A0A096NA85_PAPAN Loading...

ATP synthase F(0) complex subunit e, mitochondrial

Subunit e, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel. These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro. Part of the complex F(0) domain.

AlphaFold DB , UniProt , Accession A0A096NA85, Species PAPAN (Papio anubis, Olive baboon), Gene ATP5ME, Length 69 aa.

						>A0A096NA85_PAPAN|A0A096NA85|ATP5ME
MVPPVEVSPLIKLGRYSALFLGMAYGATRYSYLKPRAEEERRIEAEEKKRQDELKRIARELAEEDSILK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	82.4	Confident	92	Very high	241 Å²	241	122.8 Å²	122.8	100%	1.187	70%	0.697	S	S	*	*				0	125.8	0	-161	158.1	173.1	0	0	106.8
2	V	86.8	Confident	92.3	Very high	131 Å²	131	121.4 Å²	121.4	79%	0.794	68%	0.677	S	S	*	*	P	Polyproline II helix	trans	-73.2	131	-177.6	-178.4	0	0	0	0	108.3
3	P	90.6	Very high	92.7	Very high	98 Å²	98	121.2 Å²	121.2	64%	0.636	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-66.6	149.2	-179.8	27.4	-34.1	0	0	0	111	V5	P3-V5 PolarHBondContact O-N 3.48Å
4	P	90.5	Very high	93.1	Very high	132 Å²	132	114.9 Å²	114.9	86%	0.857	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-62.6	135.7	177.4	26.2	-33.1	0	0	0	110.6
5	V	91.4	Very high	93.4	Very high	123 Å²	123	118.3 Å²	118.3	75%	0.745	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-93.1	131.7	178.7	-176.4	0	0	0	0	109.3	P3 V7	P3-V5 PolarHBondContact O-N 3.48Å; V5-V7 PolarHBondContact O-N 3.1Å
6	E	92.4	Very high	93.7	Very high	194 Å²	194	121.3 Å²	121.3	91%	0.907	65%	0.648	S	S	*	*			trans	-69.7	114.1	173.7	-64.9	-170.2	166.8	0	0	110.2
7	V	93.6	Very high	93.9	Very high	57 Å²	57	117.3 Å²	117.3	35%	0.345	63%	0.632	S	S	.	*			trans	-90.3	142.6	176.3	-60.7	0	0	0	0	111	V5 K12	V5-V7 PolarHBondContact O-N 3.1Å; V7-K12 HydrophobicContact CG2-CD 4.18Å; V7-K12 HydrophobicContact CG2-CG 3.76Å; V7-K12 WeakPolarHBondContact O-CE 3.38Å
8	S	95.4	Very high	94.1	Very high	61 Å²	61	114.1 Å²	114.1	43%	0.427	62%	0.624	S	S	.	*			trans	-53.2	139	179.1	171.4	0	0	0	0	112.3	L10 I11 K12	S8-L10 PolarHBondContact O-N 3.15Å; S8-L10 VanDerWaalsContact O-N 3.16Å; S8-L10 PolarHBondContact OG-N 3.22Å; S8-I11 WeakPolarHBondContact O-CB 3.3Å; S8-I11 PolarHBondContact O-N 2.84Å; S8-K12 PolarHBondContact O-N 3.28Å
9	P	95.9	Very high	94.3	Very high	103 Å²	103	113.6 Å²	113.6	67%	0.669	62%	0.62	S	S	*	*	H	α-helix	trans	-53.2	-33.5	175.2	-27.6	35.4	0	0	0	114	I11 K12 L13	P9-I11 VanDerWaalsContact C-N 3.32Å; P9-I11 PolarHBondContact O-N 2.94Å; P9-K12 PolarHBondContact O-N 2.7Å; P9-L13 WeakPolarHBondContact O-CB 3.46Å; P9-L13 PolarHBondContact O-N 3.03Å
10	L	96.6	Very high	94.5	Very high	131 Å²	131	115.6 Å²	115.6	69%	0.686	62%	0.622	S	S	*	*	H	α-helix	trans	-63.1	-38.8	177.5	-178.2	61.7	0	0	0	112	S8 L13 G14	S8-L10 PolarHBondContact O-N 3.15Å; S8-L10 VanDerWaalsContact O-N 3.16Å; S8-L10 PolarHBondContact OG-N 3.22Å; L10-L13 PolarHBondContact O-N 3.35Å; L10-G14 PolarHBondContact O-N 2.94Å
11	I	96.3	Very high	94.7	Very high	80 Å²	80	115.5 Å²	115.5	41%	0.41	62%	0.621	S	S	.	*	H	α-helix	trans	-67.8	-41.2	177.8	-62.8	173.4	0	0	0	109.9	S8 P9 G14 R15	S8-I11 WeakPolarHBondContact O-CB 3.3Å; S8-I11 PolarHBondContact O-N 2.84Å; P9-I11 VanDerWaalsContact C-N 3.32Å; P9-I11 PolarHBondContact O-N 2.94Å; I11-G14 PolarHBondContact O-N 3.49Å; I11-R15 VanDerWaalsContact O-CG 3.3Å; I11-R15 WeakPolarHBondContact O-CG 3.35Å; I11-R15 PolarHBondContact O-N 3.06Å
12	K	95.9	Very high	95.5	Very high	106 Å²	106	106 Å²	106	46%	0.461	59%	0.585	S	S	.	*	H	α-helix	trans	-61.3	-49.1	176.3	-61.1	-177.7	-174.9	175.9	0	110.2	V7 S8 P9 G14 R15 Y16	V7-K12 HydrophobicContact CG2-CD 4.18Å; V7-K12 HydrophobicContact CG2-CG 3.76Å; V7-K12 WeakPolarHBondContact O-CE 3.38Å; S8-K12 PolarHBondContact O-N 3.28Å; P9-K12 PolarHBondContact O-N 2.7Å; K12-G14 PolarHBondContact O-N 3.44Å; K12-R15 PolarHBondContact O-N 3.32Å; K12-Y16 HydrophobicContact CB-CD2 4.5Å; K12-Y16 HydrophobicContact CB-CE2 4.44Å; K12-Y16 WeakPolarHBondContact O-CD2 3.47Å; K12-Y16 PolarHBondContact O-N 3.39Å
13	L	97.5	Very high	96	Very high	119 Å²	119	106.3 Å²	106.3	62%	0.623	58%	0.58	S	S	*	*	H	α-helix	trans	-60	-46.8	178.9	-179.3	133.7	0	0	0	111.9	P9 L10 R15 Y16 S17	P9-L13 WeakPolarHBondContact O-CB 3.46Å; P9-L13 PolarHBondContact O-N 3.03Å; L10-L13 PolarHBondContact O-N 3.35Å; L13-R15 PolarHBondContact O-N 2.9Å; L13-Y16 PolarHBondContact O-N 3.05Å; L13-S17 VanDerWaalsContact O-CB 3.31Å; L13-S17 WeakPolarHBondContact O-CB 3.39Å; L13-S17 PolarHBondContact O-N 3.03Å; L13-S17 PolarHBondContact O-OG 3Å; L13-S17 VanDerWaalsContact O-OG 3.1Å
14	G	97.9	Very high	96.4	Very high	33 Å²	33	103.8 Å²	103.8	34%	0.34	57%	0.567	S	S	.	*	H	α-helix	trans	-61	-40.4	177.9	0	0	0	0	0	113.4	L10 I11 K12 S17 A18	L10-G14 PolarHBondContact O-N 2.94Å; I11-G14 PolarHBondContact O-N 3.49Å; K12-G14 PolarHBondContact O-N 3.44Å; G14-S17 WeakPolarHBondContact CA-OG 3.37Å; G14-S17 PolarHBondContact O-OG 3.06Å; G14-A18 VanDerWaalsContact O-CB 3.27Å; G14-A18 WeakPolarHBondContact O-CB 3.46Å; G14-A18 PolarHBondContact O-N 2.97Å
15	R	97.5	Very high	96.7	Very high	166 Å²	166	104.6 Å²	104.6	63%	0.626	55%	0.554	S	S	*	*	H	α-helix	trans	-65.4	-47.4	177.1	-73.6	176.1	-175.7	-173.2	2.4	111.8	I11 K12 L13 L19	I11-R15 VanDerWaalsContact O-CG 3.3Å; I11-R15 WeakPolarHBondContact O-CG 3.35Å; I11-R15 PolarHBondContact O-N 3.06Å; K12-R15 PolarHBondContact O-N 3.32Å; L13-R15 PolarHBondContact O-N 2.9Å; R15-L19 WeakPolarHBondContact O-CB 3.28Å; R15-L19 PolarHBondContact O-N 3.18Å
16	Y	97.9	Very high	97	Very high	166 Å²	166	100.5 Å²	100.5	65%	0.651	54%	0.537	S	S	*	.	H	α-helix	trans	-71.3	-34.7	-178.8	-70.9	-61.3	0	0	0	112.5	K12 L13 L19 F20	K12-Y16 HydrophobicContact CB-CD2 4.5Å; K12-Y16 HydrophobicContact CB-CE2 4.44Å; K12-Y16 WeakPolarHBondContact O-CD2 3.47Å; K12-Y16 PolarHBondContact O-N 3.39Å; L13-Y16 PolarHBondContact O-N 3.05Å; Y16-L19 PolarHBondContact O-N 2.94Å; Y16-F20 WeakPolarHBondContact O-CB 3.49Å; Y16-F20 PolarHBondContact O-N 3Å
17	S	97.6	Very high	97.3	Very high	53 Å²	53	94 Å²	94	37%	0.371	52%	0.517	S	S	.	.	H	α-helix	trans	-66.2	-44.6	174.5	66.9	0	0	0	0	111.5	L13 G14 L19 F20 L21	L13-S17 VanDerWaalsContact O-CB 3.31Å; L13-S17 WeakPolarHBondContact O-CB 3.39Å; L13-S17 PolarHBondContact O-N 3.03Å; L13-S17 PolarHBondContact O-OG 3Å; L13-S17 VanDerWaalsContact O-OG 3.1Å; G14-S17 WeakPolarHBondContact CA-OG 3.37Å; G14-S17 PolarHBondContact O-OG 3.06Å; S17-L19 VanDerWaalsContact C-N 3.32Å; S17-L19 PolarHBondContact O-N 3.35Å; S17-F20 PolarHBondContact O-N 3.42Å; S17-L21 WeakPolarHBondContact O-CB 3.46Å; S17-L21 VanDerWaalsContact O-CG 3.3Å; S17-L21 WeakPolarHBondContact O-CG 3.3Å; S17-L21 PolarHBondContact O-N 3.42Å
18	A	98.1	Very high	97.4	Very high	60 Å²	60	95.6 Å²	95.6	50%	0.496	53%	0.526	S	S	.	.	H	α-helix	trans	-61.5	-41.1	175.1	0	0	0	0	0	111.8	G14 G22	G14-A18 VanDerWaalsContact O-CB 3.27Å; G14-A18 WeakPolarHBondContact O-CB 3.46Å; G14-A18 PolarHBondContact O-N 2.97Å; A18-G22 PolarHBondContact O-N 3.11Å
19	L	97.9	Very high	97.5	Very high	104 Å²	104	98.2 Å²	98.2	55%	0.545	53%	0.527	S	S	.	.	H	α-helix	trans	-60.3	-48.5	175.1	178.9	62.9	0	0	0	111.4	R15 Y16 S17 G22 M23	R15-L19 WeakPolarHBondContact O-CB 3.28Å; R15-L19 PolarHBondContact O-N 3.18Å; Y16-L19 PolarHBondContact O-N 2.94Å; S17-L19 VanDerWaalsContact C-N 3.32Å; S17-L19 PolarHBondContact O-N 3.35Å; L19-G22 PolarHBondContact O-N 3.3Å; L19-M23 PolarHBondContact O-N 3.36Å
20	F	98.2	Very high	97.5	Very high	153 Å²	153	100.4 Å²	100.4	67%	0.671	52%	0.523	S	S	*	.	H	α-helix	trans	-63	-46.6	-180	-174.5	-96.4	0	0	0	111.8	Y16 S17 G22 M23 A24	Y16-F20 WeakPolarHBondContact O-CB 3.49Å; Y16-F20 PolarHBondContact O-N 3Å; S17-F20 PolarHBondContact O-N 3.42Å; F20-G22 VanDerWaalsContact C-N 3.32Å; F20-G22 PolarHBondContact O-N 3.48Å; F20-M23 PolarHBondContact O-N 3.47Å; F20-A24 PolarHBondContact O-N 2.91Å
21	L	98.4	Very high	97.5	Very high	115 Å²	115	97.9 Å²	97.9	60%	0.602	52%	0.516	S	S	*	.	H	α-helix	trans	-61.5	-41.1	176	-72.7	171.7	0	0	0	111.8	S17 A24 Y25	S17-L21 WeakPolarHBondContact O-CB 3.46Å; S17-L21 VanDerWaalsContact O-CG 3.3Å; S17-L21 WeakPolarHBondContact O-CG 3.3Å; S17-L21 PolarHBondContact O-N 3.42Å; L21-A24 PolarHBondContact O-N 3.17Å; L21-Y25 VanDerWaalsContact O-CB 3.26Å; L21-Y25 WeakPolarHBondContact O-CB 3.23Å; L21-Y25 PolarHBondContact O-N 2.89Å
22	G	98.3	Very high	97.4	Very high	42 Å²	42	99.6 Å²	99.6	43%	0.433	52%	0.518	S	S	.	.	H	α-helix	trans	-61.3	-44.2	176.5	0	0	0	0	0	112.4	A18 L19 F20 Y25 G26	A18-G22 PolarHBondContact O-N 3.11Å; L19-G22 PolarHBondContact O-N 3.3Å; F20-G22 VanDerWaalsContact C-N 3.32Å; F20-G22 PolarHBondContact O-N 3.48Å; G22-Y25 PolarHBondContact O-N 3.42Å; G22-G26 PolarHBondContact O-N 2.94Å
23	M	98.2	Very high	97.4	Very high	137 Å²	137	98 Å²	98	68%	0.675	51%	0.514	S	S	*	.	H	α-helix	trans	-64.3	-46.6	175.4	-75.8	-173.5	67.9	0	0	112.3	L19 F20 Y25 G26 A27	L19-M23 PolarHBondContact O-N 3.36Å; F20-M23 PolarHBondContact O-N 3.47Å; M23-Y25 VanDerWaalsContact C-N 3.33Å; M23-Y25 PolarHBondContact O-N 3.06Å; M23-G26 PolarHBondContact O-N 3.15Å; M23-A27 PolarHBondContact O-N 3.48Å
24	A	98.1	Very high	97.2	Very high	45 Å²	45	97 Å²	97	37%	0.372	51%	0.505	S	S	.	.	H	α-helix	trans	-61.7	-42.4	178.1	0	0	0	0	0	111.8	F20 L21 T28	F20-A24 PolarHBondContact O-N 2.91Å; L21-A24 PolarHBondContact O-N 3.17Å; A24-T28 VanDerWaalsContact O-CG2 3.31Å; A24-T28 WeakPolarHBondContact O-CG2 3.42Å; A24-T28 PolarHBondContact O-N 3.31Å; A24-T28 PolarHBondContact O-OG1 3.25Å
25	Y	98.1	Very high	97.1	Very high	149 Å²	149	98.3 Å²	98.3	58%	0.584	51%	0.507	S	S	*	.	H	α-helix	trans	-64.3	-44.1	175.5	-178.6	-101.9	0	0	0	111.9	L21 G22 M23 A27 T28 R29	L21-Y25 VanDerWaalsContact O-CB 3.26Å; L21-Y25 WeakPolarHBondContact O-CB 3.23Å; L21-Y25 PolarHBondContact O-N 2.89Å; G22-Y25 PolarHBondContact O-N 3.42Å; M23-Y25 VanDerWaalsContact C-N 3.33Å; M23-Y25 PolarHBondContact O-N 3.06Å; Y25-A27 PolarHBondContact O-N 3.01Å; Y25-T28 WeakPolarHBondContact CA-OG1 3.31Å; Y25-T28 PolarHBondContact O-N 2.95Å; Y25-T28 PolarHBondContact O-OG1 3.41Å; Y25-R29 HydrophobicContact CE1-CB 4.35Å; Y25-R29 HydrophobicContact CE1-CG 4.49Å; Y25-R29 WeakPolarHBondContact O-CB 3.44Å; Y25-R29 PolarHBondContact O-N 2.9Å
26	G	97.8	Very high	96.9	Very high	37 Å²	37	96 Å²	96	38%	0.381	50%	0.499	S	S	.	.	H	α-helix	trans	-59.4	-46.9	177.4	0	0	0	0	0	112.5	G22 M23 Y30	G22-G26 PolarHBondContact O-N 2.94Å; M23-G26 PolarHBondContact O-N 3.15Å; G26-Y30 WeakPolarHBondContact O-CB 3.31Å; G26-Y30 PolarHBondContact O-N 3.29Å
27	A	97.5	Very high	96.7	Very high	58 Å²	58	89.5 Å²	89.5	48%	0.479	48%	0.479	S	S	.	.	H	α-helix	trans	-63.9	-45.1	179.4	0	0	0	0	0	112.3	M23 Y25 S31	M23-A27 PolarHBondContact O-N 3.48Å; Y25-A27 PolarHBondContact O-N 3.01Å; A27-S31 WeakPolarHBondContact O-CB 3.48Å; A27-S31 PolarHBondContact O-N 3.35Å; A27-S31 PolarHBondContact O-OG 2.99Å
28	T	96.9	Very high	96.5	Very high	89 Å²	89	91 Å²	91	55%	0.546	48%	0.48	S	S	.	.	H	α-helix	trans	-66.9	-45.2	179.1	51.2	0	0	0	0	111.5	A24 Y25 S31 Y32	A24-T28 VanDerWaalsContact O-CG2 3.31Å; A24-T28 WeakPolarHBondContact O-CG2 3.42Å; A24-T28 PolarHBondContact O-N 3.31Å; A24-T28 PolarHBondContact O-OG1 3.25Å; Y25-T28 WeakPolarHBondContact CA-OG1 3.31Å; Y25-T28 PolarHBondContact O-N 2.95Å; Y25-T28 PolarHBondContact O-OG1 3.41Å; T28-S31 PolarHBondContact O-N 3.24Å; T28-Y32 WeakPolarHBondContact O-CB 3.43Å; T28-Y32 PolarHBondContact O-N 3.09Å
29	R	97.1	Very high	96.2	Very high	116 Å²	116	93.8 Å²	93.8	44%	0.438	48%	0.483	S	S	.	.	H	α-helix	trans	-65	-41.8	179.1	-170.9	64.3	178.3	-178.9	1.6	112.2	Y25 Y32 L33	Y25-R29 HydrophobicContact CE1-CB 4.35Å; Y25-R29 HydrophobicContact CE1-CG 4.49Å; Y25-R29 WeakPolarHBondContact O-CB 3.44Å; Y25-R29 PolarHBondContact O-N 2.9Å; R29-Y32 PolarHBondContact O-N 3.29Å; R29-L33 HydrophobicContact CG-CD1 4.06Å; R29-L33 WeakPolarHBondContact O-CG 3.42Å; R29-L33 PolarHBondContact O-N 3.35Å
30	Y	96.6	Very high	95.9	Very high	150 Å²	150	94.7 Å²	94.7	59%	0.588	49%	0.485	S	S	*	.	H	α-helix	trans	-60.9	-47.9	175.4	177.6	-99.6	0	0	0	111.3	G26 Y32 L33 K34	G26-Y30 WeakPolarHBondContact O-CB 3.31Å; G26-Y30 PolarHBondContact O-N 3.29Å; Y30-Y32 PolarHBondContact O-N 2.99Å; Y30-L33 PolarHBondContact O-N 3.1Å; Y30-K34 HydrophobicContact CE1-CD 3.9Å; Y30-K34 VanDerWaalsContact O-CB 3.31Å; Y30-K34 WeakPolarHBondContact O-CB 3.43Å; Y30-K34 PolarHBondContact O-N 3.29Å
31	S	95.4	Very high	95.6	Very high	78 Å²	78	95.5 Å²	95.5	55%	0.545	48%	0.483	S	S	.	.	H	α-helix	trans	-62.6	-33.6	-179.4	-55.9	0	0	0	0	112.4	A27 T28 P35	A27-S31 WeakPolarHBondContact O-CB 3.48Å; A27-S31 PolarHBondContact O-N 3.35Å; A27-S31 PolarHBondContact O-OG 2.99Å; T28-S31 PolarHBondContact O-N 3.24Å; S31-P35 WeakPolarHBondContact O-CD 3.25Å
32	Y	94.5	Very high	95.3	Very high	115 Å²	115	98.6 Å²	98.6	45%	0.451	49%	0.487	S	S	.	.	H	α-helix	trans	-71.4	-41.5	175.3	177.7	-105.5	0	0	0	113.4	T28 R29 Y30 P35 R36	T28-Y32 WeakPolarHBondContact O-CB 3.43Å; T28-Y32 PolarHBondContact O-N 3.09Å; R29-Y32 PolarHBondContact O-N 3.29Å; Y30-Y32 PolarHBondContact O-N 2.99Å; Y32-P35 WeakPolarHBondContact O-CD 3.36Å; Y32-R36 VanDerWaalsContact CZ-CZ 3.41Å; Y32-R36 PolarHBondContact OH-NH1 3.05Å; Y32-R36 PolarHBondContact OH-NH2 3.06Å
33	L	95.9	Very high	95	Very high	73 Å²	73	101 Å²	101	38%	0.382	49%	0.489	S	S	.	.	H	α-helix	trans	-82.5	-28.8	-175.9	-67.5	178.2	0	0	0	113.2	R29 Y30 R36 A37	R29-L33 HydrophobicContact CG-CD1 4.06Å; R29-L33 WeakPolarHBondContact O-CG 3.42Å; R29-L33 PolarHBondContact O-N 3.35Å; Y30-L33 PolarHBondContact O-N 3.1Å; L33-R36 PolarHBondContact O-N 2.95Å; L33-A37 PolarHBondContact O-N 2.86Å
34	K	93.8	Very high	94.8	Very high	98 Å²	98	100.5 Å²	100.5	43%	0.426	49%	0.485	S	S	.	.	H	α-helix	trans	-52.6	-52.7	-179.6	-174.7	179.6	179.8	-176.5	0	114	Y30 R36 A37 E38	Y30-K34 HydrophobicContact CE1-CD 3.9Å; Y30-K34 VanDerWaalsContact O-CB 3.31Å; Y30-K34 WeakPolarHBondContact O-CB 3.43Å; Y30-K34 PolarHBondContact O-N 3.29Å; K34-R36 VanDerWaalsContact C-N 3.31Å; K34-R36 PolarHBondContact O-N 3.37Å; K34-A37 PolarHBondContact O-N 2.88Å; K34-E38 WeakPolarHBondContact CE-OE1 3.24Å; K34-E38 PolarHBondContact O-N 3.25Å
35	P	94.8	Very high	94.6	Very high	60 Å²	60	100.8 Å²	100.8	39%	0.39	49%	0.487	S	S	.	.	H	α-helix	trans	-63.6	-37.4	-179.1	24.3	-34.2	0	0	0	112.2	S31 Y32 E38 E39	S31-P35 WeakPolarHBondContact O-CD 3.25Å; Y32-P35 WeakPolarHBondContact O-CD 3.36Å; P35-E38 PolarHBondContact O-N 3.17Å; P35-E39 WeakPolarHBondContact O-CG 3.33Å; P35-E39 PolarHBondContact O-N 3.38Å
36	R	92.9	Very high	94.2	Very high	118 Å²	118	100.5 Å²	100.5	45%	0.445	49%	0.491	S	S	.	.	H	α-helix	trans	-63.4	-44.5	177.4	-68.3	-179.3	166.8	-170.9	-5.9	112.1	Y32 L33 K34 E38 E39 E40	Y32-R36 VanDerWaalsContact CZ-CZ 3.41Å; Y32-R36 PolarHBondContact OH-NH1 3.05Å; Y32-R36 PolarHBondContact OH-NH2 3.06Å; L33-R36 PolarHBondContact O-N 2.95Å; K34-R36 VanDerWaalsContact C-N 3.31Å; K34-R36 PolarHBondContact O-N 3.37Å; R36-E38 VanDerWaalsContact C-N 3.26Å; R36-E38 PolarHBondContact O-N 3.04Å; R36-E39 PolarHBondContact O-N 2.9Å; R36-E40 WeakPolarHBondContact O-CG 3.45Å; R36-E40 PolarHBondContact O-N 3.49Å
37	A	93.8	Very high	93.9	Very high	29 Å²	29	104 Å²	104	24%	0.24	50%	0.498	C	S	.	.	H	α-helix	trans	-66.3	-29.2	176.2	0	0	0	0	0	112.4	L33 K34 R41	L33-A37 PolarHBondContact O-N 2.86Å; K34-A37 PolarHBondContact O-N 2.88Å; A37-R41 VanDerWaalsContact O-CG 3.24Å; A37-R41 WeakPolarHBondContact O-CG 3.47Å; A37-R41 PolarHBondContact O-N 2.88Å; A37-R41 PolarHBondContact O-NE 3.21Å
38	E	93.6	Very high	93.7	Very high	84 Å²	84	107.6 Å²	107.6	39%	0.393	50%	0.502	S	S	.	.	H	α-helix	trans	-73.2	-39.9	172.9	-74.2	178.2	-166.8	0	0	111.9	K34 P35 R36 R41 R42	K34-E38 WeakPolarHBondContact CE-OE1 3.24Å; K34-E38 PolarHBondContact O-N 3.25Å; P35-E38 PolarHBondContact O-N 3.17Å; R36-E38 VanDerWaalsContact C-N 3.26Å; R36-E38 PolarHBondContact O-N 3.04Å; E38-R41 PolarHBondContact O-N 2.99Å; E38-R42 VanDerWaalsContact O-CG 3.31Å; E38-R42 WeakPolarHBondContact O-CG 3.31Å; E38-R42 PolarHBondContact O-N 3.05Å
39	E	92.1	Very high	93.5	Very high	119 Å²	119	110.1 Å²	110.1	56%	0.556	51%	0.506	S	S	*	.	H	α-helix	trans	-63.6	-47.6	174.5	-74.3	173.4	-179	0	0	111.8	P35 R36 R41 R42 I43	P35-E39 WeakPolarHBondContact O-CG 3.33Å; P35-E39 PolarHBondContact O-N 3.38Å; R36-E39 PolarHBondContact O-N 2.9Å; E39-R41 VanDerWaalsContact C-N 3.32Å; E39-R41 PolarHBondContact O-N 3.26Å; E39-R42 WeakPolarHBondContact O-CB 3.17Å; E39-R42 PolarHBondContact O-N 3.3Å; E39-I43 WeakPolarHBondContact O-CG1 3.36Å; E39-I43 PolarHBondContact O-N 3.46Å
40	E	91.8	Very high	93.2	Very high	124 Å²	124	113.3 Å²	113.3	58%	0.579	52%	0.518	S	S	*	.	H	α-helix	trans	-56.1	-46.4	176.1	-75.1	171.6	178.8	0	0	111.3	R36 R42 I43 E44	R36-E40 WeakPolarHBondContact O-CG 3.45Å; R36-E40 PolarHBondContact O-N 3.49Å; E40-R42 VanDerWaalsContact C-N 3.3Å; E40-R42 PolarHBondContact O-N 3.32Å; E40-I43 PolarHBondContact O-N 2.98Å; E40-E44 WeakPolarHBondContact O-CG 3.42Å; E40-E44 PolarHBondContact O-N 3.29Å
41	R	92.4	Very high	93	Very high	169 Å²	169	111 Å²	111	64%	0.638	51%	0.512	S	S	*	.	H	α-helix	trans	-63.6	-33.5	176.3	-73.5	179.5	-137.8	177.9	1.6	113.4	A37 E38 E39 A45	A37-R41 VanDerWaalsContact O-CG 3.24Å; A37-R41 WeakPolarHBondContact O-CG 3.47Å; A37-R41 PolarHBondContact O-N 2.88Å; A37-R41 PolarHBondContact O-NE 3.21Å; E38-R41 PolarHBondContact O-N 2.99Å; E39-R41 VanDerWaalsContact C-N 3.32Å; E39-R41 PolarHBondContact O-N 3.26Å; R41-A45 WeakPolarHBondContact O-CB 3.38Å; R41-A45 PolarHBondContact O-N 3.06Å; R41-A45 VanDerWaalsContact O-N 3.09Å
42	R	92.3	Very high	92.8	Very high	181 Å²	181	110.4 Å²	110.4	68%	0.683	50%	0.503	S	S	*	.	H	α-helix	trans	-67.3	-44	176.2	-75.5	174.9	-177	-159.1	3.5	110.7	E38 E39 E40 A45 E46	E38-R42 VanDerWaalsContact O-CG 3.31Å; E38-R42 WeakPolarHBondContact O-CG 3.31Å; E38-R42 PolarHBondContact O-N 3.05Å; E39-R42 WeakPolarHBondContact O-CB 3.17Å; E39-R42 PolarHBondContact O-N 3.3Å; E40-R42 VanDerWaalsContact C-N 3.3Å; E40-R42 PolarHBondContact O-N 3.32Å; R42-A45 PolarHBondContact O-N 3.46Å; R42-E46 PolarHBondContact O-N 3.39Å
43	I	92.7	Very high	92.7	Very high	91 Å²	91	110.6 Å²	110.6	47%	0.467	51%	0.508	S	S	.	.	H	α-helix	trans	-62.5	-48.6	177.8	-65.1	164.1	0	0	0	110	E39 E40 A45 E46 E47	E39-I43 WeakPolarHBondContact O-CG1 3.36Å; E39-I43 PolarHBondContact O-N 3.46Å; E40-I43 PolarHBondContact O-N 2.98Å; I43-A45 VanDerWaalsContact C-N 3.28Å; I43-A45 PolarHBondContact O-N 3.31Å; I43-E46 PolarHBondContact O-N 2.99Å; I43-E46 VanDerWaalsContact O-N 3.1Å; I43-E47 HydrophobicContact CG2-CG 4.34Å; I43-E47 WeakPolarHBondContact O-CG 3.21Å; I43-E47 PolarHBondContact O-N 2.89Å
44	E	92.4	Very high	92.4	Very high	128 Å²	128	112.4 Å²	112.4	60%	0.598	52%	0.517	S	S	*	.	H	α-helix	trans	-58.2	-39.9	177	-74	179.8	176.1	0	0	112.4	E40 K48	E40-E44 WeakPolarHBondContact O-CG 3.42Å; E40-E44 PolarHBondContact O-N 3.29Å; E44-K48 VanDerWaalsContact O-CB 3.25Å; E44-K48 WeakPolarHBondContact O-CB 3.31Å; E44-K48 PolarHBondContact O-N 2.75Å
45	A	93.5	Very high	92.3	Very high	50 Å²	50	112.8 Å²	112.8	41%	0.413	52%	0.519	S	S	.	.	H	α-helix	trans	-67.6	-37	177.2	0	0	0	0	0	112.4	R41 R42 I43 K49	R41-A45 WeakPolarHBondContact O-CB 3.38Å; R41-A45 PolarHBondContact O-N 3.06Å; R41-A45 VanDerWaalsContact O-N 3.09Å; R42-A45 PolarHBondContact O-N 3.46Å; I43-A45 VanDerWaalsContact C-N 3.28Å; I43-A45 PolarHBondContact O-N 3.31Å; A45-K49 WeakPolarHBondContact O-CG 3.48Å; A45-K49 PolarHBondContact O-N 3.35Å; A45-K49 VanDerWaalsContact O-N 3.15Å
46	E	90.9	Very high	92.1	Very high	144 Å²	144	118 Å²	118	67%	0.673	53%	0.531	S	S	*	.	H	α-helix	trans	-69.9	-45.7	176.5	-171.3	173.9	173.6	0	0	111.6	R42 I43 K48 K49 R50	R42-E46 PolarHBondContact O-N 3.39Å; I43-E46 PolarHBondContact O-N 2.99Å; I43-E46 VanDerWaalsContact O-N 3.1Å; E46-K48 VanDerWaalsContact C-N 3.32Å; E46-K48 PolarHBondContact O-N 2.95Å; E46-K49 PolarHBondContact O-N 3.39Å; E46-R50 PolarHBondContact O-N 3.5Å
47	E	92	Very high	91.9	Very high	111 Å²	111	116.7 Å²	116.7	52%	0.519	53%	0.532	S	S	.	.	H	α-helix	trans	-60.4	-42.4	175.4	-72.7	-172.9	170.7	0	0	111.7	I43 K49 R50 Q51	I43-E47 HydrophobicContact CG2-CG 4.34Å; I43-E47 WeakPolarHBondContact O-CG 3.21Å; I43-E47 PolarHBondContact O-N 2.89Å; E47-K49 PolarHBondContact O-N 3.03Å; E47-R50 PolarHBondContact O-N 3.47Å; E47-Q51 WeakPolarHBondContact O-CG 3.37Å; E47-Q51 PolarHBondContact O-N 2.92Å
48	K	93.1	Very high	91.7	Very high	133 Å²	133	118.2 Å²	118.2	58%	0.578	54%	0.544	S	S	*	.	H	α-helix	trans	-62.1	-43.5	177.1	-173.8	175.2	-179.1	179.5	0	112	E44 E46 R50 Q51 D52	E44-K48 VanDerWaalsContact O-CB 3.25Å; E44-K48 WeakPolarHBondContact O-CB 3.31Å; E44-K48 PolarHBondContact O-N 2.75Å; E46-K48 VanDerWaalsContact C-N 3.32Å; E46-K48 PolarHBondContact O-N 2.95Å; K48-R50 VanDerWaalsContact C-N 3.34Å; K48-R50 PolarHBondContact O-N 2.87Å; K48-Q51 PolarHBondContact O-N 3.43Å; K48-D52 WeakPolarHBondContact O-CB 3.07Å; K48-D52 VanDerWaalsContact O-CG 3.25Å; K48-D52 PolarHBondContact O-N 3.23Å
49	K	93.1	Very high	91.4	Very high	142 Å²	142	122.6 Å²	122.6	62%	0.617	56%	0.557	S	S	*	*	H	α-helix	trans	-59.8	-46	175.5	-75.5	174.4	-178.3	-177.5	0	111.4	A45 E46 E47 Q51 D52 E53	A45-K49 WeakPolarHBondContact O-CG 3.48Å; A45-K49 PolarHBondContact O-N 3.35Å; A45-K49 VanDerWaalsContact O-N 3.15Å; E46-K49 PolarHBondContact O-N 3.39Å; E47-K49 PolarHBondContact O-N 3.03Å; K49-Q51 VanDerWaalsContact C-N 3.33Å; K49-Q51 PolarHBondContact O-N 3.07Å; K49-D52 PolarHBondContact O-N 2.9Å; K49-E53 WeakPolarHBondContact O-CG 3.41Å; K49-E53 PolarHBondContact O-N 3.02Å
50	R	90.8	Very high	91.1	Very high	182 Å²	182	122.6 Å²	122.6	69%	0.687	56%	0.557	S	S	*	*	H	α-helix	trans	-60.7	-42.7	177.9	-164.2	179.5	-159.2	170	6.6	111.9	E46 E47 K48 L54	E46-R50 PolarHBondContact O-N 3.5Å; E47-R50 PolarHBondContact O-N 3.47Å; K48-R50 VanDerWaalsContact C-N 3.34Å; K48-R50 PolarHBondContact O-N 2.87Å; R50-L54 VanDerWaalsContact O-CG 3.31Å; R50-L54 WeakPolarHBondContact O-CG 3.19Å; R50-L54 PolarHBondContact O-N 3.48Å
51	Q	91.7	Very high	90.8	Very high	102 Å²	102	121.9 Å²	121.9	48%	0.477	56%	0.557	S	S	.	*	H	α-helix	trans	-64.6	-40.5	175.4	-73.4	-175	14.8	0	0	112.3	E47 K48 K49 L54 K55	E47-Q51 WeakPolarHBondContact O-CG 3.37Å; E47-Q51 PolarHBondContact O-N 2.92Å; K48-Q51 PolarHBondContact O-N 3.43Å; K49-Q51 VanDerWaalsContact C-N 3.33Å; K49-Q51 PolarHBondContact O-N 3.07Å; Q51-L54 PolarHBondContact O-N 3.03Å; Q51-K55 WeakPolarHBondContact O-CB 3.38Å; Q51-K55 VanDerWaalsContact O-CG 3.23Å; Q51-K55 WeakPolarHBondContact O-CG 3.49Å; Q51-K55 PolarHBondContact O-N 3.37Å
52	D	91.9	Very high	90.3	Very high	66 Å²	66	116.8 Å²	116.8	35%	0.353	55%	0.551	S	S	.	*	H	α-helix	trans	-68.9	-36.5	-180	-71.4	-17.9	0	0	0	111.6	K48 K49 K55 R56	K48-D52 WeakPolarHBondContact O-CB 3.07Å; K48-D52 VanDerWaalsContact O-CG 3.25Å; K48-D52 PolarHBondContact O-N 3.23Å; K49-D52 PolarHBondContact O-N 2.9Å; D52-K55 PolarHBondContact O-N 2.98Å; D52-R56 WeakPolarHBondContact O-CG 3.06Å; D52-R56 PolarHBondContact O-N 3.43Å
53	E	90.9	Very high	89.6	Confident	119 Å²	119	114.1 Å²	114.1	56%	0.556	55%	0.546	S	S	*	.	H	α-helix	trans	-63.7	-48	172.1	-74.1	173.4	-174.8	0	0	112	K49 K55 R56 I57	K49-E53 WeakPolarHBondContact O-CG 3.41Å; K49-E53 PolarHBondContact O-N 3.02Å; E53-K55 VanDerWaalsContact C-N 3.28Å; E53-K55 PolarHBondContact O-N 3.31Å; E53-R56 WeakPolarHBondContact O-CB 3.36Å; E53-R56 PolarHBondContact O-N 3.47Å; E53-R56 VanDerWaalsContact O-N 3.11Å; E53-I57 WeakPolarHBondContact O-CG1 3.42Å; E53-I57 PolarHBondContact O-N 3.28Å
54	L	90.8	Very high	88.7	Confident	110 Å²	110	115.9 Å²	115.9	58%	0.576	55%	0.552	S	S	*	*	H	α-helix	trans	-60.1	-39.7	175.9	-71.2	171.6	0	0	0	111.8	R50 Q51 R56 A58	R50-L54 VanDerWaalsContact O-CG 3.31Å; R50-L54 WeakPolarHBondContact O-CG 3.19Å; R50-L54 PolarHBondContact O-N 3.48Å; Q51-L54 PolarHBondContact O-N 3.03Å; L54-R56 VanDerWaalsContact C-N 3.35Å; L54-A58 VanDerWaalsContact O-CB 3.31Å; L54-A58 WeakPolarHBondContact O-CB 3.4Å; L54-A58 PolarHBondContact O-N 3.05Å
55	K	90.1	Very high	87.8	Confident	107 Å²	107	114.8 Å²	114.8	47%	0.465	55%	0.55	S	S	.	*	H	α-helix	trans	-66.5	-34.5	175.7	-75.1	169.8	-170.8	165.1	0	112.5	Q51 D52 E53 R59	Q51-K55 WeakPolarHBondContact O-CB 3.38Å; Q51-K55 VanDerWaalsContact O-CG 3.23Å; Q51-K55 WeakPolarHBondContact O-CG 3.49Å; Q51-K55 PolarHBondContact O-N 3.37Å; D52-K55 PolarHBondContact O-N 2.98Å; E53-K55 VanDerWaalsContact C-N 3.28Å; E53-K55 PolarHBondContact O-N 3.31Å; K55-R59 WeakPolarHBondContact O-CB 3.3Å; K55-R59 VanDerWaalsContact O-CG 3.28Å; K55-R59 WeakPolarHBondContact O-CG 3.26Å; K55-R59 PolarHBondContact O-N 3.45Å
56	R	91.1	Very high	86.7	Confident	170 Å²	170	116 Å²	116	64%	0.642	56%	0.556	S	S	*	*	H	α-helix	trans	-66.5	-50.1	174.8	-76.5	178.3	-173.6	-175.7	1.9	111.1	D52 E53 L54 A58 R59 E60	D52-R56 WeakPolarHBondContact O-CG 3.06Å; D52-R56 PolarHBondContact O-N 3.43Å; E53-R56 WeakPolarHBondContact O-CB 3.36Å; E53-R56 PolarHBondContact O-N 3.47Å; E53-R56 VanDerWaalsContact O-N 3.11Å; L54-R56 VanDerWaalsContact C-N 3.35Å; R56-A58 VanDerWaalsContact C-N 3.29Å; R56-A58 PolarHBondContact O-N 2.95Å; R56-R59 WeakPolarHBondContact O-CB 3.39Å; R56-R59 PolarHBondContact O-N 3.42Å; R56-E60 WeakPolarHBondContact O-CG 3.42Å; R56-E60 PolarHBondContact O-N 2.88Å
57	I	89.6	Confident	85.4	Confident	90 Å²	90	115.6 Å²	115.6	46%	0.462	56%	0.557	S	S	.	*	H	α-helix	trans	-57.4	-45.6	177.1	-64.8	166.7	0	0	0	110.3	E53 R59 E60 L61	E53-I57 WeakPolarHBondContact O-CG1 3.42Å; E53-I57 PolarHBondContact O-N 3.28Å; I57-R59 VanDerWaalsContact C-N 3.31Å; I57-R59 PolarHBondContact O-N 2.84Å; I57-E60 PolarHBondContact O-N 2.85Å; I57-L61 HydrophobicContact CG2-CD1 3.64Å; I57-L61 WeakPolarHBondContact O-CB 3.43Å; I57-L61 WeakPolarHBondContact O-CD1 3.3Å; I57-L61 PolarHBondContact O-N 3.31Å
58	A	88.3	Confident	83.9	Confident	60 Å²	60	117.4 Å²	117.4	50%	0.496	57%	0.57	S	S	.	*	H	α-helix	trans	-63.4	-34.7	177.7	0	0	0	0	0	113.2	L54 R56 A62	L54-A58 VanDerWaalsContact O-CB 3.31Å; L54-A58 WeakPolarHBondContact O-CB 3.4Å; L54-A58 PolarHBondContact O-N 3.05Å; R56-A58 VanDerWaalsContact C-N 3.29Å; R56-A58 PolarHBondContact O-N 2.95Å; A58-A62 VanDerWaalsContact O-CB 3.3Å; A58-A62 WeakPolarHBondContact O-CB 3.31Å; A58-A62 PolarHBondContact O-N 2.85Å
59	R	87.4	Confident	81.8	Confident	177 Å²	177	121.7 Å²	121.7	67%	0.668	59%	0.588	S	S	*	*	H	α-helix	trans	-69.7	-45	174.5	-78.7	176.3	-176.5	-175.1	0.6	111.8	K55 R56 I57 A62 E63	K55-R59 WeakPolarHBondContact O-CB 3.3Å; K55-R59 VanDerWaalsContact O-CG 3.28Å; K55-R59 WeakPolarHBondContact O-CG 3.26Å; K55-R59 PolarHBondContact O-N 3.45Å; R56-R59 WeakPolarHBondContact O-CB 3.39Å; R56-R59 PolarHBondContact O-N 3.42Å; I57-R59 VanDerWaalsContact C-N 3.31Å; I57-R59 PolarHBondContact O-N 2.84Å; R59-A62 PolarHBondContact O-N 3.03Å; R59-E63 WeakPolarHBondContact O-CG 3.27Å; R59-E63 PolarHBondContact O-N 2.97Å
60	E	86.9	Confident	81.3	Confident	119 Å²	119	120.7 Å²	120.7	56%	0.556	59%	0.587	S	S	*	*	H	α-helix	trans	-60.4	-46.2	177.6	-71.8	170.5	-173.9	0	0	110.8	R56 I57 A62 E63 E64	R56-E60 WeakPolarHBondContact O-CG 3.42Å; R56-E60 PolarHBondContact O-N 2.88Å; I57-E60 PolarHBondContact O-N 2.85Å; E60-A62 VanDerWaalsContact C-N 3.34Å; E60-A62 PolarHBondContact O-N 3.45Å; E60-E63 PolarHBondContact O-N 2.89Å; E60-E64 PolarHBondContact O-N 3.44Å
61	L	84.3	Confident	80.8	Confident	108 Å²	108	117.5 Å²	117.5	57%	0.565	58%	0.581	S	S	*	*	H	α-helix	trans	-60.4	-40.2	173.5	-95.4	130	0	0	0	112.9	I57 D65	I57-L61 HydrophobicContact CG2-CD1 3.64Å; I57-L61 WeakPolarHBondContact O-CB 3.43Å; I57-L61 WeakPolarHBondContact O-CD1 3.3Å; I57-L61 PolarHBondContact O-N 3.31Å; L61-D65 WeakPolarHBondContact O-CB 3.48Å; L61-D65 PolarHBondContact O-N 3.25Å
62	A	82.6	Confident	80.2	Confident	62 Å²	62	118.3 Å²	118.3	51%	0.512	59%	0.587	S	S	.	*	H	α-helix	trans	-70.3	-36	178	0	0	0	0	0	112.5	A58 R59 E60 S66	A58-A62 VanDerWaalsContact O-CB 3.3Å; A58-A62 WeakPolarHBondContact O-CB 3.31Å; A58-A62 PolarHBondContact O-N 2.85Å; R59-A62 PolarHBondContact O-N 3.03Å; E60-A62 VanDerWaalsContact C-N 3.34Å; E60-A62 PolarHBondContact O-N 3.45Å; A62-S66 WeakPolarHBondContact O-CB 3.31Å; A62-S66 PolarHBondContact O-N 3.39Å; A62-S66 PolarHBondContact O-OG 3.43Å
63	E	77.7	Confident	79.5	Confident	125 Å²	125	121.4 Å²	121.4	58%	0.584	60%	0.601	S	S	*	*	H	α-helix	trans	-66	-46.1	174	-77.1	-179.3	-177.3	0	0	110.7	R59 E60 D65 S66 I67	R59-E63 WeakPolarHBondContact O-CG 3.27Å; R59-E63 PolarHBondContact O-N 2.97Å; E60-E63 PolarHBondContact O-N 2.89Å; E63-D65 PolarHBondContact O-N 3.01Å; E63-S66 PolarHBondContact O-N 3.28Å; E63-S66 PolarHBondContact O-OG 3.16Å; E63-I67 VanDerWaalsContact O-CG1 3.3Å; E63-I67 WeakPolarHBondContact O-CG1 3.46Å; E63-I67 PolarHBondContact O-N 2.93Å
64	E	74.3	Confident	78.8	Confident	129 Å²	129	121.6 Å²	121.6	60%	0.603	60%	0.604	S	S	*	*	H	α-helix	trans	-59.8	-45.9	174.9	-73.6	-173.6	168.1	0	0	112.4	E60 S66 I67 L68	E60-E64 PolarHBondContact O-N 3.44Å; E64-S66 VanDerWaalsContact C-N 3.26Å; E64-S66 PolarHBondContact O-N 3.39Å; E64-I67 PolarHBondContact O-N 2.9Å; E64-I67 VanDerWaalsContact O-N 3.15Å; E64-L68 WeakPolarHBondContact O-CG 3.46Å; E64-L68 PolarHBondContact O-N 3Å; E64-L68 VanDerWaalsContact O-N 3.1Å
65	D	72.5	Confident	78	Confident	104 Å²	104	122.3 Å²	122.3	56%	0.556	61%	0.606	S	S	*	*	H	α-helix	trans	-66.5	-28.4	178.8	-159.6	51.2	0	0	0	112.3	L61 E63	L61-D65 WeakPolarHBondContact O-CB 3.48Å; L61-D65 PolarHBondContact O-N 3.25Å; E63-D65 PolarHBondContact O-N 3.01Å
66	S	70.4	Confident	77.1	Confident	75 Å²	75	123.4 Å²	123.4	52%	0.524	62%	0.616	S	S	.	*	H	α-helix	trans	-75.5	-27.3	173.7	76.6	0	0	0	0	113.8	A62 E63 E64	A62-S66 WeakPolarHBondContact O-CB 3.31Å; A62-S66 PolarHBondContact O-N 3.39Å; A62-S66 PolarHBondContact O-OG 3.43Å; E63-S66 PolarHBondContact O-N 3.28Å; E63-S66 PolarHBondContact O-OG 3.16Å; E64-S66 VanDerWaalsContact C-N 3.26Å; E64-S66 PolarHBondContact O-N 3.39Å
67	I	64.7	Low	76	Confident	136 Å²	136	119.8 Å²	119.8	70%	0.697	61%	0.614	S	S	*	*	H	α-helix	trans	-80.8	-28.5	177.7	-69.1	167.3	0	0	0	111.1	E63 E64 K69	E63-I67 VanDerWaalsContact O-CG1 3.3Å; E63-I67 WeakPolarHBondContact O-CG1 3.46Å; E63-I67 PolarHBondContact O-N 2.93Å; E64-I67 PolarHBondContact O-N 2.9Å; E64-I67 VanDerWaalsContact O-N 3.15Å; I67-K69 VanDerWaalsContact C-N 3.29Å; I67-K69 PolarHBondContact O-N 3.1Å
68	L	59	Low	74.9	Confident	150 Å²	150	122.3 Å²	122.3	79%	0.785	63%	0.626	S	S	*	*			trans	-82.2	-0.4	179	-68.7	173.5	0	0	0	114.3	E64	E64-L68 WeakPolarHBondContact O-CG 3.46Å; E64-L68 PolarHBondContact O-N 3Å; E64-L68 VanDerWaalsContact O-N 3.1Å
69	K	50.3	Low	73.7	Confident	223 Å²	223	128 Å²	128	97%	0.97	64%	0.638	S	S	*	*			trans	-111.6	0	-174.6	-147	175.3	-161.8	156.5	0	111.9	I67	I67-K69 VanDerWaalsContact C-N 3.29Å; I67-K69 PolarHBondContact O-N 3.1Å

Retrieved 69 of 69 residues in 61.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).