A0A096N947_PAPAN Loading...

DNA-directed RNA polymerase subunit

Core component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs using the four ribonucleoside triphosphates as substrates. Can mediate Pol I proofreading of the nascent RNA transcript. Anchors into the Pol III active site to constantly monitor transcription fidelity, cleaves mis-incorporated 5'-ribonucleotides and restarts the transcription process. Once Pol III reaches the poly(dT) termination signal, can induce Pol III clamp opening and transcription termination. Pol III plays an important role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as a nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

AlphaFold DB , UniProt , Accession A0A096N947, Species PAPAN (Papio anubis, Olive baboon), Gene POLR3K, Length 108 aa.

						>A0A096N947_PAPAN|A0A096N947|POLR3K
MLLFCPGCGNGLMVEEGQRCHRFACNRCPYVHNITRKVTNRKYPKLKEVDDVLGGAAACENVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCSAQRGHRWRD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.4	Confident	87.8	Confident	135 Å²	135	77.2 Å²	77.2	67%	0.665	48%	0.484	S	S	*	.				0	129.7	0	-171.3	163.4	68.3	0	0	108.4	L3 V38 N40	M1-L3 HydrophobicContact CE-CD2 4.19Å; M1-L3 HydrophobicContact CE-CG 4.42Å; M1-V38 HydrophobicContact CE-CG1 4.07Å; M1-N40 HydrophobicContact CB-CB 4.3Å
2	L	84	Confident	88.2	Confident	142 Å²	142	72.9 Å²	72.9	74%	0.743	46%	0.455	S	S	*	.			trans	-97.3	132	171.7	-67.7	168.8	0	0	0	108	F4	L2-F4 HydrophobicContact CB-CE2 4.29Å; L2-F4 HydrophobicContact CB-CZ 4.09Å
3	L	87.7	Confident	88.4	Confident	63 Å²	63	75.4 Å²	75.4	33%	0.33	46%	0.46	S	S	.	.			trans	-111	138.6	175.2	-68	169.8	0	0	0	108.4	M1 L12 F23	M1-L3 HydrophobicContact CE-CD2 4.19Å; M1-L3 HydrophobicContact CE-CG 4.42Å; L3-L12 HydrophobicContact CB-CB 4.42Å; L3-L12 HydrophobicContact CB-CD1 4.16Å; L3-L12 PolarHBondContact O-N 2.93Å; L3-F23 HydrophobicContact CD1-CD1 4.16Å; L3-F23 HydrophobicContact CD1-CD2 4.22Å; L3-F23 HydrophobicContact CD1-CE1 3.74Å; L3-F23 HydrophobicContact CD1-CE2 3.81Å; L3-F23 HydrophobicContact CD1-CG 4.38Å; L3-F23 HydrophobicContact CD1-CZ 3.57Å
4	F	91.3	Very high	88.6	Confident	127 Å²	127	76.6 Å²	76.6	56%	0.557	47%	0.467	S	S	*	.	B	Isolated β-bridge	trans	-115.1	147	-175.9	-61.7	-74.5	0	0	0	111.3	L2 G9 N10	L2-F4 HydrophobicContact CB-CE2 4.29Å; L2-F4 HydrophobicContact CB-CZ 4.09Å; F4-G9 WeakPolarHBondContact CD1-O 3.47Å; F4-N10 WeakPolarHBondContact CA-O 3.36Å
5	C	92.2	Very high	88.7	Confident	4 Å²	4	76.6 Å²	76.6	3%	0.027	46%	0.46	C	S	.	.			trans	-71.1	129.2	174.8	177.9	0	0	0	0	110.3	G7 C8 G9 N10 L12 C25 C28 Y30	C5-G7 VanDerWaalsContact C-N 3.26Å; C5-G7 PolarHBondContact O-N 3.41Å; C5-C8 VanDerWaalsContact CB-SG 3.55Å; C5-G9 WeakPolarHBondContact O-CA 3.5Å; C5-G9 PolarHBondContact O-N 3.4Å; C5-N10 PolarHBondContact N-O 3.27Å; C5-L12 HydrophobicContact CB-CD2 3.82Å; C5-L12 HydrophobicContact CB-CG 4.43Å; C5-C25 HydrophobicContact CB-CB 4.26Å; C5-C28 PolarHBondContact SG-SG 3.16Å; C5-Y30 HydrophobicContact CB-CD1 4.45Å; C5-Y30 VanDerWaalsContact SG-CB 3.58Å
6	P	89.1	Confident	88.7	Confident	102 Å²	102	81.6 Å²	81.6	66%	0.662	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66	-25.5	-179.5	24.4	-32.4	0	0	0	113.7	Y30	P6-Y30 HydrophobicContact CG-CD2 4.16Å; P6-Y30 HydrophobicContact CG-CE2 3.61Å
7	G	88.3	Confident	88.5	Confident	74 Å²	74	78.1 Å²	78.1	76%	0.763	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.1	-46.8	178.8	0	0	0	0	0	114.9	C5	C5-G7 VanDerWaalsContact C-N 3.26Å; C5-G7 PolarHBondContact O-N 3.41Å
8	C	89.6	Confident	88.2	Confident	53 Å²	53	85.2 Å²	85.2	36%	0.358	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.6	-1.7	-170.3	64.1	0	0	0	0	114.6	C5 N10 C25	C5-C8 VanDerWaalsContact CB-SG 3.55Å; C8-N10 PolarHBondContact O-N 2.86Å; C8-C25 PolarHBondContact SG-SG 3.03Å
9	G	86.6	Confident	87.9	Confident	48 Å²	48	93.4 Å²	93.4	50%	0.495	51%	0.512	S	S	.	.			trans	68.3	-0.9	178.9	0	0	0	0	0	115.6	F4 C5	F4-G9 WeakPolarHBondContact CD1-O 3.47Å; C5-G9 WeakPolarHBondContact O-CA 3.5Å; C5-G9 PolarHBondContact O-N 3.4Å
10	N	90	Very high	87.8	Confident	64 Å²	64	91.8 Å²	91.8	34%	0.342	51%	0.507	S	S	.	.	P	Polyproline II helix	trans	-72.7	153.1	177.6	-90.1	-9.7	0	0	0	112.3	F4 C5 C8 L12 R27	F4-N10 WeakPolarHBondContact CA-O 3.36Å; C5-N10 PolarHBondContact N-O 3.27Å; C8-N10 PolarHBondContact O-N 2.86Å; N10-L12 PolarHBondContact O-N 3.06Å; N10-R27 WeakPolarHBondContact ND2-CB 3.49Å; N10-R27 WeakPolarHBondContact ND2-CD 3.47Å
11	G	91.1	Very high	87.9	Confident	37 Å²	37	92.1 Å²	92.1	38%	0.381	51%	0.505	S	S	.	.	B	Isolated β-bridge	trans	-60.9	133.7	172.9	0	0	0	0	0	111.7
12	L	92.3	Very high	88.6	Confident	26 Å²	26	89.8 Å²	89.8	14%	0.136	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.2	136.7	173.7	-63.9	173.6	0	0	0	110.2	L3 C5 N10 F23 C25 Y30	L3-L12 HydrophobicContact CB-CB 4.42Å; L3-L12 HydrophobicContact CB-CD1 4.16Å; L3-L12 PolarHBondContact O-N 2.93Å; C5-L12 HydrophobicContact CB-CD2 3.82Å; C5-L12 HydrophobicContact CB-CG 4.43Å; N10-L12 PolarHBondContact O-N 3.06Å; L12-F23 HydrophobicContact CB-CB 4.11Å; L12-F23 HydrophobicContact CD1-CB 4.12Å; L12-C25 HydrophobicContact CD2-CB 3.83Å; L12-Y30 HydrophobicContact CD1-CD1 4.45Å; L12-Y30 HydrophobicContact CD1-CE1 3.93Å; L12-Y30 HydrophobicContact CD2-CD1 3.7Å; L12-Y30 HydrophobicContact CD2-CE1 4.04Å
13	M	90.5	Very high	89	Confident	105 Å²	105	84.4 Å²	84.4	52%	0.517	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	150.4	175.7	-63.9	-59.2	-68.9	0	0	110.1	F23 A24	M13-F23 CarbonylContact O-C 3.59Å; M13-F23 VanDerWaalsContact O-CA 3.27Å; M13-F23 WeakPolarHBondContact O-CA 3.35Å; M13-A24 PolarHBondContact N-O 2.83Å; M13-A24 PolarHBondContact O-N 2.88Å
14	V	91.7	Very high	89.1	Confident	92 Å²	92	81.7 Å²	81.7	56%	0.558	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.9	124.7	175.4	-178.7	0	0	0	0	108.6	F23	V14-F23 HydrophobicContact CG2-CD1 3.74Å; V14-F23 HydrophobicContact CG2-CE1 3.44Å; V14-F23 VanDerWaalsContact CG2-CE1 3.44Å; V14-F23 HydrophobicContact CG2-CZ 4.45Å
15	E	89.3	Confident	89.2	Confident	77 Å²	77	76.1 Å²	76.1	36%	0.36	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	154.8	175.3	-66.6	-174.9	172.4	0	0	111.2	H21 R22 A24	E15-H21 WeakPolarHBondContact O-CA 3.43Å; E15-R22 HydrophobicContact CB-CG 4.2Å; E15-R22 PolarHBondContact N-O 2.85Å; E15-R22 PolarHBondContact O-N 3.31Å; E15-R22 IonicContact OE2-NE 3.52Å; E15-R22 IonicContact OE2-NH2 2.9Å; E15-A24 HydrophobicContact CG-CB 4.09Å; E15-A24 WeakPolarHBondContact OE2-CB 3.44Å
16	E	89.4	Confident	89	Confident	157 Å²	157	82 Å²	82	73%	0.734	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86	118.2	171.2	-56.1	-165.3	153	0	0	110	H21	E16-H21 IonicContact OE1-CE1 3.72Å; E16-H21 PolarHBondContact OE1-CE1 3.49Å
17	G	84.4	Confident	89	Confident	22 Å²	22	87 Å²	87	23%	0.227	46%	0.459	C	S	.	.			trans	-92	170.4	168.4	0	0	0	0	0	111.4	R19 C20	G17-R19 PolarHBondContact O-N 2.93Å; G17-C20 WeakPolarHBondContact CA-O 3.34Å; G17-C20 PolarHBondContact N-O 3.33Å
18	Q	83.4	Confident	89	Confident	206 Å²	206	85.1 Å²	85.1	96%	0.963	43%	0.434	S	S	*	.	S	Bend	trans	-59.1	-21.2	-179.2	-70	171.3	-7.8	0	0	114.9
19	R	83.1	Confident	89.1	Confident	240 Å²	240	88.8 Å²	88.8	91%	0.906	46%	0.457	S	S	*	.	S	Bend	trans	-129.1	-28.7	-176.7	-66.3	-174.6	179.6	-173.3	-0.7	114.2	G17	G17-R19 PolarHBondContact O-N 2.93Å
20	C	86.4	Confident	89.3	Confident	62 Å²	62	90.2 Å²	90.2	42%	0.419	45%	0.448	S	S	.	.	S	Bend	trans	-149.9	157.1	-177.3	-57.4	0	0	0	0	110.2	G17	G17-C20 WeakPolarHBondContact CA-O 3.34Å; G17-C20 PolarHBondContact N-O 3.33Å
21	H	89.7	Confident	89.3	Confident	98 Å²	98	90.8 Å²	90.8	45%	0.454	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.4	141	164.1	-61.7	-72.5	0	0	0	110.1	E15 E16 I34	E15-H21 WeakPolarHBondContact O-CA 3.43Å; E16-H21 IonicContact OE1-CE1 3.72Å; E16-H21 PolarHBondContact OE1-CE1 3.49Å; H21-I34 HydrophobicContact CB-CD1 4.04Å; H21-I34 WeakPolarHBondContact O-CB 3.33Å; H21-I34 WeakPolarHBondContact O-CG1 3.4Å; H21-I34 PolarHBondContact O-N 3.05Å
22	R	91.1	Very high	89.1	Confident	86 Å²	86	93.5 Å²	93.5	33%	0.325	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	146.3	-176.8	60.7	-176.4	-179.5	-170.8	-0	110.9	E15 H32	E15-R22 HydrophobicContact CB-CG 4.2Å; E15-R22 PolarHBondContact N-O 2.85Å; E15-R22 PolarHBondContact O-N 3.31Å; E15-R22 IonicContact OE2-NE 3.52Å; E15-R22 IonicContact OE2-NH2 2.9Å; R22-H32 CarbonylContact C-O 3.49Å; R22-H32 VanDerWaalsContact CA-O 3.3Å; R22-H32 WeakPolarHBondContact CA-O 3.32Å
23	F	91.3	Very high	89.1	Confident	30 Å²	30	96.4 Å²	96.4	13%	0.132	47%	0.472	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.8	113.8	165.9	-66.2	-70.9	0	0	0	108.5	L3 L12 M13 V14 V31 H32 I34	L3-F23 HydrophobicContact CD1-CD1 4.16Å; L3-F23 HydrophobicContact CD1-CD2 4.22Å; L3-F23 HydrophobicContact CD1-CE1 3.74Å; L3-F23 HydrophobicContact CD1-CE2 3.81Å; L3-F23 HydrophobicContact CD1-CG 4.38Å; L3-F23 HydrophobicContact CD1-CZ 3.57Å; L12-F23 HydrophobicContact CB-CB 4.11Å; L12-F23 HydrophobicContact CD1-CB 4.12Å; M13-F23 CarbonylContact O-C 3.59Å; M13-F23 VanDerWaalsContact O-CA 3.27Å; M13-F23 WeakPolarHBondContact O-CA 3.35Å; V14-F23 HydrophobicContact CG2-CD1 3.74Å; V14-F23 HydrophobicContact CG2-CE1 3.44Å; V14-F23 VanDerWaalsContact CG2-CE1 3.44Å; V14-F23 HydrophobicContact CG2-CZ 4.45Å; F23-V31 CarbonylContact O-C 3.54Å; F23-V31 WeakPolarHBondContact O-CA 3.49Å; F23-H32 HydrophobicContact CB-CB 4.29Å; F23-H32 PolarHBondContact N-O 3.15Å; F23-H32 PolarHBondContact O-N 2.83Å; F23-I34 HydrophobicContact CD2-CD1 3.96Å; F23-I34 HydrophobicContact CD2-CG1 3.72Å; F23-I34 HydrophobicContact CE1-CD1 4.29Å; F23-I34 HydrophobicContact CE2-CD1 3.47Å; F23-I34 VanDerWaalsContact CE2-CD1 3.47Å; F23-I34 HydrophobicContact CE2-CG1 3.48Å; F23-I34 VanDerWaalsContact CE2-CG1 3.48Å; F23-I34 HydrophobicContact CZ-CD1 3.65Å; F23-I34 HydrophobicContact CZ-CG1 4.2Å
24	A	91.4	Very high	89	Confident	5 Å²	5	93.6 Å²	93.6	4%	0.041	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	144.4	-179.9	0	0	0	0	0	110.6	M13 E15 V31	M13-A24 PolarHBondContact N-O 2.83Å; M13-A24 PolarHBondContact O-N 2.88Å; E15-A24 HydrophobicContact CG-CB 4.09Å; E15-A24 WeakPolarHBondContact OE2-CB 3.44Å; A24-V31 HydrophobicContact CB-CG1 4.22Å
25	C	92.2	Very high	88.8	Confident	11 Å²	11	95.2 Å²	95.2	7%	0.074	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91	135	170.3	-170.3	0	0	0	0	110.4	C5 C8 L12 R27 C28 Y30	C5-C25 HydrophobicContact CB-CB 4.26Å; C8-C25 PolarHBondContact SG-SG 3.03Å; L12-C25 HydrophobicContact CD2-CB 3.83Å; C25-R27 PolarHBondContact O-N 2.9Å; C25-C28 WeakPolarHBondContact CB-SG 3.3Å; C25-C28 VanDerWaalsContact SG-SG 3.61Å; C25-Y30 PolarHBondContact N-O 2.87Å
26	N	88.8	Confident	88.7	Confident	126 Å²	126	100.9 Å²	100.9	67%	0.674	49%	0.487	S	S	*	.	S	Bend	trans	-71.8	-17.3	178.2	-65.8	-0.2	0	0	0	113.7
27	R	88	Confident	88.6	Confident	207 Å²	207	102.6 Å²	102.6	78%	0.781	49%	0.492	S	S	*	.	S	Bend	trans	-112.8	-15.8	-172	-151.1	173.1	-146.3	-172.4	6.3	114.1	N10 C25	N10-R27 WeakPolarHBondContact ND2-CB 3.49Å; N10-R27 WeakPolarHBondContact ND2-CD 3.47Å; C25-R27 PolarHBondContact O-N 2.9Å
28	C	89.9	Confident	88.7	Confident	35 Å²	35	105.1 Å²	105.1	24%	0.236	50%	0.503	C	S	.	.	S	Bend	trans	-139.5	162.5	178.5	71.7	0	0	0	0	111	C5 C25 Y30	C5-C28 PolarHBondContact SG-SG 3.16Å; C25-C28 WeakPolarHBondContact CB-SG 3.3Å; C25-C28 VanDerWaalsContact SG-SG 3.61Å; C28-Y30 PolarHBondContact O-N 2.84Å; C28-Y30 WeakPolarHBondContact SG-CB 3.27Å
29	P	90.1	Very high	88.9	Confident	130 Å²	130	99.5 Å²	99.5	84%	0.844	48%	0.483	S	S	*	.	S	Bend	trans	-71.2	11	-178.4	-14.9	30.2	0	0	0	114.6	V31	P29-V31 PolarHBondContact O-N 2.78Å
30	Y	90.8	Very high	89.1	Confident	78 Å²	78	93 Å²	93	31%	0.306	47%	0.466	S	S	.	.			trans	-69.5	123.9	-177.8	-179.3	-93.5	0	0	0	110.4	C5 P6 L12 C25 C28 H32	C5-Y30 HydrophobicContact CB-CD1 4.45Å; C5-Y30 VanDerWaalsContact SG-CB 3.58Å; P6-Y30 HydrophobicContact CG-CD2 4.16Å; P6-Y30 HydrophobicContact CG-CE2 3.61Å; L12-Y30 HydrophobicContact CD1-CD1 4.45Å; L12-Y30 HydrophobicContact CD1-CE1 3.93Å; L12-Y30 HydrophobicContact CD2-CD1 3.7Å; L12-Y30 HydrophobicContact CD2-CE1 4.04Å; C25-Y30 PolarHBondContact N-O 2.87Å; C28-Y30 PolarHBondContact O-N 2.84Å; C28-Y30 WeakPolarHBondContact SG-CB 3.27Å; Y30-H32 HydrophobicContact CE1-CB 4.07Å
31	V	89.7	Confident	89.1	Confident	76 Å²	76	98.8 Å²	98.8	46%	0.461	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	139.2	175.7	-66.2	0	0	0	0	110	F23 A24 P29	F23-V31 CarbonylContact O-C 3.54Å; F23-V31 WeakPolarHBondContact O-CA 3.49Å; A24-V31 HydrophobicContact CB-CG1 4.22Å; P29-V31 PolarHBondContact O-N 2.78Å
32	H	88.8	Confident	88.9	Confident	95 Å²	95	103.1 Å²	103.1	44%	0.44	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	115.3	176.5	-171.7	77.9	0	0	0	110.6	R22 F23 Y30	R22-H32 CarbonylContact C-O 3.49Å; R22-H32 VanDerWaalsContact CA-O 3.3Å; R22-H32 WeakPolarHBondContact CA-O 3.32Å; F23-H32 HydrophobicContact CB-CB 4.29Å; F23-H32 PolarHBondContact N-O 3.15Å; F23-H32 PolarHBondContact O-N 2.83Å; Y30-H32 HydrophobicContact CE1-CB 4.07Å
33	N	90.6	Very high	88.4	Confident	86 Å²	86	104 Å²	104	46%	0.46	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	133.7	-177.1	-64.5	-25.6	0	0	0	111.3	T35	N33-T35 PolarHBondContact O-N 3Å; N33-T35 VanDerWaalsContact O-N 3.16Å
34	I	89.8	Confident	87.9	Confident	47 Å²	47	106.9 Å²	106.9	24%	0.241	52%	0.522	C	S	.	.			trans	-82.1	96	178.4	-54.2	177.7	0	0	0	108.5	H21 F23 R36 V38	H21-I34 HydrophobicContact CB-CD1 4.04Å; H21-I34 WeakPolarHBondContact O-CB 3.33Å; H21-I34 WeakPolarHBondContact O-CG1 3.4Å; H21-I34 PolarHBondContact O-N 3.05Å; F23-I34 HydrophobicContact CD2-CD1 3.96Å; F23-I34 HydrophobicContact CD2-CG1 3.72Å; F23-I34 HydrophobicContact CE1-CD1 4.29Å; F23-I34 HydrophobicContact CE2-CD1 3.47Å; F23-I34 VanDerWaalsContact CE2-CD1 3.47Å; F23-I34 HydrophobicContact CE2-CG1 3.48Å; F23-I34 VanDerWaalsContact CE2-CG1 3.48Å; F23-I34 HydrophobicContact CZ-CD1 3.65Å; F23-I34 HydrophobicContact CZ-CG1 4.2Å; I34-R36 WeakPolarHBondContact CG2-O 3.48Å; I34-V38 HydrophobicContact CG2-CG2 4.44Å
35	T	87.4	Confident	87.2	Confident	125 Å²	125	116.3 Å²	116.3	77%	0.767	56%	0.562	S	S	*	*			trans	-89.7	-21.7	179.6	54.8	0	0	0	0	113.6	N33	N33-T35 PolarHBondContact O-N 3Å; N33-T35 VanDerWaalsContact O-N 3.16Å
36	R	86.3	Confident	86.1	Confident	197 Å²	197	120.2 Å²	120.2	74%	0.743	58%	0.582	S	S	*	*	S	Bend	trans	-128.1	155.2	-176.5	63.4	-178.9	178.6	-127.3	0.3	111.2	I34 V38	I34-R36 WeakPolarHBondContact CG2-O 3.48Å; R36-V38 PolarHBondContact O-N 3.39Å; R36-V38 VanDerWaalsContact O-N 3.15Å
37	K	87.2	Confident	85.2	Confident	192 Å²	192	123.5 Å²	123.5	84%	0.835	59%	0.59	S	S	*	*			trans	-62.7	115.8	176.3	-172.2	176.1	-178.7	174.8	0	110.1	T39	K37-T39 HydrophobicContact CD-CG2 4.45Å; K37-T39 HydrophobicContact CG-CG2 4.11Å
38	V	86	Confident	83.8	Confident	75 Å²	75	122 Å²	122	46%	0.455	59%	0.592	S	S	.	*			trans	-102.8	129.7	172.6	-177.4	0	0	0	0	107.9	M1 I34 R36	M1-V38 HydrophobicContact CE-CG1 4.07Å; I34-V38 HydrophobicContact CG2-CG2 4.44Å; R36-V38 PolarHBondContact O-N 3.39Å; R36-V38 VanDerWaalsContact O-N 3.15Å
39	T	88.1	Confident	82.3	Confident	89 Å²	89	122.8 Å²	122.8	55%	0.546	60%	0.595	S	S	.	*			trans	-128	143.6	176.4	61.9	0	0	0	0	110.2	K37	K37-T39 HydrophobicContact CD-CG2 4.45Å; K37-T39 HydrophobicContact CG-CG2 4.11Å
40	N	87.1	Confident	80.6	Confident	103 Å²	103	123 Å²	123	55%	0.551	59%	0.59	S	S	*	*			trans	-128.7	111.8	171	-172.8	-105.8	0	0	0	107.5	M1	M1-N40 HydrophobicContact CB-CB 4.3Å
41	R	86.6	Confident	78.8	Confident	184 Å²	184	125.7 Å²	125.7	69%	0.694	61%	0.609	S	S	*	*			trans	-96.7	125.2	178.4	-64.2	-179.5	-179	-179.4	-1.7	108.3	Y43	R41-Y43 HydrophobicContact CB-CE2 4.09Å
42	K	85.6	Confident	77.1	Confident	188 Å²	188	125.2 Å²	125.2	82%	0.817	61%	0.606	S	S	*	*			trans	-101.6	125	165.7	-172.8	175.5	-177.1	-179.5	0	106.5	P44	K42-P44 WeakPolarHBondContact O-CD 3.16Å
43	Y	80.9	Confident	75.4	Confident	105 Å²	105	121.6 Å²	121.6	41%	0.412	59%	0.59	S	S	.	*			trans	-93	98.5	175.8	-66.3	-84.2	0	0	0	108.4	R41 D88	R41-Y43 HydrophobicContact CB-CE2 4.09Å; Y43-D88 WeakPolarHBondContact CE1-OD2 3.34Å; Y43-D88 PolarHBondContact OH-OD1 3.07Å; Y43-D88 PolarHBondContact OH-OD2 3.09Å
44	P	80.6	Confident	73.4	Confident	90 Å²	90	119.5 Å²	119.5	58%	0.584	59%	0.589	S	S	*	*	P	Polyproline II helix	trans	-65.6	145.1	174.1	29.4	-34.4	0	0	0	109.2	K42 L46	K42-P44 WeakPolarHBondContact O-CD 3.16Å; P44-L46 PolarHBondContact O-N 2.9Å
45	K	77.4	Confident	71.8	Confident	204 Å²	204	119.8 Å²	119.8	89%	0.887	60%	0.603	S	S	*	*	P	Polyproline II helix	trans	-67.9	119.3	162.6	-66.6	-174.5	179	-175.9	0	106.8
46	L	68.8	Low	70	Confident	92 Å²	92	118.3 Å²	118.3	48%	0.482	60%	0.604	S	S	.	*	P	Polyproline II helix	trans	-65.4	145.5	169.4	-73.8	102.2	0	0	0	108.5	P44 R85	P44-L46 PolarHBondContact O-N 2.9Å; L46-R85 WeakPolarHBondContact CD1-O 3.41Å
47	K	69.9	Low	68.3	Low	196 Å²	196	112.6 Å²	112.6	85%	0.852	60%	0.599	S	S	*	*	P	Polyproline II helix	trans	-59	143	169	-76.3	-176.2	176.8	-178.1	0	108.2	V49	K47-V49 PolarHBondContact O-N 3.04Å
48	E	59.2	Low	66.7	Low	174 Å²	174	105.7 Å²	105.7	81%	0.813	58%	0.577	S	S	*	*	P	Polyproline II helix	trans	-56.8	130.2	171.8	-65.9	-169.9	137.3	0	0	108.3	D50	E48-D50 PolarHBondContact O-N 3.17Å
49	V	58.5	Low	65.1	Low	52 Å²	52	102.4 Å²	102.4	32%	0.315	56%	0.558	S	S	.	*			trans	-77.2	79.4	-177.9	-176.6	0	0	0	0	107.2	K47 V52	K47-V49 PolarHBondContact O-N 3.04Å; V49-V52 HydrophobicContact CG1-CB 3.49Å; V49-V52 VanDerWaalsContact CG1-CB 3.49Å; V49-V52 HydrophobicContact CG1-CG2 3Å
50	D	53.1	Low	63.4	Low	136 Å²	136	106 Å²	106	73%	0.727	57%	0.568	S	S	*	*			trans	-71.6	125.7	164.7	-81.7	-41.4	0	0	0	108.3	E48	E48-D50 PolarHBondContact O-N 3.17Å
51	D	52.8	Low	61.8	Low	134 Å²	134	108.9 Å²	108.9	72%	0.717	58%	0.584	S	S	*	*			trans	65.3	37.3	168.4	-60	-26.4	0	0	0	119.9	L53	D51-L53 PolarHBondContact O-N 2.96Å
52	V	53.5	Low	60.7	Low	65 Å²	65	101.3 Å²	101.3	39%	0.394	56%	0.558	S	S	.	*	S	Bend	trans	-67.6	-17.3	169.1	159.1	0	0	0	0	114.6	V49 G54 M80 L82	V49-V52 HydrophobicContact CG1-CB 3.49Å; V49-V52 VanDerWaalsContact CG1-CB 3.49Å; V49-V52 HydrophobicContact CG1-CG2 3Å; V52-G54 VanDerWaalsContact C-N 3.32Å; V52-G54 PolarHBondContact O-N 3.22Å; V52-M80 HydrophobicContact CG1-SD 3.75Å; V52-L82 HydrophobicContact CG1-CD1 3.98Å; V52-L82 HydrophobicContact CG1-CD2 4.13Å
53	L	53.9	Low	59.8	Low	20 Å²	20	98.1 Å²	98.1	11%	0.105	55%	0.55	C	S	.	.	S	Bend	trans	-96	59.7	174.8	-81.5	160.5	0	0	0	110.9	D51 G55 K96 R105	D51-L53 PolarHBondContact O-N 2.96Å; L53-G55 PolarHBondContact O-N 3.5Å; L53-G55 VanDerWaalsContact O-N 3.15Å; L53-K96 HydrophobicContact CB-CD 4.38Å; L53-K96 HydrophobicContact CD1-CB 4.36Å; L53-K96 HydrophobicContact CD1-CD 4.37Å; L53-K96 HydrophobicContact CD2-CD 4.17Å; L53-R105 HydrophobicContact CD1-CG 4.37Å
54	G	49.8	Very low	59.3	Low	42 Å²	42	96.2 Å²	96.2	43%	0.433	55%	0.552	S	S	.	*			trans	-52.1	114.7	176.8	0	0	0	0	0	112.6	V52 A58	V52-G54 VanDerWaalsContact C-N 3.32Å; V52-G54 PolarHBondContact O-N 3.22Å; G54-A58 WeakPolarHBondContact O-CB 3.37Å; G54-A58 PolarHBondContact O-N 3.3Å
55	G	54.2	Low	59.2	Low	52 Å²	52	94.1 Å²	94.1	54%	0.536	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	54.2	-175.9	167.3	0	0	0	0	0	116.7	L53 A57 K96	L53-G55 PolarHBondContact O-N 3.5Å; L53-G55 VanDerWaalsContact O-N 3.15Å; G55-A57 VanDerWaalsContact C-N 3.29Å; G55-K96 PolarHBondContact O-NZ 3.08Å
56	A	51.6	Low	59.2	Low	94 Å²	94	88.7 Å²	88.7	78%	0.777	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.8	-24.5	174.8	0	0	0	0	0	112.5
57	A	50.2	Low	59.4	Low	78 Å²	78	87.4 Å²	87.4	65%	0.645	52%	0.522	S	S	*	.	G	3₁₀ helix	trans	-78.7	-26.2	-174.4	0	0	0	0	0	114.6	G55 C59	G55-A57 VanDerWaalsContact C-N 3.29Å; A57-C59 PolarHBondContact O-N 3.41Å
58	A	52	Low	59.8	Low	46 Å²	46	82.2 Å²	82.2	38%	0.38	51%	0.508	S	S	.	.	G	3₁₀ helix	trans	-75.8	-4.3	176.5	0	0	0	0	0	113.4	G54 V62	G54-A58 WeakPolarHBondContact O-CB 3.37Å; G54-A58 PolarHBondContact O-N 3.3Å; A58-V62 VanDerWaalsContact O-CG2 3.23Å; A58-V62 WeakPolarHBondContact O-CG2 3.43Å
59	C	53	Low	60.7	Low	6 Å²	6	74 Å²	74	4%	0.041	47%	0.47	C	S	.	.	G	3₁₀ helix	trans	-93.8	-6.8	-179.3	-60.8	0	0	0	0	113.5	A57 N61 Y78 K96	A57-C59 PolarHBondContact O-N 3.41Å; C59-N61 VanDerWaalsContact C-N 3.3Å; C59-N61 PolarHBondContact O-N 2.77Å; C59-Y78 HydrophobicContact CB-CD2 3.78Å; C59-Y78 HydrophobicContact CB-CE2 3.78Å; C59-Y78 HydrophobicContact CB-CG 4.31Å; C59-Y78 WeakPolarHBondContact O-CE1 3.45Å; C59-Y78 VanDerWaalsContact O-CZ 3.3Å; C59-K96 VanDerWaalsContact SG-CD 3.51Å; C59-K96 WeakPolarHBondContact SG-CE 3.44Å; C59-K96 PolarHBondContact SG-NZ 2.81Å
60	E	53.1	Low	61.6	Low	164 Å²	164	75.9 Å²	75.9	77%	0.766	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.5	-19.3	-176.8	-151.9	165.9	-164.2	0	0	112.6
61	N	53.3	Low	62.7	Low	164 Å²	164	76.1 Å²	76.1	88%	0.877	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.7	15.5	180	-81.8	-58	0	0	0	114.1	C59	C59-N61 VanDerWaalsContact C-N 3.3Å; C59-N61 PolarHBondContact O-N 2.77Å
62	V	62.8	Low	63.8	Low	26 Å²	26	71.7 Å²	71.7	16%	0.158	46%	0.457	C	S	.	.	S	Bend	trans	-102.8	139.3	-178.8	-176.5	0	0	0	0	109.7	A58 Y78 F79 M80	A58-V62 VanDerWaalsContact O-CG2 3.23Å; A58-V62 WeakPolarHBondContact O-CG2 3.43Å; V62-Y78 HydrophobicContact CB-CD1 4.42Å; V62-Y78 WeakPolarHBondContact O-CD1 3.24Å; V62-F79 WeakPolarHBondContact CG1-O 3.28Å; V62-M80 HydrophobicContact CG1-CE 4.44Å; V62-M80 HydrophobicContact CG2-CE 3.99Å
63	D	66.8	Low	64.8	Low	120 Å²	120	76.5 Å²	76.5	64%	0.642	48%	0.475	S	S	*	.			trans	-55.3	139.8	175.9	-67.3	-48.5	0	0	0	111.2	F79	D63-F79 HydrophobicContact CB-CD1 4.28Å; D63-F79 HydrophobicContact CB-CE1 3.49Å; D63-F79 VanDerWaalsContact CB-CE1 3.49Å; D63-F79 HydrophobicContact CB-CZ 3.79Å; D63-F79 WeakPolarHBondContact O-CD1 3.29Å; D63-F79 PolarHBondContact O-N 2.83Å; D63-F79 VanDerWaalsContact O-N 3.08Å
64	S	71.8	Confident	65.9	Low	66 Å²	66	79 Å²	79	46%	0.462	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	135.4	-179	68.4	0	0	0	0	110.6	A77	S64-A77 WeakPolarHBondContact CA-O 3.01Å
65	T	77.4	Confident	67.2	Low	46 Å²	46	80.9 Å²	80.9	28%	0.282	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	151	176.9	-70.4	0	0	0	0	109.8	E67 A77 F79	T65-E67 HydrophobicContact CG2-CB 4.29Å; T65-E67 HydrophobicContact CG2-CG 3.95Å; T65-E67 PolarHBondContact O-N 3.26Å; T65-A77 PolarHBondContact N-O 3.41Å; T65-A77 PolarHBondContact O-N 2.88Å; T65-A77 VanDerWaalsContact O-N 3.08Å; T65-F79 WeakPolarHBondContact OG1-CD1 3.1Å; T65-F79 WeakPolarHBondContact OG1-CE1 3.08Å
66	A	76.6	Confident	68.2	Low	90 Å²	90	86.1 Å²	86.1	74%	0.744	49%	0.494	S	S	*	.			trans	-77.1	44	175.8	0	0	0	0	0	112.9	P75	A66-P75 CarbonylContact C-O 3.45Å; A66-P75 VanDerWaalsContact CA-O 3.29Å; A66-P75 WeakPolarHBondContact CA-O 3.14Å
67	E	73.9	Confident	69.6	Low	65 Å²	65	81.6 Å²	81.6	30%	0.304	46%	0.457	S	S	.	.	P	Polyproline II helix	trans	-95.2	127.3	174.8	-88.6	-177.9	-144	0	0	110.5	T65 Y95	T65-E67 HydrophobicContact CG2-CB 4.29Å; T65-E67 HydrophobicContact CG2-CG 3.95Å; T65-E67 PolarHBondContact O-N 3.26Å; E67-Y95 VanDerWaalsContact CD-CE1 3.45Å; E67-Y95 VanDerWaalsContact CD-CZ 3.47Å; E67-Y95 VanDerWaalsContact CD-OH 3.26Å; E67-Y95 PolarHBondContact OE1-OH 3.5Å; E67-Y95 WeakPolarHBondContact OE2-CE1 3.08Å; E67-Y95 PolarHBondContact OE2-OH 3.44Å
68	P	78.6	Confident	70.9	Confident	86 Å²	86	80.9 Å²	80.9	56%	0.558	44%	0.438	S	S	*	.	P	Polyproline II helix	trans	-71.5	133.1	-178.6	28	-32.6	0	0	0	111.3	H74	P68-H74 WeakPolarHBondContact CA-O 3.48Å
69	C	77.3	Confident	72.2	Confident	2 Å²	2	81.1 Å²	81.1	1%	0.014	43%	0.431	C	S	.	.	P	Polyproline II helix	trans	-65.6	127.3	174.1	177.3	0	0	0	0	110.6	K71 C72 E73 H74 C97 W106	C69-K71 PolarHBondContact O-N 2.92Å; C69-C72 WeakPolarHBondContact CB-SG 3.42Å; C69-C72 PolarHBondContact O-N 3.11Å; C69-C72 PolarHBondContact SG-SG 2.82Å; C69-E73 WeakPolarHBondContact O-CA 3.39Å; C69-E73 PolarHBondContact O-N 2.87Å; C69-H74 PolarHBondContact N-O 3.31Å; C69-H74 VanDerWaalsContact N-O 3.07Å; C69-C97 HydrophobicContact CB-CB 4.31Å; C69-W106 HydrophobicContact CB-CH2 3.65Å; C69-W106 HydrophobicContact CB-CZ2 4.44Å; C69-W106 HydrophobicContact CB-CZ3 4.05Å; C69-W106 VanDerWaalsContact SG-CZ3 3.57Å
70	P	78.1	Confident	73.3	Confident	92 Å²	92	83.2 Å²	83.2	60%	0.597	44%	0.441	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.7	-10.6	-175.7	25.5	-35.1	0	0	0	114.5	W106	P70-W106 HydrophobicContact CG-CD2 4.22Å; P70-W106 HydrophobicContact CG-CG 4.4Å
71	K	76.9	Confident	74.5	Confident	141 Å²	141	80.7 Å²	80.7	61%	0.613	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	-109.1	-24.2	-179.2	-74.7	-167.2	-178.2	164.9	0	115.5	C69 H104	C69-K71 PolarHBondContact O-N 2.92Å; K71-H104 WeakPolarHBondContact CD-NE2 3.32Å; K71-H104 WeakPolarHBondContact CE-NE2 3.44Å; K71-H104 PolarHBondContact NZ-CD2 3.05Å; K71-H104 VanDerWaalsContact NZ-CD2 3.31Å; K71-H104 PolarHBondContact NZ-NE2 3.31Å
72	C	74.9	Confident	75.6	Confident	40 Å²	40	74.4 Å²	74.4	27%	0.27	40%	0.395	S	S	.	.	T	Hydrogen-bonded Turn	trans	-132.2	2.9	-176.2	61.9	0	0	0	0	113.3	C69 H74 C97	C69-C72 WeakPolarHBondContact CB-SG 3.42Å; C69-C72 PolarHBondContact O-N 3.11Å; C69-C72 PolarHBondContact SG-SG 2.82Å; C72-H74 PolarHBondContact O-N 3.2Å; C72-C97 PolarHBondContact SG-SG 2.9Å
73	E	74.8	Confident	76.2	Confident	167 Å²	167	76.6 Å²	76.6	78%	0.78	40%	0.404	S	S	*	.			trans	53.8	19.4	177.2	-61.9	177.7	163.1	0	0	113.8	C69	C69-E73 WeakPolarHBondContact O-CA 3.39Å; C69-E73 PolarHBondContact O-N 2.87Å
74	H	76.9	Confident	76.5	Confident	73 Å²	73	72.4 Å²	72.4	34%	0.338	38%	0.382	S	S	.	.			trans	-67.4	130.4	177.7	-164.9	68.5	0	0	0	108.9	P68 C69 C72 R76	P68-H74 WeakPolarHBondContact CA-O 3.48Å; C69-H74 PolarHBondContact N-O 3.31Å; C69-H74 VanDerWaalsContact N-O 3.07Å; C72-H74 PolarHBondContact O-N 3.2Å; H74-R76 PolarHBondContact CD2-O 3.15Å; H74-R76 PolarHBondContact O-N 2.97Å; H74-R76 VanDerWaalsContact O-N 3.09Å
75	P	77.4	Confident	76.7	Confident	81 Å²	81	76.2 Å²	76.2	53%	0.526	39%	0.387	S	S	.	.	S	Bend	trans	-75	-0.5	-168.6	29.8	-37.5	0	0	0	114.2	A66	A66-P75 CarbonylContact C-O 3.45Å; A66-P75 VanDerWaalsContact CA-O 3.29Å; A66-P75 WeakPolarHBondContact CA-O 3.14Å
76	R	75.6	Confident	76.6	Confident	161 Å²	161	75.4 Å²	75.4	61%	0.608	38%	0.383	S	S	*	.			trans	-128.1	132.5	-178.5	-67.4	-172.9	177.2	-174.3	-1.2	110.9	H74 C98	H74-R76 PolarHBondContact CD2-O 3.15Å; H74-R76 PolarHBondContact O-N 2.97Å; H74-R76 VanDerWaalsContact O-N 3.09Å; R76-C98 VanDerWaalsContact C-SG 3.55Å; R76-C98 HydrophobicContact CB-CB 4.35Å; R76-C98 PolarHBondContact O-N 2.69Å; R76-C98 PolarHBondContact O-SG 2.98Å; R76-C98 VanDerWaalsContact O-SG 3.37Å
77	A	79.3	Confident	76.5	Confident	0 Å²	0	74.5 Å²	74.5	0%	0	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	140.8	171.8	0	0	0	0	0	109.6	S64 T65 Y95 K96 W106	S64-A77 WeakPolarHBondContact CA-O 3.01Å; T65-A77 PolarHBondContact N-O 3.41Å; T65-A77 PolarHBondContact O-N 2.88Å; T65-A77 VanDerWaalsContact O-N 3.08Å; A77-Y95 HydrophobicContact CB-CD1 4.31Å; A77-K96 WeakPolarHBondContact CA-O 3.4Å; A77-W106 HydrophobicContact CB-CH2 3.72Å; A77-W106 HydrophobicContact CB-CZ2 3.89Å
78	Y	78.4	Confident	76.7	Confident	62 Å²	62	76.6 Å²	76.6	24%	0.243	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.3	137	165.5	-61.2	-66.6	0	0	0	108.2	C59 V62 Y95 K96 C98	C59-Y78 HydrophobicContact CB-CD2 3.78Å; C59-Y78 HydrophobicContact CB-CE2 3.78Å; C59-Y78 HydrophobicContact CB-CG 4.31Å; C59-Y78 WeakPolarHBondContact O-CE1 3.45Å; C59-Y78 VanDerWaalsContact O-CZ 3.3Å; V62-Y78 HydrophobicContact CB-CD1 4.42Å; V62-Y78 WeakPolarHBondContact O-CD1 3.24Å; Y78-Y95 CarbonylContact O-C 3.5Å; Y78-Y95 VanDerWaalsContact O-CA 3.28Å; Y78-Y95 WeakPolarHBondContact O-CA 3.32Å; Y78-K96 PolarHBondContact N-O 3.42Å; Y78-K96 PolarHBondContact O-N 3.38Å; Y78-C98 HydrophobicContact CD2-CB 4.22Å; Y78-C98 WeakPolarHBondContact CD2-SG 3.23Å; Y78-C98 HydrophobicContact CE2-CB 3.74Å; Y78-C98 WeakPolarHBondContact CE2-SG 3.47Å; Y78-C98 PolarHBondContact N-SG 2.85Å
79	F	78.7	Confident	76.5	Confident	51 Å²	51	76.3 Å²	76.3	22%	0.224	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	145.1	177.2	77.2	-79.5	0	0	0	110.6	V62 D63 T65 T93 F94 Y95	V62-F79 WeakPolarHBondContact CG1-O 3.28Å; D63-F79 HydrophobicContact CB-CD1 4.28Å; D63-F79 HydrophobicContact CB-CE1 3.49Å; D63-F79 VanDerWaalsContact CB-CE1 3.49Å; D63-F79 HydrophobicContact CB-CZ 3.79Å; D63-F79 WeakPolarHBondContact O-CD1 3.29Å; D63-F79 PolarHBondContact O-N 2.83Å; D63-F79 VanDerWaalsContact O-N 3.08Å; T65-F79 WeakPolarHBondContact OG1-CD1 3.1Å; T65-F79 WeakPolarHBondContact OG1-CE1 3.08Å; F79-T93 HydrophobicContact CB-CG2 4.13Å; F79-T93 HydrophobicContact CD2-CG2 4.19Å; F79-F94 CarbonylContact C-O 3.51Å; F79-F94 VanDerWaalsContact CA-O 3.29Å; F79-F94 WeakPolarHBondContact CA-O 3.39Å; F79-Y95 HydrophobicContact CB-CD1 3.57Å; F79-Y95 HydrophobicContact CB-CE1 3.55Å; F79-Y95 HydrophobicContact CG-CE1 4.47Å
80	M	76.7	Confident	76.4	Confident	51 Å²	51	81.6 Å²	81.6	25%	0.251	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.5	127.3	175.4	-174.7	179	-75.3	0	0	109.2	V52 V62 L82 F94	V52-M80 HydrophobicContact CG1-SD 3.75Å; V62-M80 HydrophobicContact CG1-CE 4.44Å; V62-M80 HydrophobicContact CG2-CE 3.99Å; M80-L82 HydrophobicContact CG-CD1 3.96Å; M80-L82 HydrophobicContact CG-CG 4.01Å; M80-L82 HydrophobicContact SD-CD1 3.65Å; M80-L82 HydrophobicContact SD-CD2 4.33Å; M80-L82 HydrophobicContact SD-CG 3.98Å; M80-F94 PolarHBondContact N-O 3.37Å; M80-F94 PolarHBondContact O-N 3.35Å
81	Q	78.9	Confident	76.5	Confident	110 Å²	110	82.6 Å²	82.6	51%	0.514	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	116.1	174.3	-66.5	-173.7	-40.5	0	0	109	M91 T92 T93	Q81-M91 HydrophobicContact CB-CB 4.27Å; Q81-M91 HydrophobicContact CB-SD 4.35Å; Q81-T92 WeakPolarHBondContact CA-O 3.49Å; Q81-T93 HydrophobicContact CG-CG2 4.26Å
82	L	76.1	Confident	76.8	Confident	33 Å²	33	77.2 Å²	77.2	17%	0.173	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	132.9	-179.9	-79.4	147.9	0	0	0	108.8	V52 M80 T84 T92 F94	V52-L82 HydrophobicContact CG1-CD1 3.98Å; V52-L82 HydrophobicContact CG1-CD2 4.13Å; M80-L82 HydrophobicContact CG-CD1 3.96Å; M80-L82 HydrophobicContact CG-CG 4.01Å; M80-L82 HydrophobicContact SD-CD1 3.65Å; M80-L82 HydrophobicContact SD-CD2 4.33Å; M80-L82 HydrophobicContact SD-CG 3.98Å; L82-T84 PolarHBondContact O-N 2.94Å; L82-T92 PolarHBondContact N-O 2.88Å; L82-T92 PolarHBondContact O-N 3.08Å; L82-F94 HydrophobicContact CB-CD2 3.92Å; L82-F94 HydrophobicContact CB-CE2 3.8Å; L82-F94 HydrophobicContact CD1-CD2 3.75Å; L82-F94 HydrophobicContact CD1-CE2 4.14Å; L82-F94 HydrophobicContact CD1-CG 4.47Å; L82-F94 HydrophobicContact CG-CD2 4.42Å
83	Q	75.9	Confident	77.2	Confident	71 Å²	71	76.3 Å²	76.3	33%	0.332	38%	0.384	S	S	.	.			trans	-83.1	95	171.6	-160.6	-163	-56.9	0	0	108.2	R85 S86	Q83-R85 WeakPolarHBondContact CG-O 3.25Å; Q83-R85 PolarHBondContact NE2-O 3.46Å; Q83-R85 PolarHBondContact O-N 2.87Å; Q83-S86 PolarHBondContact NE2-O 3.26Å
84	T	72.3	Confident	77.5	Confident	32 Å²	32	69 Å²	69	20%	0.196	35%	0.35	C	S	.	.			trans	-74.5	-17.5	-177.5	53.3	0	0	0	0	113.4	L82 T92 F94	L82-T84 PolarHBondContact O-N 2.94Å; T84-T92 PolarHBondContact OG1-OG1 2.91Å; T84-F94 HydrophobicContact CG2-CE2 3.72Å; T84-F94 HydrophobicContact CG2-CZ 3.66Å
85	R	75.8	Confident	77.7	Confident	146 Å²	146	66.3 Å²	66.3	55%	0.551	34%	0.337	S	S	*	.	S	Bend	trans	-131.1	-166.4	-177.9	-60	-154.8	-164.8	144.4	-5.9	111.2	L46 Q83 E89	L46-R85 WeakPolarHBondContact CD1-O 3.41Å; Q83-R85 WeakPolarHBondContact CG-O 3.25Å; Q83-R85 PolarHBondContact NE2-O 3.46Å; Q83-R85 PolarHBondContact O-N 2.87Å; R85-E89 VanDerWaalsContact CB-OE2 3.24Å; R85-E89 WeakPolarHBondContact CB-OE2 3.33Å; R85-E89 WeakPolarHBondContact CD-OE1 3.33Å; R85-E89 WeakPolarHBondContact CD-OE2 2.98Å; R85-E89 WeakPolarHBondContact CG-OE2 3.03Å; R85-E89 IonicContact CZ-OE1 3.39Å; R85-E89 IonicContact CZ-OE2 3.62Å; R85-E89 IonicContact NE-OE2 3.82Å; R85-E89 IonicContact NH1-OE1 3.89Å; R85-E89 PolarHBondContact NH1-OE1 3.15Å; R85-E89 IonicContact NH1-OE2 3.99Å
86	S	75.5	Confident	77.7	Confident	29 Å²	29	63.7 Å²	63.7	20%	0.203	32%	0.318	C	S	.	.			trans	-57.9	155.7	179.7	-54.3	0	0	0	0	112.1	Q83 D88 E89	Q83-S86 PolarHBondContact NE2-O 3.26Å; S86-D88 PolarHBondContact O-N 3.28Å; S86-E89 PolarHBondContact O-N 2.96Å
87	A	73.9	Confident	77.9	Confident	71 Å²	71	56.3 Å²	56.3	59%	0.587	29%	0.29	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.1	-1.6	-172.9	0	0	0	0	0	114.8
88	D	78.3	Confident	77.6	Confident	110 Å²	110	57.8 Å²	57.8	59%	0.588	30%	0.3	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.7	-12.5	174.7	-52	-35.9	0	0	0	112	Y43 S86	Y43-D88 WeakPolarHBondContact CE1-OD2 3.34Å; Y43-D88 PolarHBondContact OH-OD1 3.07Å; Y43-D88 PolarHBondContact OH-OD2 3.09Å; S86-D88 PolarHBondContact O-N 3.28Å
89	E	74.2	Confident	77.1	Confident	80 Å²	80	56.5 Å²	56.5	37%	0.374	30%	0.3	S	S	.	.	S	Bend	trans	-92.5	144.2	171.5	-71.9	-171.6	-177.3	0	0	111.2	R85 S86	R85-E89 VanDerWaalsContact CB-OE2 3.24Å; R85-E89 WeakPolarHBondContact CB-OE2 3.33Å; R85-E89 WeakPolarHBondContact CD-OE1 3.33Å; R85-E89 WeakPolarHBondContact CD-OE2 2.98Å; R85-E89 WeakPolarHBondContact CG-OE2 3.03Å; R85-E89 IonicContact CZ-OE1 3.39Å; R85-E89 IonicContact CZ-OE2 3.62Å; R85-E89 IonicContact NE-OE2 3.82Å; R85-E89 IonicContact NH1-OE1 3.89Å; R85-E89 PolarHBondContact NH1-OE1 3.15Å; R85-E89 IonicContact NH1-OE2 3.99Å; S86-E89 PolarHBondContact O-N 2.96Å
90	P	75.9	Confident	76.3	Confident	112 Å²	112	59.4 Å²	59.4	73%	0.727	33%	0.334	S	S	*	.	P	Polyproline II helix	trans	-61.4	150.4	174.7	27.5	-34.4	0	0	0	111.1
91	M	80	Confident	75.6	Confident	114 Å²	114	65.5 Å²	65.5	56%	0.562	36%	0.362	S	S	*	.	P	Polyproline II helix	trans	-62	137.8	178.4	-66.5	178.5	159.1	0	0	111	Q81	Q81-M91 HydrophobicContact CB-CB 4.27Å; Q81-M91 HydrophobicContact CB-SD 4.35Å
92	T	82.6	Confident	74.8	Confident	27 Å²	27	67.3 Å²	67.3	17%	0.166	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.1	133.7	178.2	-35.7	0	0	0	0	109.3	Q81 L82 T84 F94 R107 D108	Q81-T92 WeakPolarHBondContact CA-O 3.49Å; L82-T92 PolarHBondContact N-O 2.88Å; L82-T92 PolarHBondContact O-N 3.08Å; T84-T92 PolarHBondContact OG1-OG1 2.91Å; T92-F94 HydrophobicContact CG2-CE2 4.46Å; T92-R107 HydrophobicContact CG2-CG 3.83Å; T92-D108 WeakPolarHBondContact CG2-O 3.5Å
93	T	83.5	Confident	74.4	Confident	21 Å²	21	68.5 Å²	68.5	13%	0.129	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	126.8	-177.4	-51.2	0	0	0	0	110.2	F79 Q81 Y95 D108	F79-T93 HydrophobicContact CB-CG2 4.13Å; F79-T93 HydrophobicContact CD2-CG2 4.19Å; Q81-T93 HydrophobicContact CG-CG2 4.26Å; T93-Y95 HydrophobicContact CG2-CD2 4.29Å; T93-Y95 HydrophobicContact CG2-CE1 4.05Å; T93-Y95 HydrophobicContact CG2-CE2 3.61Å; T93-D108 PolarHBondContact O-N 3.26Å; T93-D108 VanDerWaalsContact O-N 3.11Å
94	F	81.4	Confident	74.3	Confident	15 Å²	15	67.3 Å²	67.3	7%	0.066	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	129.2	175.5	-67.8	-87.9	0	0	0	110	F79 M80 L82 T84 T92 R107	F79-F94 CarbonylContact C-O 3.51Å; F79-F94 VanDerWaalsContact CA-O 3.29Å; F79-F94 WeakPolarHBondContact CA-O 3.39Å; M80-F94 PolarHBondContact N-O 3.37Å; M80-F94 PolarHBondContact O-N 3.35Å; L82-F94 HydrophobicContact CB-CD2 3.92Å; L82-F94 HydrophobicContact CB-CE2 3.8Å; L82-F94 HydrophobicContact CD1-CD2 3.75Å; L82-F94 HydrophobicContact CD1-CE2 4.14Å; L82-F94 HydrophobicContact CD1-CG 4.47Å; L82-F94 HydrophobicContact CG-CD2 4.42Å; T84-F94 HydrophobicContact CG2-CE2 3.72Å; T84-F94 HydrophobicContact CG2-CZ 3.66Å; T92-F94 HydrophobicContact CG2-CE2 4.46Å; F94-R107 HydrophobicContact CD1-CB 4.29Å; F94-R107 HydrophobicContact CD1-CG 4.46Å; F94-R107 HydrophobicContact CE1-CB 4.32Å; F94-R107 HydrophobicContact CE1-CG 4.23Å; F94-R107 VanDerWaalsContact CE1-NE 3.28Å
95	Y	80.9	Confident	74.4	Confident	15 Å²	15	69.7 Å²	69.7	6%	0.059	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	144.4	178.7	-63.4	-84.3	0	0	0	111.3	E67 A77 Y78 F79 T93 R105 W106 D108	E67-Y95 VanDerWaalsContact CD-CE1 3.45Å; E67-Y95 VanDerWaalsContact CD-CZ 3.47Å; E67-Y95 VanDerWaalsContact CD-OH 3.26Å; E67-Y95 PolarHBondContact OE1-OH 3.5Å; E67-Y95 WeakPolarHBondContact OE2-CE1 3.08Å; E67-Y95 PolarHBondContact OE2-OH 3.44Å; A77-Y95 HydrophobicContact CB-CD1 4.31Å; Y78-Y95 CarbonylContact O-C 3.5Å; Y78-Y95 VanDerWaalsContact O-CA 3.28Å; Y78-Y95 WeakPolarHBondContact O-CA 3.32Å; F79-Y95 HydrophobicContact CB-CD1 3.57Å; F79-Y95 HydrophobicContact CB-CE1 3.55Å; F79-Y95 HydrophobicContact CG-CE1 4.47Å; T93-Y95 HydrophobicContact CG2-CD2 4.29Å; T93-Y95 HydrophobicContact CG2-CE1 4.05Å; T93-Y95 HydrophobicContact CG2-CE2 3.61Å; Y95-R105 CarbonylContact O-C 3.5Å; Y95-R105 VanDerWaalsContact O-CA 3.25Å; Y95-R105 WeakPolarHBondContact O-CA 3.39Å; Y95-R105 WeakPolarHBondContact O-CG 3.43Å; Y95-W106 AromaticContact CD2-CD1 3.88Å; Y95-W106 AromaticContact CD2-NE1 3.56Å; Y95-W106 AromaticContact CG-CE2 3.89Å; Y95-W106 HydrophobicContact CG-CZ2 4.14Å; Y95-W106 AromaticContact CG-NE1 3.62Å; Y95-W106 PolarHBondContact N-O 3.47Å; Y95-W106 PolarHBondContact O-N 3.01Å; Y95-D108 HydrophobicContact CD2-CB 4.48Å; Y95-D108 HydrophobicContact CE2-CB 3.81Å
96	K	78.7	Confident	74.5	Confident	27 Å²	27	64.9 Å²	64.9	12%	0.117	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	129.8	172.2	-175.5	169.6	170.3	-174.3	0	109.8	L53 G55 C59 A77 Y78 C98 H104	L53-K96 HydrophobicContact CB-CD 4.38Å; L53-K96 HydrophobicContact CD1-CB 4.36Å; L53-K96 HydrophobicContact CD1-CD 4.37Å; L53-K96 HydrophobicContact CD2-CD 4.17Å; G55-K96 PolarHBondContact O-NZ 3.08Å; C59-K96 VanDerWaalsContact SG-CD 3.51Å; C59-K96 WeakPolarHBondContact SG-CE 3.44Å; C59-K96 PolarHBondContact SG-NZ 2.81Å; A77-K96 WeakPolarHBondContact CA-O 3.4Å; Y78-K96 PolarHBondContact N-O 3.42Å; Y78-K96 PolarHBondContact O-N 3.38Å; K96-C98 PolarHBondContact O-N 3.43Å; K96-H104 WeakPolarHBondContact CA-O 3.29Å
97	C	79	Confident	74.5	Confident	5 Å²	5	71.1 Å²	71.1	3%	0.034	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.3	135.2	180	-174.5	0	0	0	0	111.2	C69 C72 S99 R102 H104 W106	C69-C97 HydrophobicContact CB-CB 4.31Å; C72-C97 PolarHBondContact SG-SG 2.9Å; C97-S99 PolarHBondContact O-N 3.49Å; C97-S99 VanDerWaalsContact SG-CB 3.6Å; C97-S99 PolarHBondContact SG-N 2.84Å; C97-S99 VanDerWaalsContact SG-N 3.43Å; C97-R102 WeakPolarHBondContact CB-O 2.97Å; C97-H104 HydrophobicContact CB-CB 4.33Å; C97-H104 PolarHBondContact N-O 3.35Å; C97-W106 HydrophobicContact CB-CH2 4.44Å; C97-W106 HydrophobicContact CB-CZ3 4Å
98	C	73.1	Confident	74.2	Confident	31 Å²	31	75 Å²	75	21%	0.209	40%	0.396	C	S	.	.			trans	-75.6	-3.6	176.8	-57.7	0	0	0	0	114	R76 Y78 K96 A100	R76-C98 VanDerWaalsContact C-SG 3.55Å; R76-C98 HydrophobicContact CB-CB 4.35Å; R76-C98 PolarHBondContact O-N 2.69Å; R76-C98 PolarHBondContact O-SG 2.98Å; R76-C98 VanDerWaalsContact O-SG 3.37Å; Y78-C98 HydrophobicContact CD2-CB 4.22Å; Y78-C98 WeakPolarHBondContact CD2-SG 3.23Å; Y78-C98 HydrophobicContact CE2-CB 3.74Å; Y78-C98 WeakPolarHBondContact CE2-SG 3.47Å; Y78-C98 PolarHBondContact N-SG 2.85Å; K96-C98 PolarHBondContact O-N 3.43Å; C98-A100 PolarHBondContact O-N 3.14Å
99	S	68.8	Low	74	Confident	35 Å²	35	73.3 Å²	73.3	25%	0.245	39%	0.386	C	S	.	.			trans	-71.1	120	-179.2	-175.5	0	0	0	0	111.1	C97 Q101 R102	C97-S99 PolarHBondContact O-N 3.49Å; C97-S99 VanDerWaalsContact SG-CB 3.6Å; C97-S99 PolarHBondContact SG-N 2.84Å; C97-S99 VanDerWaalsContact SG-N 3.43Å; S99-Q101 PolarHBondContact O-N 3.48Å; S99-R102 CarbonylContact O-C 3.4Å; S99-R102 PolarHBondContact O-N 3.34Å
100	A	61.5	Low	74	Confident	113 Å²	113	72.9 Å²	72.9	93%	0.934	39%	0.387	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.9	-22.7	-179.8	0	0	0	0	0	114.4	C98	C98-A100 PolarHBondContact O-N 3.14Å
101	Q	61.1	Low	73.9	Confident	178 Å²	178	70.7 Å²	70.7	83%	0.832	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.7	-17.5	179.5	-65.8	-177.9	-6.1	0	0	113.5	S99	S99-Q101 PolarHBondContact O-N 3.48Å
102	R	62	Low	73.6	Confident	149 Å²	149	68.2 Å²	68.2	56%	0.562	36%	0.357	S	S	*	.			trans	-141.6	92.4	-172	-65.3	-172.7	-175.1	175.8	3.9	110.1	C97 S99 H104	C97-R102 WeakPolarHBondContact CB-O 2.97Å; S99-R102 CarbonylContact O-C 3.4Å; S99-R102 PolarHBondContact O-N 3.34Å; R102-H104 PolarHBondContact O-N 2.8Å
103	G	67.2	Low	73	Confident	58 Å²	58	70.8 Å²	70.8	60%	0.598	37%	0.368	S	S	*	.			trans	-77	47.7	173.9	0	0	0	0	0	113.7	R105	G103-R105 PolarHBondContact O-N 3.04Å
104	H	74	Confident	72.3	Confident	45 Å²	45	74.1 Å²	74.1	21%	0.208	38%	0.384	C	S	.	.			trans	-65.7	131.8	180	-173.8	-105.7	0	0	0	110.8	K71 K96 C97 R102 W106	K71-H104 WeakPolarHBondContact CD-NE2 3.32Å; K71-H104 WeakPolarHBondContact CE-NE2 3.44Å; K71-H104 PolarHBondContact NZ-CD2 3.05Å; K71-H104 VanDerWaalsContact NZ-CD2 3.31Å; K71-H104 PolarHBondContact NZ-NE2 3.31Å; K96-H104 WeakPolarHBondContact CA-O 3.29Å; C97-H104 HydrophobicContact CB-CB 4.33Å; C97-H104 PolarHBondContact N-O 3.35Å; R102-H104 PolarHBondContact O-N 2.8Å; H104-W106 AromaticContact ND1-CE3 3.33Å; H104-W106 VanDerWaalsContact ND1-CE3 3.33Å; H104-W106 AromaticContact ND1-CZ3 3.89Å; H104-W106 WeakPolarHBondContact O-CZ3 3.13Å
105	R	74.6	Confident	71.6	Confident	83 Å²	83	78.3 Å²	78.3	31%	0.313	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	136.8	177.7	-172.1	-177.8	178.6	178.6	0.7	109.7	L53 Y95 G103	L53-R105 HydrophobicContact CD1-CG 4.37Å; Y95-R105 CarbonylContact O-C 3.5Å; Y95-R105 VanDerWaalsContact O-CA 3.25Å; Y95-R105 WeakPolarHBondContact O-CA 3.39Å; Y95-R105 WeakPolarHBondContact O-CG 3.43Å; G103-R105 PolarHBondContact O-N 3.04Å
106	W	77.6	Confident	70.9	Confident	45 Å²	45	83.2 Å²	83.2	17%	0.17	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	165.2	172.5	64.4	100	0	0	0	110.7	C69 P70 A77 Y95 C97 H104	C69-W106 HydrophobicContact CB-CH2 3.65Å; C69-W106 HydrophobicContact CB-CZ2 4.44Å; C69-W106 HydrophobicContact CB-CZ3 4.05Å; C69-W106 VanDerWaalsContact SG-CZ3 3.57Å; P70-W106 HydrophobicContact CG-CD2 4.22Å; P70-W106 HydrophobicContact CG-CG 4.4Å; A77-W106 HydrophobicContact CB-CH2 3.72Å; A77-W106 HydrophobicContact CB-CZ2 3.89Å; Y95-W106 AromaticContact CD2-CD1 3.88Å; Y95-W106 AromaticContact CD2-NE1 3.56Å; Y95-W106 AromaticContact CG-CE2 3.89Å; Y95-W106 HydrophobicContact CG-CZ2 4.14Å; Y95-W106 AromaticContact CG-NE1 3.62Å; Y95-W106 PolarHBondContact N-O 3.47Å; Y95-W106 PolarHBondContact O-N 3.01Å; C97-W106 HydrophobicContact CB-CH2 4.44Å; C97-W106 HydrophobicContact CB-CZ3 4Å; H104-W106 AromaticContact ND1-CE3 3.33Å; H104-W106 VanDerWaalsContact ND1-CE3 3.33Å; H104-W106 AromaticContact ND1-CZ3 3.89Å; H104-W106 WeakPolarHBondContact O-CZ3 3.13Å
107	R	76.3	Confident	70.3	Confident	159 Å²	159	87.8 Å²	87.8	60%	0.6	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120	141.7	179.9	177.5	-171.7	-69.2	176.4	1.8	108.1	T92 F94	T92-R107 HydrophobicContact CG2-CG 3.83Å; F94-R107 HydrophobicContact CD1-CB 4.29Å; F94-R107 HydrophobicContact CD1-CG 4.46Å; F94-R107 HydrophobicContact CE1-CB 4.32Å; F94-R107 HydrophobicContact CE1-CG 4.23Å; F94-R107 VanDerWaalsContact CE1-NE 3.28Å
108	D	68.4	Low	69.5	Low	153 Å²	153	95.4 Å²	95.4	82%	0.818	50%	0.499	S	S	*	.			trans	-106.9	0	159.8	-162.8	7	0	0	0	108.9	T92 T93 Y95	T92-D108 WeakPolarHBondContact CG2-O 3.5Å; T93-D108 PolarHBondContact O-N 3.26Å; T93-D108 VanDerWaalsContact O-N 3.11Å; Y95-D108 HydrophobicContact CD2-CB 4.48Å; Y95-D108 HydrophobicContact CE2-CB 3.81Å

Retrieved 108 of 108 residues in 54.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).