27 WeakPolarHBondContact O-CG 3.46Å; Q23-E27 PolarHBondContact O-N 3.36Å; E24-E27 PolarHBondContact O-N 3.19Å; E27-Q30 PolarHBondContact O-N 3.35Å; E27-A31 WeakPolarHBondContact O-CB 3.29Å; E27-A31 PolarHBondContact O-N 2.89Å
28	H	98.2	Very high	97.7	Very high	121 Å²	121	95.9 Å²	95.9	56%	0.56	50%	0.498	S	S	*	.	H	α-helix	trans	-63.3	-45.1	176	-83	-57.1	0	0	0	113.2	E24 L25 Q26 Q30 A31 L32	E24-H28 PolarHBondContact O-CD2 2.92Å; E24-H28 PolarHBondContact O-N 2.86Å; L25-H28 PolarHBondContact O-N 2.97Å; Q26-H28 VanDerWaalsContact C-N 3.31Å; Q26-H28 PolarHBondContact O-N 3.12Å; H28-Q30 VanDerWaalsContact C-N 3.34Å; H28-A31 PolarHBondContact O-N 3.23Å; H28-L32 WeakPolarHBondContact O-CB 3.47Å; H28-L32 PolarHBondContact O-N 3.29Å
29	F	98.3	Very high	97.9	Very high	117 Å²	117	102 Å²	102	51%	0.513	51%	0.514	S	S	.	.	H	α-helix	trans	-64.2	-40.4	176.7	-83.9	-61.3	0	0	0	111.7	L25 Q26 L32 T33	L25-F29 HydrophobicContact CD1-CD2 3.91Å; L25-F29 HydrophobicContact CD1-CE2 3.46Å; L25-F29 VanDerWaalsContact CD1-CE2 3.46Å; L25-F29 HydrophobicContact CD1-CZ 4.33Å; L25-F29 HydrophobicContact CD2-CE2 4.12Å; L25-F29 HydrophobicContact CG-CD2 3.8Å; L25-F29 HydrophobicContact CG-CE2 3.62Å; L25-F29 WeakPolarHBondContact O-CD2 3.45Å; L25-F29 PolarHBondContact O-N 3.37Å; Q26-F29 PolarHBondContact O-N 3.17Å; F29-L32 PolarHBondContact O-N 2.95Å; F29-T33 WeakPolarHBondContact O-CB 3.4Å; F29-T33 PolarHBondContact O-N 2.85Å; F29-T33 PolarHBondContact O-OG1 3.39Å
30	Q	98.3	Very high	98	Very high	113 Å²	113	103.1 Å²	103.1	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-61.3	-45.5	175.4	-74.8	175.7	-15.8	0	0	111.8	Q26 E27 H28 L32 T33 A34	Q26-Q30 WeakPolarHBondContact O-CB 3.23Å; Q26-Q30 VanDerWaalsContact O-CG 3.29Å; Q26-Q30 WeakPolarHBondContact O-CG 3.35Å; Q26-Q30 PolarHBondContact O-N 3.1Å; E27-Q30 PolarHBondContact O-N 3.35Å; H28-Q30 VanDerWaalsContact C-N 3.34Å; Q30-L32 VanDerWaalsContact C-N 3.34Å; Q30-L32 PolarHBondContact O-N 2.97Å; Q30-T33 PolarHBondContact O-N 2.99Å; Q30-A34 WeakPolarHBondContact O-CB 3.48Å; Q30-A34 PolarHBondContact O-N 3Å
31	A	98	Very high	98	Very high	55 Å²	55	104.3 Å²	104.3	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-62.6	-40.5	176.4	0	0	0	0	0	112.1	E27 H28 A34 T35	E27-A31 WeakPolarHBondContact O-CB 3.29Å; E27-A31 PolarHBondContact O-N 2.89Å; H28-A31 PolarHBondContact O-N 3.23Å; A31-A34 PolarHBondContact O-N 3.02Å; A31-T35 PolarHBondContact O-N 2.95Å; A31-T35 PolarHBondContact O-OG1 3.01Å
32	L	98.4	Very high	98.1	Very high	98 Å²	98	104.9 Å²	104.9	51%	0.513	52%	0.522	S	S	.	.	H	α-helix	trans	-63.7	-46	175.5	-173.3	74.1	0	0	0	111.3	H28 F29 Q30 T35 L36	H28-L32 WeakPolarHBondContact O-CB 3.47Å; H28-L32 PolarHBondContact O-N 3.29Å; F29-L32 PolarHBondContact O-N 2.95Å; Q30-L32 VanDerWaalsContact C-N 3.34Å; Q30-L32 PolarHBondContact O-N 2.97Å; L32-T35 WeakPolarHBondContact O-CB 3.46Å; L32-T35 PolarHBondContact O-N 3.17Å; L32-L36 HydrophobicContact CG-CD1 4.47Å; L32-L36 PolarHBondContact O-N 3.24Å
33	T	98.3	Very high	98.1	Very high	74 Å²	74	103.4 Å²	103.4	45%	0.454	52%	0.519	S	S	.	.	H	α-helix	trans	-61.6	-43.5	176.8	-62.7	0	0	0	0	111.5	F29 Q30 T35 L36 N37	F29-T33 WeakPolarHBondContact O-CB 3.4Å; F29-T33 PolarHBondContact O-N 2.85Å; F29-T33 PolarHBondContact O-OG1 3.39Å; Q30-T33 PolarHBondContact O-N 2.99Å; T33-T35 VanDerWaalsContact C-N 3.31Å; T33-T35 PolarHBondContact O-N 3.44Å; T33-L36 PolarHBondContact O-N 3.32Å; T33-N37 PolarHBondContact O-N 3.34Å
34	A	98.3	Very high	98.2	Very high	52 Å²	52	99.2 Å²	99.2	43%	0.43	51%	0.506	S	S	.	.	H	α-helix	trans	-59.6	-43.5	175.2	0	0	0	0	0	111.5	Q30 A31 L36 N37 L38	Q30-A34 WeakPolarHBondContact O-CB 3.48Å; Q30-A34 PolarHBondContact O-N 3Å; A31-A34 PolarHBondContact O-N 3.02Å; A34-L36 PolarHBondContact O-N 3.46Å; A34-N37 PolarHBondContact O-N 3.5Å; A34-L38 WeakPolarHBondContact O-CG 3.3Å; A34-L38 PolarHBondContact O-N 3.35Å
35	T	98.3	Very high	98.2	Very high	73 Å²	73	97.7 Å²	97.7	45%	0.448	50%	0.501	S	S	.	.	H	α-helix	trans	-62.9	-42.9	176.7	-56.4	0	0	0	0	112.1	A31 L32 T33 L38 R39	A31-T35 PolarHBondContact O-N 2.95Å; A31-T35 PolarHBondContact O-OG1 3.01Å; L32-T35 WeakPolarHBondContact O-CB 3.46Å; L32-T35 PolarHBondContact O-N 3.17Å; T33-T35 VanDerWaalsContact C-N 3.31Å; T33-T35 PolarHBondContact O-N 3.44Å; T35-L38 PolarHBondContact O-N 2.97Å; T35-R39 PolarHBondContact O-N 3.08Å; T35-R39 VanDerWaalsContact O-N 3.08Å
36	L	98.4	Very high	98.2	Very high	92 Å²	92	102.7 Å²	102.7	48%	0.482	52%	0.515	S	S	.	.	H	α-helix	trans	-64.2	-41	176.6	-78.1	173.1	0	0	0	112	L32 T33 A34 R39 M40	L32-L36 HydrophobicContact CG-CD1 4.47Å; L32-L36 PolarHBondContact O-N 3.24Å; T33-L36 PolarHBondContact O-N 3.32Å; A34-L36 PolarHBondContact O-N 3.46Å; L36-R39 PolarHBondContact O-N 2.91Å; L36-M40 HydrophobicContact CB-CE 4.37Å; L36-M40 WeakPolarHBondContact O-CG 3.31Å; L36-M40 PolarHBondContact O-N 2.93Å
37	N	98.1	Very high	98.2	Very high	91 Å²	91	101.2 Å²	101.2	49%	0.487	51%	0.51	S	S	.	.	H	α-helix	trans	-62.1	-45.5	176.4	-74.5	-18.1	0	0	0	111.9	T33 A34 R39 M40 E41	T33-N37 PolarHBondContact O-N 3.34Å; A34-N37 PolarHBondContact O-N 3.5Å; N37-R39 VanDerWaalsContact C-N 3.34Å; N37-R39 PolarHBondContact O-N 2.93Å; N37-M40 PolarHBondContact O-N 3.19Å; N37-M40 WeakPolarHBondContact OD1-CE 3.48Å; N37-E41 PolarHBondContact O-N 3.33Å
38	L	98.4	Very high	98.2	Very high	105 Å²	105	101.4 Å²	101.4	55%	0.55	51%	0.51	S	S	.	.	H	α-helix	trans	-57.4	-47.6	175.1	-71.3	170.2	0	0	0	111.3	A34 T35 M40 E41 E42	A34-L38 WeakPolarHBondContact O-CG 3.3Å; A34-L38 PolarHBondContact O-N 3.35Å; T35-L38 PolarHBondContact O-N 2.97Å; L38-M40 VanDerWaalsContact C-N 3.3Å; L38-M40 PolarHBondContact O-N 2.92Å; L38-E41 PolarHBondContact O-N 2.99Å; L38-E42 WeakPolarHBondContact O-CG 3.39Å; L38-E42 PolarHBondContact O-N 2.9Å
39	R	98.3	Very high	98.2	Very high	167 Å²	167	100.3 Å²	100.3	63%	0.63	51%	0.508	S	S	*	.	H	α-helix	trans	-62.9	-35.2	177.2	-77.1	-168.5	174.1	-169.4	0.7	113.5	T35 L36 N37 M43	T35-R39 PolarHBondContact O-N 3.08Å; T35-R39 VanDerWaalsContact O-N 3.08Å; L36-R39 PolarHBondContact O-N 2.91Å; N37-R39 VanDerWaalsContact C-N 3.34Å; N37-R39 PolarHBondContact O-N 2.93Å; R39-M43 WeakPolarHBondContact O-CB 3.29Å; R39-M43 PolarHBondContact O-N 3.37Å
40	M	98.1	Very high	98.2	Very high	112 Å²	112	99.9 Å²	99.9	55%	0.552	51%	0.511	S	S	*	.	H	α-helix	trans	-67.5	-41.1	175.8	-78.7	-172.2	-80.3	0	0	111.3	L36 N37 L38 M43 G44	L36-M40 HydrophobicContact CB-CE 4.37Å; L36-M40 WeakPolarHBondContact O-CG 3.31Å; L36-M40 PolarHBondContact O-N 2.93Å; N37-M40 PolarHBondContact O-N 3.19Å; N37-M40 WeakPolarHBondContact OD1-CE 3.48Å; L38-M40 VanDerWaalsContact C-N 3.3Å; L38-M40 PolarHBondContact O-N 2.92Å; M40-M43 PolarHBondContact O-N 3.23Å; M40-G44 PolarHBondContact O-N 2.85Å
41	E	98.2	Very high	98.1	Very high	132 Å²	132	100.7 Å²	100.7	62%	0.617	52%	0.515	S	S	*	.	H	α-helix	trans	-63.1	-47	174.6	-172.8	178.1	87.4	0	0	111.5	N37 L38 M43 G44 N45	N37-E41 PolarHBondContact O-N 3.33Å; L38-E41 PolarHBondContact O-N 2.99Å; E41-M43 VanDerWaalsContact C-N 3.29Å; E41-M43 PolarHBondContact O-N 3.43Å; E41-G44 PolarHBondContact O-N 3.45Å; E41-G44 VanDerWaalsContact O-N 3.12Å; E41-N45 PolarHBondContact O-N 2.89Å; E41-N45 PolarHBondContact O-ND2 3.27Å
42	E	98.3	Very high	98	Very high	118 Å²	118	104.3 Å²	104.3	55%	0.551	52%	0.52	S	S	*	.	H	α-helix	trans	-57.9	-41.4	174.5	-70.4	177.8	98.9	0	0	112.1	L38 R46	L38-E42 WeakPolarHBondContact O-CG 3.39Å; L38-E42 PolarHBondContact O-N 2.9Å; E42-R46 VanDerWaalsContact O-CG 3.3Å; E42-R46 WeakPolarHBondContact O-CG 3.27Å; E42-R46 PolarHBondContact O-N 2.91Å; E42-R46 VanDerWaalsContact O-N 3.1Å
43	M	98.4	Very high	97.9	Very high	113 Å²	113	104.5 Å²	104.5	56%	0.557	52%	0.522	S	S	*	.	H	α-helix	trans	-66.5	-39.4	176.6	-168.2	-178.7	-50.9	0	0	111.7	R39 M40 E41 R46 I47	R39-M43 WeakPolarHBondContact O-CB 3.29Å; R39-M43 PolarHBondContact O-N 3.37Å; M40-M43 PolarHBondContact O-N 3.23Å; E41-M43 VanDerWaalsContact C-N 3.29Å; E41-M43 PolarHBondContact O-N 3.43Å; M43-R46 PolarHBondContact O-N 3.3Å; M43-I47 HydrophobicContact CG-CD1 4.17Å; M43-I47 VanDerWaalsContact O-CG1 3.27Å; M43-I47 WeakPolarHBondContact O-CG1 3.4Å; M43-I47 PolarHBondContact O-N 2.86Å
44	G	97.8	Very high	97.7	Very high	26 Å²	26	104.3 Å²	104.3	27%	0.268	52%	0.52	S	S	.	.	H	α-helix	trans	-57.3	-53.4	173.8	0	0	0	0	0	111.8	M40 E41 R46 I47 E48	M40-G44 PolarHBondContact O-N 2.85Å; E41-G44 PolarHBondContact O-N 3.45Å; E41-G44 VanDerWaalsContact O-N 3.12Å; G44-R46 VanDerWaalsContact C-N 3.3Å; G44-R46 PolarHBondContact O-N 3.04Å; G44-I47 WeakPolarHBondContact O-CA 3.3Å; G44-I47 WeakPolarHBondContact O-CB 3.43Å; G44-I47 PolarHBondContact O-N 3.47Å; G44-E48 PolarHBondContact O-N 3.32Å
45	N	97.9	Very high	97.4	Very high	80 Å²	80	104.5 Å²	104.5	43%	0.428	52%	0.519	S	S	.	.	H	α-helix	trans	-56.1	-44	177.6	-70.2	-41.3	0	0	0	112	E41 I47 E48 D49	E41-N45 PolarHBondContact O-N 2.89Å; E41-N45 PolarHBondContact O-ND2 3.27Å; N45-I47 VanDerWaalsContact C-N 3.31Å; N45-I47 PolarHBondContact O-N 3.33Å; N45-E48 PolarHBondContact O-N 3.21Å; N45-D49 PolarHBondContact O-N 3.44Å
46	R	98.4	Very high	97.2	Very high	187 Å²	187	104.4 Å²	104.4	71%	0.706	52%	0.515	S	S	*	.	H	α-helix	trans	-64.7	-33.1	177.1	-71.9	174	65.7	-161.5	-0.7	113.1	E42 M43 G44 L50	E42-R46 VanDerWaalsContact O-CG 3.3Å; E42-R46 WeakPolarHBondContact O-CG 3.27Å; E42-R46 PolarHBondContact O-N 2.91Å; E42-R46 VanDerWaalsContact O-N 3.1Å; M43-R46 PolarHBondContact O-N 3.3Å; G44-R46 VanDerWaalsContact C-N 3.3Å; G44-R46 PolarHBondContact O-N 3.04Å; R46-L50 VanDerWaalsContact O-CB 3.3Å; R46-L50 WeakPolarHBondContact O-CB 3.33Å; R46-L50 PolarHBondContact O-N 3.31Å
47	I	98.3	Very high	97	Very high	84 Å²	84	105.3 Å²	105.3	43%	0.431	52%	0.52	S	S	.	.	H	α-helix	trans	-68.8	-43.6	174.8	-71.1	164.2	0	0	0	109.8	M43 G44 N45 L50 Q51	M43-I47 HydrophobicContact CG-CD1 4.17Å; M43-I47 VanDerWaalsContact O-CG1 3.27Å; M43-I47 WeakPolarHBondContact O-CG1 3.4Å; M43-I47 PolarHBondContact O-N 2.86Å; G44-I47 WeakPolarHBondContact O-CA 3.3Å; G44-I47 WeakPolarHBondContact O-CB 3.43Å; G44-I47 PolarHBondContact O-N 3.47Å; N45-I47 VanDerWaalsContact C-N 3.31Å; N45-I47 PolarHBondContact O-N 3.33Å; I47-L50 PolarHBondContact O-N 2.98Å; I47-Q51 HydrophobicContact CG2-CG 4.39Å; I47-Q51 VanDerWaalsContact O-CG 3.31Å; I47-Q51 WeakPolarHBondContact O-CG 3.38Å; I47-Q51 PolarHBondContact O-N 3.43Å
48	E	97.9	Very high	96.6	Very high	120 Å²	120	103.5 Å²	103.5	56%	0.561	51%	0.51	S	S	*	.	H	α-helix	trans	-60.5	-46.2	176.4	-68.6	177.2	85.6	0	0	111.6	G44 N45 L50 Q51 K52	G44-E48 PolarHBondContact O-N 3.32Å; N45-E48 PolarHBondContact O-N 3.21Å; E48-L50 VanDerWaalsContact C-N 3.32Å; E48-L50 PolarHBondContact O-N 2.96Å; E48-Q51 WeakPolarHBondContact O-CB 3.45Å; E48-Q51 PolarHBondContact O-N 2.92Å; E48-K52 PolarHBondContact O-N 3.42Å
49	D	98.2	Very high	96.2	Very high	97 Å²	97	102.2 Å²	102.2	52%	0.519	51%	0.506	S	S	.	.	H	α-helix	trans	-60.1	-42.1	174.5	-75.6	-26.6	0	0	0	111.9	N45 K52 N53	N45-D49 PolarHBondContact O-N 3.44Å; D49-K52 PolarHBondContact O-N 3.36Å; D49-N53 WeakPolarHBondContact O-CB 3.29Å; D49-N53 PolarHBondContact O-N 3.16Å; D49-N53 PolarHBondContact O-ND2 3.49Å
50	L	98.1	Very high	95.8	Very high	109 Å²	109	101.8 Å²	101.8	57%	0.571	51%	0.511	S	S	*	.	H	α-helix	trans	-64.4	-43	177.2	-175.6	64.9	0	0	0	111.4	R46 I47 E48 K52 N53 V54	R46-L50 VanDerWaalsContact O-CB 3.3Å; R46-L50 WeakPolarHBondContact O-CB 3.33Å; R46-L50 PolarHBondContact O-N 3.31Å; I47-L50 PolarHBondContact O-N 2.98Å; E48-L50 VanDerWaalsContact C-N 3.32Å; E48-L50 PolarHBondContact O-N 2.96Å; L50-K52 VanDerWaalsContact C-N 3.32Å; L50-K52 PolarHBondContact O-N 3.28Å; L50-N53 PolarHBondContact O-N 2.93Å; L50-V54 HydrophobicContact CD1-CG2 4.5Å; L50-V54 WeakPolarHBondContact O-CB 3.45Å; L50-V54 VanDerWaalsContact O-CG2 3.29Å; L50-V54 WeakPolarHBondContact O-CG2 3.47Å; L50-V54 PolarHBondContact O-N 2.97Å
51	Q	96	Very high	95.4	Very high	130 Å²	130	99.4 Å²	99.4	61%	0.607	51%	0.509	S	S	*	.	H	α-helix	trans	-60	-43.4	176.1	-75.2	175.7	-12	0	0	111.2	I47 E48 V54 S55	I47-Q51 HydrophobicContact CG2-CG 4.39Å; I47-Q51 VanDerWaalsContact O-CG 3.31Å; I47-Q51 WeakPolarHBondContact O-CG 3.38Å; I47-Q51 PolarHBondContact O-N 3.43Å; E48-Q51 WeakPolarHBondContact O-CB 3.45Å; E48-Q51 PolarHBondContact O-N 2.92Å; Q51-V54 PolarHBondContact O-N 2.8Å; Q51-S55 WeakPolarHBondContact O-CB 3.43Å; Q51-S55 PolarHBondContact O-N 2.98Å
52	K	96.3	Very high	94.7	Very high	131 Å²	131	96 Å²	96	57%	0.57	51%	0.509	S	S	*	.	H	α-helix	trans	-61.6	-49.6	175	-175.7	-179	177.1	-176.7	0	111.8	E48 D49 L50 V54 S55 D56	E48-K52 PolarHBondContact O-N 3.42Å; D49-K52 PolarHBondContact O-N 3.36Å; L50-K52 VanDerWaalsContact C-N 3.32Å; L50-K52 PolarHBondContact O-N 3.28Å; K52-V54 VanDerWaalsContact C-N 3.29Å; K52-V54 PolarHBondContact O-N 3.33Å; K52-S55 WeakPolarHBondContact O-CB 3.4Å; K52-S55 PolarHBondContact O-N 3.47Å; K52-S55 VanDerWaalsContact O-N 3.11Å; K52-D56 PolarHBondContact O-N 2.95Å
53	N	96.4	Very high	93.9	Very high	101 Å²	101	93.7 Å²	93.7	54%	0.54	50%	0.5	S	S	.	.	H	α-helix	trans	-59.7	-39.9	179.2	-71.4	-28.6	0	0	0	112.2	D49 L50 L57	D49-N53 WeakPolarHBondContact O-CB 3.29Å; D49-N53 PolarHBondContact O-N 3.16Å; D49-N53 PolarHBondContact O-ND2 3.49Å; L50-N53 PolarHBondContact O-N 2.93Å; N53-L57 WeakPolarHBondContact O-CB 3.45Å; N53-L57 PolarHBondContact O-N 2.92Å
54	V	94.2	Very high	92.5	Very high	70 Å²	70	92.2 Å²	92.2	42%	0.424	49%	0.492	S	S	.	.	H	α-helix	trans	-65.8	-43.9	175.1	170	0	0	0	0	110.9	L50 Q51 K52 D56 L57 M58	L50-V54 HydrophobicContact CD1-CG2 4.5Å; L50-V54 WeakPolarHBondContact O-CB 3.45Å; L50-V54 VanDerWaalsContact O-CG2 3.29Å; L50-V54 WeakPolarHBondContact O-CG2 3.47Å; L50-V54 PolarHBondContact O-N 2.97Å; Q51-V54 PolarHBondContact O-N 2.8Å; K52-V54 VanDerWaalsContact C-N 3.29Å; K52-V54 PolarHBondContact O-N 3.33Å; V54-D56 PolarHBondContact O-N 2.98Å; V54-L57 PolarHBondContact O-N 3.13Å; V54-M58 HydrophobicContact CG1-CG 4.35Å; V54-M58 HydrophobicContact CG1-SD 3.85Å; V54-M58 VanDerWaalsContact O-CG 3.23Å; V54-M58 WeakPolarHBondContact O-CG 3.44Å; V54-M58 PolarHBondContact O-N 3.38Å
55	S	91.6	Very high	90.8	Very high	57 Å²	57	96.4 Å²	96.4	40%	0.399	51%	0.508	S	S	.	.	H	α-helix	trans	-58.8	-47.5	175.5	-173.1	0	0	0	0	111.5	Q51 K52 L57 M58 V59	Q51-S55 WeakPolarHBondContact O-CB 3.43Å; Q51-S55 PolarHBondContact O-N 2.98Å; K52-S55 WeakPolarHBondContact O-CB 3.4Å; K52-S55 PolarHBondContact O-N 3.47Å; K52-S55 VanDerWaalsContact O-N 3.11Å; S55-L57 VanDerWaalsContact C-N 3.32Å; S55-L57 PolarHBondContact O-N 3.27Å; S55-M58 WeakPolarHBondContact O-CB 3.41Å; S55-M58 PolarHBondContact O-N 3.47Å; S55-V59 WeakPolarHBondContact O-CG2 3.48Å; S55-V59 PolarHBondContact O-N 2.87Å
56	D	94.4	Very high	89.2	Confident	70 Å²	70	96.4 Å²	96.4	37%	0.374	51%	0.514	S	S	.	.	H	α-helix	trans	-62.5	-39.7	178.5	-70.4	-19.2	0	0	0	111.5	K52 V54 V59 Q60	K52-D56 PolarHBondContact O-N 2.95Å; V54-D56 PolarHBondContact O-N 2.98Å; D56-V59 PolarHBondContact O-N 2.71Å; D56-Q60 WeakPolarHBondContact O-CB 3.36Å; D56-Q60 VanDerWaalsContact O-CG 3.27Å; D56-Q60 WeakPolarHBondContact O-CG 3.22Å; D56-Q60 PolarHBondContact O-N 2.97Å; D56-Q60 PolarHBondContact O-NE2 3.25Å
57	L	94.4	Very high	87.5	Confident	111 Å²	111	90.4 Å²	90.4	58%	0.581	50%	0.496	S	S	*	.	H	α-helix	trans	-65.8	-40.9	175	-177.1	66.8	0	0	0	111.9	N53 V54 S55 V59 Q60 A61	N53-L57 WeakPolarHBondContact O-CB 3.45Å; N53-L57 PolarHBondContact O-N 2.92Å; V54-L57 PolarHBondContact O-N 3.13Å; S55-L57 VanDerWaalsContact C-N 3.32Å; S55-L57 PolarHBondContact O-N 3.27Å; L57-V59 VanDerWaalsContact C-N 3.31Å; L57-V59 PolarHBondContact O-N 3.49Å; L57-Q60 PolarHBondContact O-N 2.98Å; L57-A61 VanDerWaalsContact O-CB 3.29Å; L57-A61 WeakPolarHBondContact O-CB 3.45Å; L57-A61 PolarHBondContact O-N 3.46Å
58	M	89.1	Confident	85.8	Confident	54 Å²	54	91.8 Å²	91.8	27%	0.266	50%	0.498	S	S	.	.	H	α-helix	trans	-62.1	-39.6	176.1	-72.4	165.3	67	0	0	111.7	V54 S55 G62 I63 I67	V54-M58 HydrophobicContact CG1-CG 4.35Å; V54-M58 HydrophobicContact CG1-SD 3.85Å; V54-M58 VanDerWaalsContact O-CG 3.23Å; V54-M58 WeakPolarHBondContact O-CG 3.44Å; V54-M58 PolarHBondContact O-N 3.38Å; S55-M58 WeakPolarHBondContact O-CB 3.41Å; S55-M58 PolarHBondContact O-N 3.47Å; M58-G62 PolarHBondContact O-N 2.89Å; M58-I63 HydrophobicContact CB-CD1 4.35Å; M58-I63 HydrophobicContact CB-CG1 4.06Å; M58-I63 HydrophobicContact CG-CD1 4.08Å; M58-I63 HydrophobicContact CG-CG1 4.31Å; M58-I63 VanDerWaalsContact O-CG1 3.32Å; M58-I63 WeakPolarHBondContact O-CG1 3.48Å; M58-I63 PolarHBondContact O-N 3.39Å; M58-I63 VanDerWaalsContact O-N 3.12Å; M58-I67 HydrophobicContact CE-CD1 3.59Å
59	V	90.1	Very high	84	Confident	77 Å²	77	91.1 Å²	91.1	47%	0.467	50%	0.495	S	S	.	.	H	α-helix	trans	-64.6	-50.1	174	172	0	0	0	0	110.5	S55 D56 L57 A61 G62 E64	S55-V59 WeakPolarHBondContact O-CG2 3.48Å; S55-V59 PolarHBondContact O-N 2.87Å; D56-V59 PolarHBondContact O-N 2.71Å; L57-V59 VanDerWaalsContact C-N 3.31Å; L57-V59 PolarHBondContact O-N 3.49Å; V59-A61 VanDerWaalsContact C-N 3.31Å; V59-A61 PolarHBondContact O-N 2.97Å; V59-G62 PolarHBondContact O-N 3.14Å; V59-E64 VanDerWaalsContact CG2-OE2 3.28Å; V59-E64 WeakPolarHBondContact CG2-OE2 3.48Å
60	Q	89.8	Confident	82.1	Confident	158 Å²	158	92.6 Å²	92.6	74%	0.738	50%	0.499	S	S	*	.	H	α-helix	trans	-60.5	-39.1	179.5	-75.6	173.4	61.3	0	0	112.8	D56 L57 G62	D56-Q60 WeakPolarHBondContact O-CB 3.36Å; D56-Q60 VanDerWaalsContact O-CG 3.27Å; D56-Q60 WeakPolarHBondContact O-CG 3.22Å; D56-Q60 PolarHBondContact O-N 2.97Å; D56-Q60 PolarHBondContact O-NE2 3.25Å; L57-Q60 PolarHBondContact O-N 2.98Å; Q60-G62 PolarHBondContact O-N 3.08Å
61	A	89.5	Confident	80.3	Confident	62 Å²	62	94.1 Å²	94.1	51%	0.512	51%	0.505	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.7	-4.7	176.4	0	0	0	0	0	113.3	L57 V59 I63	L57-A61 VanDerWaalsContact O-CB 3.29Å; L57-A61 WeakPolarHBondContact O-CB 3.45Å; L57-A61 PolarHBondContact O-N 3.46Å; V59-A61 VanDerWaalsContact C-N 3.31Å; V59-A61 PolarHBondContact O-N 2.97Å; A61-I63 HydrophobicContact CB-CD1 4.35Å; A61-I63 HydrophobicContact CB-CG1 4.11Å; A61-I63 HydrophobicContact CB-CG2 4.31Å; A61-I63 PolarHBondContact O-N 2.98Å
62	G	83.3	Confident	78.8	Confident	60 Å²	60	94.6 Å²	94.6	62%	0.619	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	68	16.2	179.7	0	0	0	0	0	114.4	M58 V59 Q60	M58-G62 PolarHBondContact O-N 2.89Å; V59-G62 PolarHBondContact O-N 3.14Å; Q60-G62 PolarHBondContact O-N 3.08Å
63	I	81.4	Confident	77.1	Confident	71 Å²	71	96.6 Å²	96.6	36%	0.364	52%	0.52	S	S	.	.			trans	-93.6	-2.5	-173.9	59.3	173.3	0	0	0	113.9	M58 A61 N65 S66 I67	M58-I63 HydrophobicContact CB-CD1 4.35Å; M58-I63 HydrophobicContact CB-CG1 4.06Å; M58-I63 HydrophobicContact CG-CD1 4.08Å; M58-I63 HydrophobicContact CG-CG1 4.31Å; M58-I63 VanDerWaalsContact O-CG1 3.32Å; M58-I63 WeakPolarHBondContact O-CG1 3.48Å; M58-I63 PolarHBondContact O-N 3.39Å; M58-I63 VanDerWaalsContact O-N 3.12Å; A61-I63 HydrophobicContact CB-CD1 4.35Å; A61-I63 HydrophobicContact CB-CG1 4.11Å; A61-I63 HydrophobicContact CB-CG2 4.31Å; A61-I63 PolarHBondContact O-N 2.98Å; I63-N65 PolarHBondContact O-N 2.99Å; I63-N65 VanDerWaalsContact O-N 3.14Å; I63-S66 PolarHBondContact O-N 3.17Å; I63-S66 VanDerWaalsContact O-N 3.07Å; I63-I67 HydrophobicContact CD1-CD1 4.24Å; I63-I67 PolarHBondContact O-N 2.89Å
64	E	69.6	Low	74.9	Confident	82 Å²	82	101.2 Å²	101.2	38%	0.383	54%	0.542	S	S	.	.	H	α-helix	trans	-54.5	-36.7	-177.1	-163	-169.4	93	0	0	112.6	V59 K68	V59-E64 VanDerWaalsContact CG2-OE2 3.28Å; V59-E64 WeakPolarHBondContact CG2-OE2 3.48Å; E64-K68 WeakPolarHBondContact O-CG 3.46Å; E64-K68 IonicContact OE1-NZ 2.98Å; E64-K68 PolarHBondContact OE1-NZ 3.46Å
65	N	62.8	Low	74	Confident	114 Å²	114	102.8 Å²	102.8	61%	0.61	55%	0.548	S	S	*	.	H	α-helix	trans	-80.9	-29.1	-178.8	-148.2	26	0	0	0	113.3	I63 Q69	I63-N65 PolarHBondContact O-N 2.99Å; I63-N65 VanDerWaalsContact O-N 3.14Å; N65-Q69 WeakPolarHBondContact O-CB 3.32Å; N65-Q69 VanDerWaalsContact O-CG 3.32Å; N65-Q69 WeakPolarHBondContact O-CG 3.45Å; N65-Q69 PolarHBondContact O-N 2.88Å
66	S	62.8	Low	73	Confident	80 Å²	80	105.2 Å²	105.2	56%	0.559	56%	0.556	S	S	*	*	H	α-helix	trans	-69.4	-36.1	179	-70	0	0	0	0	112.1	I63 Q70	I63-S66 PolarHBondContact O-N 3.17Å; I63-S66 VanDerWaalsContact O-N 3.07Å; S66-Q70 WeakPolarHBondContact O-CB 3.06Å; S66-Q70 PolarHBondContact O-N 3.1Å
67	I	63.7	Low	71.9	Confident	61 Å²	61	107.1 Å²	107.1	31%	0.313	57%	0.566	S	S	.	*	H	α-helix	trans	-76.4	-42.2	-179.7	-66.4	169.9	0	0	0	111	M58 I63 Q69 Q70 M71	M58-I67 HydrophobicContact CE-CD1 3.59Å; I63-I67 HydrophobicContact CD1-CD1 4.24Å; I63-I67 PolarHBondContact O-N 2.89Å; I67-Q69 VanDerWaalsContact C-N 3.28Å; I67-Q69 PolarHBondContact O-N 3Å; I67-Q70 PolarHBondContact O-N 3.32Å; I67-M71 HydrophobicContact CG2-CG 4.4Å; I67-M71 HydrophobicContact CG2-SD 4.41Å; I67-M71 PolarHBondContact O-N 3.41Å
68	K	63.2	Low	70.5	Confident	112 Å²	112	106.9 Å²	106.9	49%	0.487	57%	0.565	S	S	.	*	H	α-helix	trans	-56.4	-43.7	174	-72	174.2	-178.7	168.8	0	111.2	E64 Q70 L72	E64-K68 WeakPolarHBondContact O-CG 3.46Å; E64-K68 IonicContact OE1-NZ 2.98Å; E64-K68 PolarHBondContact OE1-NZ 3.46Å; K68-Q70 VanDerWaalsContact C-N 3.3Å; K68-Q70 PolarHBondContact O-N 3.4Å; K68-L72 WeakPolarHBondContact O-CD1 3.36Å; K68-L72 PolarHBondContact O-N 3.01Å
69	Q	58.9	Low	69.4	Low	106 Å²	106	110.2 Å²	110.2	50%	0.495	58%	0.584	S	S	.	*	H	α-helix	trans	-69.2	-22.9	176.2	-74.1	-74.9	11.7	0	0	114.3	N65 I67 K73	N65-Q69 WeakPolarHBondContact O-CB 3.32Å; N65-Q69 VanDerWaalsContact O-CG 3.32Å; N65-Q69 WeakPolarHBondContact O-CG 3.45Å; N65-Q69 PolarHBondContact O-N 2.88Å; I67-Q69 VanDerWaalsContact C-N 3.28Å; I67-Q69 PolarHBondContact O-N 3Å; Q69-K73 WeakPolarHBondContact O-CD 3.47Å; Q69-K73 WeakPolarHBondContact O-CG 3.49Å
70	Q	59.4	Low	68	Low	128 Å²	128	112.4 Å²	112.4	60%	0.598	59%	0.592	S	S	*	*	H	α-helix	trans	-83.9	-38.6	176.4	-169.4	173.9	6.1	0	0	111.8	S66 I67 K68 L72 K73	S66-Q70 WeakPolarHBondContact O-CB 3.06Å; S66-Q70 PolarHBondContact O-N 3.1Å; I67-Q70 PolarHBondContact O-N 3.32Å; K68-Q70 VanDerWaalsContact C-N 3.3Å; K68-Q70 PolarHBondContact O-N 3.4Å; Q70-L72 VanDerWaalsContact C-N 3.32Å; Q70-L72 PolarHBondContact O-N 3.07Å; Q70-K73 PolarHBondContact O-N 3.1Å
71	M	60	Low	66.4	Low	141 Å²	141	109.1 Å²	109.1	70%	0.695	58%	0.581	S	S	*	*	H	α-helix	trans	-67.2	-30.8	175.6	-70	-171.4	122.6	0	0	113	I67 K73	I67-M71 HydrophobicContact CG2-CG 4.4Å; I67-M71 HydrophobicContact CG2-SD 4.41Å; I67-M71 PolarHBondContact O-N 3.41Å; M71-K73 PolarHBondContact O-N 3.14Å
72	L	64.8	Low	64.7	Low	141 Å²	141	112.8 Å²	112.8	74%	0.738	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.8	-9.1	173.8	-88.6	153.6	0	0	0	114.1	K68 Q70	K68-L72 WeakPolarHBondContact O-CD1 3.36Å; K68-L72 PolarHBondContact O-N 3.01Å; Q70-L72 VanDerWaalsContact C-N 3.32Å; Q70-L72 PolarHBondContact O-N 3.07Å
73	K	60.1	Low	63.1	Low	173 Å²	173	117.2 Å²	117.2	75%	0.752	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.1	2	-178.4	-73.5	177.8	-177.2	177.1	0	113.9	Q69 Q70 M71	Q69-K73 WeakPolarHBondContact O-CD 3.47Å; Q69-K73 WeakPolarHBondContact O-CG 3.49Å; Q70-K73 PolarHBondContact O-N 3.1Å; M71-K73 PolarHBondContact O-N 3.14Å
74	I	50.6	Low	61.4	Low	197 Å²	197	121.4 Å²	121.4	100%	1.01	60%	0.604	S	S	*	*			trans	-104.7	0	175.1	-54.1	172.5	0	0	0	107.6

Retrieved 74 of 74 residues in 25.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).