A0A096NC85_PAPAN Loading...

V-type proton ATPase subunit G

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession A0A096NC85, Species PAPAN (Papio anubis, Olive baboon), Gene ATP6V1G3, Length 118 aa.

						>A0A096NC85_PAPAN|A0A096NC85|ATP6V1G3
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLIQSKIMGSQSNLSDEIEEQTLGKIQELNGHYNKHMESVMNQLLSMVCDMKPEIHVNYRATN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	76.5	Confident	217 Å²	217	120.1 Å²	120.1	100%	1.069	65%	0.646	S	S	*	*				0	-16.7	0	-63.7	-64.4	-103.2	0	0	114
2	T	57.1	Low	77.9	Confident	124 Å²	124	117.9 Å²	117.9	76%	0.761	63%	0.633	S	S	*	*	H	α-helix	trans	-80.6	-25.9	-176.1	47.8	0	0	0	0	115.1	Q4	T2-Q4 PolarHBondContact O-N 2.67Å
3	S	61.3	Low	79.1	Confident	102 Å²	102	116.8 Å²	116.8	71%	0.713	62%	0.621	S	S	*	*	H	α-helix	trans	-69.5	-28.5	-175.9	-173.2	0	0	0	0	114.6
4	Q	66.1	Low	80.2	Confident	148 Å²	148	112.3 Å²	112.3	69%	0.692	61%	0.609	S	S	*	*	H	α-helix	trans	-75.9	-37.1	-177.3	-164.9	178	15	0	0	111.7	T2 I8	T2-Q4 PolarHBondContact O-N 2.67Å; Q4-I8 HydrophobicContact CG-CD1 4.4Å; Q4-I8 WeakPolarHBondContact O-CD1 3.43Å; Q4-I8 WeakPolarHBondContact O-CG1 3.14Å; Q4-I8 PolarHBondContact O-N 2.84Å
5	S	74.7	Confident	81.2	Confident	70 Å²	70	113.4 Å²	113.4	49%	0.49	61%	0.608	S	S	.	*	H	α-helix	trans	-67	-37.9	178.3	-178.1	0	0	0	0	112.4	I8 H9	S5-I8 PolarHBondContact O-N 3.24Å; S5-H9 PolarHBondContact O-CD2 2.86Å; S5-H9 PolarHBondContact O-N 3.06Å; S5-H9 VanDerWaalsContact O-N 3.12Å
6	Q	81.4	Confident	82.1	Confident	148 Å²	148	115.1 Å²	115.1	69%	0.692	61%	0.609	S	S	*	*	H	α-helix	trans	-68.9	-38	-179.7	-165.3	165.2	-1.5	0	0	112.8	H9 Q10	Q6-H9 PolarHBondContact O-N 3.23Å; Q6-Q10 PolarHBondContact O-N 3.3Å
7	G	88	Confident	82.9	Confident	33 Å²	33	117.6 Å²	117.6	34%	0.34	61%	0.608	S	S	.	*	H	α-helix	trans	-66.2	-40.8	175.1	0	0	0	0	0	113.1	H9 Q10 L11	G7-H9 PolarHBondContact O-N 3.03Å; G7-Q10 PolarHBondContact O-N 3.35Å; G7-L11 WeakPolarHBondContact O-CG 3.31Å; G7-L11 PolarHBondContact O-N 3.43Å; G7-L11 VanDerWaalsContact O-N 3.09Å
8	I	87.6	Confident	83.6	Confident	91 Å²	91	114.6 Å²	114.6	47%	0.467	60%	0.602	S	S	.	*	H	α-helix	trans	-62.7	-43.7	176.3	-67.2	165.8	0	0	0	110.7	Q4 S5 Q10 L11 L12	Q4-I8 HydrophobicContact CG-CD1 4.4Å; Q4-I8 WeakPolarHBondContact O-CD1 3.43Å; Q4-I8 WeakPolarHBondContact O-CG1 3.14Å; Q4-I8 PolarHBondContact O-N 2.84Å; S5-I8 PolarHBondContact O-N 3.24Å; I8-Q10 VanDerWaalsContact C-N 3.3Å; I8-Q10 PolarHBondContact O-N 3.35Å; I8-L11 PolarHBondContact O-N 3.43Å; I8-L12 HydrophobicContact CG2-CD1 4.01Å; I8-L12 HydrophobicContact CG2-CG 4.42Å; I8-L12 WeakPolarHBondContact O-CG 3.37Å; I8-L12 PolarHBondContact O-N 3.47Å
9	H	88.4	Confident	84.3	Confident	126 Å²	126	115.7 Å²	115.7	58%	0.583	60%	0.602	S	S	*	*	H	α-helix	trans	-59.8	-38.9	176	-96	-68.1	0	0	0	113.1	S5 Q6 G7 L12 Q13	S5-H9 PolarHBondContact O-CD2 2.86Å; S5-H9 PolarHBondContact O-N 3.06Å; S5-H9 VanDerWaalsContact O-N 3.12Å; Q6-H9 PolarHBondContact O-N 3.23Å; G7-H9 PolarHBondContact O-N 3.03Å; H9-L12 PolarHBondContact O-N 2.9Å; H9-Q13 WeakPolarHBondContact O-CB 3.24Å; H9-Q13 PolarHBondContact O-N 3.18Å
10	Q	91.3	Very high	84.9	Confident	137 Å²	137	114.4 Å²	114.4	64%	0.64	60%	0.596	S	S	*	*	H	α-helix	trans	-67.3	-39.8	177.8	-167.7	172.5	10.6	0	0	112.1	Q6 G7 I8 Q13 A14	Q6-Q10 PolarHBondContact O-N 3.3Å; G7-Q10 PolarHBondContact O-N 3.35Å; I8-Q10 VanDerWaalsContact C-N 3.3Å; I8-Q10 PolarHBondContact O-N 3.35Å; Q10-Q13 PolarHBondContact O-N 3.21Å; Q10-A14 WeakPolarHBondContact O-CB 3.1Å; Q10-A14 PolarHBondContact O-N 3.05Å
11	L	92.3	Very high	85.5	Confident	125 Å²	125	116.7 Å²	116.7	65%	0.654	60%	0.601	S	S	*	*	H	α-helix	trans	-64.4	-44.6	175.2	-68.8	173.2	0	0	0	111.8	G7 I8 Q13 A14 E15	G7-L11 WeakPolarHBondContact O-CG 3.31Å; G7-L11 PolarHBondContact O-N 3.43Å; G7-L11 VanDerWaalsContact O-N 3.09Å; I8-L11 PolarHBondContact O-N 3.43Å; L11-Q13 VanDerWaalsContact C-N 3.3Å; L11-Q13 PolarHBondContact O-N 3.41Å; L11-A14 WeakPolarHBondContact O-CB 3.37Å; L11-A14 PolarHBondContact O-N 2.97Å; L11-E15 WeakPolarHBondContact O-CB 3.41Å; L11-E15 PolarHBondContact O-N 2.9Å
12	L	93.5	Very high	87.6	Confident	94 Å²	94	110.9 Å²	110.9	49%	0.492	57%	0.574	S	S	.	*	H	α-helix	trans	-61.9	-38.2	176	-69.9	171.3	0	0	0	112	I8 H9 K16	I8-L12 HydrophobicContact CG2-CD1 4.01Å; I8-L12 HydrophobicContact CG2-CG 4.42Å; I8-L12 WeakPolarHBondContact O-CG 3.37Å; I8-L12 PolarHBondContact O-N 3.47Å; H9-L12 PolarHBondContact O-N 2.9Å; L12-K16 PolarHBondContact O-N 2.93Å
13	Q	93.8	Very high	89.4	Confident	103 Å²	103	109.2 Å²	109.2	48%	0.481	56%	0.558	S	S	.	*	H	α-helix	trans	-67.6	-40	175	-169.2	-178.7	39.3	0	0	111.9	H9 Q10 L11 K16 R17	H9-Q13 WeakPolarHBondContact O-CB 3.24Å; H9-Q13 PolarHBondContact O-N 3.18Å; Q10-Q13 PolarHBondContact O-N 3.21Å; L11-Q13 VanDerWaalsContact C-N 3.3Å; L11-Q13 PolarHBondContact O-N 3.41Å; Q13-K16 PolarHBondContact O-N 3.29Å; Q13-R17 VanDerWaalsContact NE2-NH2 3.16Å; Q13-R17 WeakPolarHBondContact O-CG 3.39Å; Q13-R17 PolarHBondContact O-N 3.29Å
14	A	94.4	Very high	91.1	Very high	54 Å²	54	110.9 Å²	110.9	45%	0.446	55%	0.554	S	S	.	*	H	α-helix	trans	-64.6	-42.1	175.6	0	0	0	0	0	111.6	Q10 L11 R17 A18	Q10-A14 WeakPolarHBondContact O-CB 3.1Å; Q10-A14 PolarHBondContact O-N 3.05Å; L11-A14 WeakPolarHBondContact O-CB 3.37Å; L11-A14 PolarHBondContact O-N 2.97Å; A14-R17 PolarHBondContact O-N 3.28Å; A14-A18 WeakPolarHBondContact O-CB 3.31Å; A14-A18 PolarHBondContact O-N 2.9Å
15	E	94.7	Very high	92.6	Very high	129 Å²	129	106.7 Å²	106.7	60%	0.603	54%	0.544	S	S	*	.	H	α-helix	trans	-59.7	-47	175.3	-172.8	-176.1	172.6	0	0	111.2	L11 R17 A18 K19	L11-E15 WeakPolarHBondContact O-CB 3.41Å; L11-E15 PolarHBondContact O-N 2.9Å; E15-R17 PolarHBondContact O-N 3.36Å; E15-A18 PolarHBondContact O-N 3.34Å; E15-K19 WeakPolarHBondContact O-CB 3.46Å; E15-K19 PolarHBondContact O-N 3.06Å
16	K	95.9	Very high	93.7	Very high	141 Å²	141	108.8 Å²	108.8	61%	0.613	55%	0.545	S	S	*	.	H	α-helix	trans	-58.8	-48.1	176.4	-172.4	177	179.5	-179.4	0	111.7	L12 Q13 A18 K19 D20	L12-K16 PolarHBondContact O-N 2.93Å; Q13-K16 PolarHBondContact O-N 3.29Å; K16-A18 VanDerWaalsContact C-N 3.33Å; K16-A18 PolarHBondContact O-N 3.44Å; K16-K19 PolarHBondContact O-N 2.88Å; K16-D20 VanDerWaalsContact O-CG 3.23Å; K16-D20 PolarHBondContact O-N 2.92Å
17	R	95.4	Very high	94.4	Very high	158 Å²	158	109.9 Å²	109.9	60%	0.596	55%	0.547	S	S	*	.	H	α-helix	trans	-62.2	-39	177.7	-72.3	176.9	-176	167.4	3.8	112.4	Q13 A14 E15 K21	Q13-R17 VanDerWaalsContact NE2-NH2 3.16Å; Q13-R17 WeakPolarHBondContact O-CG 3.39Å; Q13-R17 PolarHBondContact O-N 3.29Å; A14-R17 PolarHBondContact O-N 3.28Å; E15-R17 PolarHBondContact O-N 3.36Å; R17-K21 WeakPolarHBondContact O-CB 3.3Å; R17-K21 PolarHBondContact O-N 3.37Å
18	A	96	Very high	94.8	Very high	62 Å²	62	115.5 Å²	115.5	51%	0.512	56%	0.558	S	S	.	*	H	α-helix	trans	-65.5	-43.1	177.3	0	0	0	0	0	111.1	A14 E15 K16 K21 L22	A14-A18 WeakPolarHBondContact O-CB 3.31Å; A14-A18 PolarHBondContact O-N 2.9Å; E15-A18 PolarHBondContact O-N 3.34Å; K16-A18 VanDerWaalsContact C-N 3.33Å; K16-A18 PolarHBondContact O-N 3.44Å; A18-K21 PolarHBondContact O-N 3.36Å; A18-L22 WeakPolarHBondContact O-CB 3.4Å; A18-L22 PolarHBondContact O-N 2.98Å
19	K	96.4	Very high	95.3	Very high	136 Å²	136	118.1 Å²	118.1	59%	0.591	57%	0.566	S	S	*	*	H	α-helix	trans	-63.1	-46.6	176	-170.4	176.4	-178.8	176.9	0	111.9	E15 K16 K21 L22 E23	E15-K19 WeakPolarHBondContact O-CB 3.46Å; E15-K19 PolarHBondContact O-N 3.06Å; K16-K19 PolarHBondContact O-N 2.88Å; K19-K21 VanDerWaalsContact C-N 3.33Å; K19-K21 PolarHBondContact O-N 3.44Å; K19-L22 WeakPolarHBondContact O-CB 3.41Å; K19-L22 PolarHBondContact O-N 2.85Å; K19-E23 WeakPolarHBondContact O-CG 3.41Å; K19-E23 PolarHBondContact O-N 3.33Å
20	D	96.5	Very high	95.7	Very high	89 Å²	89	113.6 Å²	113.6	48%	0.476	55%	0.554	S	S	.	*	H	α-helix	trans	-60.7	-43.5	178.1	-68	-19.7	0	0	0	111.1	K16 L22 E23 E24	K16-D20 VanDerWaalsContact O-CG 3.23Å; K16-D20 PolarHBondContact O-N 2.92Å; D20-L22 VanDerWaalsContact C-N 3.34Å; D20-L22 PolarHBondContact O-N 3.19Å; D20-E23 PolarHBondContact O-N 3.23Å; D20-E24 WeakPolarHBondContact O-CB 3.32Å; D20-E24 PolarHBondContact O-N 3.03Å
21	K	96.9	Very high	96	Very high	163 Å²	163	114.3 Å²	114.3	71%	0.709	56%	0.555	S	S	*	*	H	α-helix	trans	-63	-38.6	176.2	-169.9	176.2	-171.2	-179.7	0	112.4	R17 A18 K19 A25	R17-K21 WeakPolarHBondContact O-CB 3.3Å; R17-K21 PolarHBondContact O-N 3.37Å; A18-K21 PolarHBondContact O-N 3.36Å; K19-K21 VanDerWaalsContact C-N 3.33Å; K19-K21 PolarHBondContact O-N 3.44Å; K21-A25 WeakPolarHBondContact O-CB 3.39Å; K21-A25 PolarHBondContact O-N 3.12Å; K21-A25 VanDerWaalsContact O-N 3.08Å
22	L	97	Very high	96.3	Very high	96 Å²	96	115.6 Å²	115.6	50%	0.503	55%	0.551	S	S	.	*	H	α-helix	trans	-65.5	-46.9	176.4	-171	94.2	0	0	0	111.2	A18 K19 D20 A25 K26	A18-L22 WeakPolarHBondContact O-CB 3.4Å; A18-L22 PolarHBondContact O-N 2.98Å; K19-L22 WeakPolarHBondContact O-CB 3.41Å; K19-L22 PolarHBondContact O-N 2.85Å; D20-L22 VanDerWaalsContact C-N 3.34Å; D20-L22 PolarHBondContact O-N 3.19Å; L22-A25 PolarHBondContact O-N 3.48Å; L22-K26 WeakPolarHBondContact O-CG 3.32Å; L22-K26 PolarHBondContact O-N 3.14Å
23	E	96.7	Very high	96.4	Very high	89 Å²	89	116.5 Å²	116.5	42%	0.416	56%	0.556	S	S	.	*	H	α-helix	trans	-66.6	-38.3	-180	-69.7	-53.1	127.8	0	0	112	K19 D20 A25 K26 K27	K19-E23 WeakPolarHBondContact O-CG 3.41Å; K19-E23 PolarHBondContact O-N 3.33Å; D20-E23 PolarHBondContact O-N 3.23Å; E23-A25 PolarHBondContact O-N 3.02Å; E23-K26 PolarHBondContact O-N 2.94Å; E23-K26 IonicContact OE1-NZ 2.72Å; E23-K26 PolarHBondContact OE1-NZ 3.31Å; E23-K27 WeakPolarHBondContact O-CB 3.48Å; E23-K27 PolarHBondContact O-N 3.28Å
24	E	96.8	Very high	96.6	Very high	137 Å²	137	118.6 Å²	118.6	64%	0.64	56%	0.563	S	S	*	*	H	α-helix	trans	-61	-44.4	172.3	-169.7	-177.3	174.8	0	0	111.6	D20 K26 K27 R28	D20-E24 WeakPolarHBondContact O-CB 3.32Å; D20-E24 PolarHBondContact O-N 3.03Å; E24-K26 PolarHBondContact O-N 2.89Å; E24-K27 PolarHBondContact O-N 3.46Å; E24-R28 WeakPolarHBondContact O-CB 3.45Å; E24-R28 PolarHBondContact O-N 3.28Å
25	A	96.9	Very high	96.7	Very high	59 Å²	59	120.3 Å²	120.3	49%	0.488	56%	0.562	S	S	.	*	H	α-helix	trans	-62.4	-43.1	176.7	0	0	0	0	0	112.2	K21 L22 E23 R28 K29	K21-A25 WeakPolarHBondContact O-CB 3.39Å; K21-A25 PolarHBondContact O-N 3.12Å; K21-A25 VanDerWaalsContact O-N 3.08Å; L22-A25 PolarHBondContact O-N 3.48Å; E23-A25 PolarHBondContact O-N 3.02Å; A25-R28 PolarHBondContact O-N 2.73Å; A25-K29 WeakPolarHBondContact O-CB 3.48Å; A25-K29 PolarHBondContact O-N 3.46Å
26	K	97.1	Very high	96.8	Very high	114 Å²	114	116.7 Å²	116.7	50%	0.496	55%	0.554	S	S	.	*	H	α-helix	trans	-61.3	-46.5	174.7	-73.5	177.1	-173.6	167.8	0	111.6	L22 E23 E24 R28 K29 G30	L22-K26 WeakPolarHBondContact O-CG 3.32Å; L22-K26 PolarHBondContact O-N 3.14Å; E23-K26 PolarHBondContact O-N 2.94Å; E23-K26 IonicContact OE1-NZ 2.72Å; E23-K26 PolarHBondContact OE1-NZ 3.31Å; E24-K26 PolarHBondContact O-N 2.89Å; K26-R28 VanDerWaalsContact C-N 3.34Å; K26-R28 PolarHBondContact O-N 3.39Å; K26-K29 PolarHBondContact O-N 2.89Å; K26-G30 PolarHBondContact O-N 3.12Å
27	K	97.1	Very high	96.9	Very high	171 Å²	171	116.9 Å²	116.9	74%	0.743	56%	0.555	S	S	*	*	H	α-helix	trans	-60.9	-43.3	177.5	-172	178.3	-178.8	-180	0	111.4	E23 E24 G30 K31	E23-K27 WeakPolarHBondContact O-CB 3.48Å; E23-K27 PolarHBondContact O-N 3.28Å; E24-K27 PolarHBondContact O-N 3.46Å; K27-G30 PolarHBondContact O-N 2.97Å; K27-K31 PolarHBondContact O-N 2.92Å
28	R	97.2	Very high	97	Very high	152 Å²	152	115.4 Å²	115.4	57%	0.574	56%	0.555	S	S	*	*	H	α-helix	trans	-64.2	-42.3	177	-171.9	175.4	-178.8	165.6	0.4	112.1	E24 A25 K26 K31 R32	E24-R28 WeakPolarHBondContact O-CB 3.45Å; E24-R28 PolarHBondContact O-N 3.28Å; A25-R28 PolarHBondContact O-N 2.73Å; K26-R28 VanDerWaalsContact C-N 3.34Å; K26-R28 PolarHBondContact O-N 3.39Å; R28-K31 PolarHBondContact O-N 3.12Å; R28-R32 PolarHBondContact O-N 3.38Å
29	K	97.3	Very high	97.1	Very high	145 Å²	145	117.6 Å²	117.6	63%	0.63	56%	0.555	S	S	*	*	H	α-helix	trans	-60.9	-47.1	173.9	-178.1	-179.9	176.3	-179.3	0	111.1	A25 K26 K31 R32 L33	A25-K29 WeakPolarHBondContact O-CB 3.48Å; A25-K29 PolarHBondContact O-N 3.46Å; K26-K29 PolarHBondContact O-N 2.89Å; K29-K31 VanDerWaalsContact C-N 3.35Å; K29-K31 PolarHBondContact O-N 3.14Å; K29-R32 PolarHBondContact O-N 3.48Å; K29-L33 HydrophobicContact CG-CD1 4.03Å; K29-L33 PolarHBondContact O-N 2.88Å
30	G	97.4	Very high	97.1	Very high	32 Å²	32	113.3 Å²	113.3	33%	0.33	55%	0.545	S	S	.	.	H	α-helix	trans	-59.8	-42.5	177.1	0	0	0	0	0	112.7	K26 K27 L33 K34	K26-G30 PolarHBondContact O-N 3.12Å; K27-G30 PolarHBondContact O-N 2.97Å; G30-L33 PolarHBondContact O-N 3.46Å; G30-K34 WeakPolarHBondContact O-CG 3.1Å; G30-K34 PolarHBondContact O-N 2.94Å
31	K	97.3	Very high	97.1	Very high	151 Å²	151	114 Å²	114	66%	0.657	55%	0.546	S	S	*	.	H	α-helix	trans	-61.9	-46.4	175.5	-173	177	178.5	-179	0	111.9	K27 R28 K29 L33 K34 Q35	K27-K31 PolarHBondContact O-N 2.92Å; R28-K31 PolarHBondContact O-N 3.12Å; K29-K31 VanDerWaalsContact C-N 3.35Å; K29-K31 PolarHBondContact O-N 3.14Å; K31-L33 PolarHBondContact O-N 3.21Å; K31-K34 PolarHBondContact O-N 3.27Å; K31-Q35 WeakPolarHBondContact O-CB 3.42Å; K31-Q35 PolarHBondContact O-N 2.96Å
32	R	97.1	Very high	97.2	Very high	153 Å²	153	110.1 Å²	110.1	58%	0.577	54%	0.536	S	S	*	.	H	α-helix	trans	-62.7	-39.5	178.2	-77.5	-176.6	169.4	179.5	-5.3	112.8	R28 K29 Q35 A36	R28-R32 PolarHBondContact O-N 3.38Å; K29-R32 PolarHBondContact O-N 3.48Å; R32-Q35 PolarHBondContact O-N 3.38Å; R32-A36 WeakPolarHBondContact O-CB 3.48Å; R32-A36 PolarHBondContact O-N 2.91Å
33	L	96.7	Very high	97.2	Very high	112 Å²	112	112.1 Å²	112.1	59%	0.586	54%	0.543	S	S	*	.	H	α-helix	trans	-64.4	-43.4	176	-82.2	160.6	0	0	0	112.2	K29 G30 K31 K37	K29-L33 HydrophobicContact CG-CD1 4.03Å; K29-L33 PolarHBondContact O-N 2.88Å; G30-L33 PolarHBondContact O-N 3.46Å; K31-L33 PolarHBondContact O-N 3.21Å; L33-K37 PolarHBondContact O-N 3.38Å; L33-K37 VanDerWaalsContact O-N 3.14Å
34	K	97.4	Very high	97.2	Very high	147 Å²	147	113.2 Å²	113.2	64%	0.639	55%	0.55	S	S	*	*	H	α-helix	trans	-63.1	-47.6	175.7	-73.5	-176.3	177.5	-170.6	0	111.5	G30 K31 A36 K37 E38	G30-K34 WeakPolarHBondContact O-CG 3.1Å; G30-K34 PolarHBondContact O-N 2.94Å; K31-K34 PolarHBondContact O-N 3.27Å; K34-A36 PolarHBondContact O-N 2.92Å; K34-K37 WeakPolarHBondContact O-CB 3.48Å; K34-K37 PolarHBondContact O-N 2.93Å; K34-K37 VanDerWaalsContact O-N 3.15Å; K34-E38 WeakPolarHBondContact O-CG 3.45Å; K34-E38 PolarHBondContact O-N 3.42Å
35	Q	97.5	Very high	97.3	Very high	90 Å²	90	110.5 Å²	110.5	42%	0.421	54%	0.54	S	S	.	.	H	α-helix	trans	-57.9	-48	177.9	-179	176.6	-2.7	0	0	111.7	K31 R32 K37 E38 E39	K31-Q35 WeakPolarHBondContact O-CB 3.42Å; K31-Q35 PolarHBondContact O-N 2.96Å; R32-Q35 PolarHBondContact O-N 3.38Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 3.44Å; Q35-E38 PolarHBondContact O-N 3.49Å; Q35-E39 HydrophobicContact CG-CG 4.32Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.33Å; Q35-E39 PolarHBondContact NE2-OE1 3.21Å; Q35-E39 WeakPolarHBondContact O-CB 3.47Å; Q35-E39 WeakPolarHBondContact O-CG 3.44Å; Q35-E39 PolarHBondContact O-N 3.31Å
36	A	97.3	Very high	97.3	Very high	54 Å²	54	113.5 Å²	113.5	45%	0.446	54%	0.544	S	S	.	.	H	α-helix	trans	-60.5	-36.6	178	0	0	0	0	0	112.5	R32 K34 A40	R32-A36 WeakPolarHBondContact O-CB 3.48Å; R32-A36 PolarHBondContact O-N 2.91Å; K34-A36 PolarHBondContact O-N 2.92Å; A36-A40 VanDerWaalsContact O-CB 3.31Å; A36-A40 WeakPolarHBondContact O-CB 3.48Å; A36-A40 PolarHBondContact O-N 3.11Å
37	K	97.3	Very high	97.4	Very high	144 Å²	144	115 Å²	115	63%	0.626	55%	0.548	S	S	*	.	H	α-helix	trans	-68.2	-44.5	175.7	-174	-176.6	175.5	-174.8	0	111.7	L33 K34 Q35 A40 M41	L33-K37 PolarHBondContact O-N 3.38Å; L33-K37 VanDerWaalsContact O-N 3.14Å; K34-K37 WeakPolarHBondContact O-CB 3.48Å; K34-K37 PolarHBondContact O-N 2.93Å; K34-K37 VanDerWaalsContact O-N 3.15Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 3.44Å; K37-A40 PolarHBondContact O-N 2.87Å; K37-M41 HydrophobicContact CG-SD 4.4Å; K37-M41 WeakPolarHBondContact O-CG 3.49Å; K37-M41 PolarHBondContact O-N 2.98Å
38	E	97.5	Very high	97.4	Very high	127 Å²	127	114.2 Å²	114.2	59%	0.593	54%	0.54	S	S	*	.	H	α-helix	trans	-63.6	-45.7	178.3	-74.7	166.4	-166	0	0	111.1	K34 Q35 A40 M41 V42	K34-E38 WeakPolarHBondContact O-CG 3.45Å; K34-E38 PolarHBondContact O-N 3.42Å; Q35-E38 PolarHBondContact O-N 3.49Å; E38-A40 PolarHBondContact O-N 3.47Å; E38-M41 PolarHBondContact O-N 2.91Å; E38-V42 WeakPolarHBondContact O-CG2 3.32Å; E38-V42 PolarHBondContact O-N 3.48Å
39	E	96.8	Very high	97.4	Very high	109 Å²	109	113.5 Å²	113.5	51%	0.509	55%	0.545	S	S	.	.	H	α-helix	trans	-60.2	-45.9	176.5	-72.9	171.9	-176.2	0	0	111.6	Q35 M41 V42 E43	Q35-E39 HydrophobicContact CG-CG 4.32Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.33Å; Q35-E39 PolarHBondContact NE2-OE1 3.21Å; Q35-E39 WeakPolarHBondContact O-CB 3.47Å; Q35-E39 WeakPolarHBondContact O-CG 3.44Å; Q35-E39 PolarHBondContact O-N 3.31Å; E39-M41 VanDerWaalsContact C-N 3.34Å; E39-M41 PolarHBondContact O-N 3.38Å; E39-V42 PolarHBondContact O-N 2.85Å; E39-E43 PolarHBondContact O-N 3.42Å
40	A	97.4	Very high	97.4	Very high	46 Å²	46	111.8 Å²	111.8	38%	0.38	54%	0.539	S	S	.	.	H	α-helix	trans	-62.8	-38.9	176.3	0	0	0	0	0	112.7	A36 K37 E38 E43 I44	A36-A40 VanDerWaalsContact O-CB 3.31Å; A36-A40 WeakPolarHBondContact O-CB 3.48Å; A36-A40 PolarHBondContact O-N 3.11Å; K37-A40 PolarHBondContact O-N 2.87Å; E38-A40 PolarHBondContact O-N 3.47Å; A40-E43 PolarHBondContact O-N 3.49Å; A40-I44 WeakPolarHBondContact O-CD1 3.35Å; A40-I44 VanDerWaalsContact O-CG1 3.23Å; A40-I44 WeakPolarHBondContact O-CG1 3.33Å; A40-I44 PolarHBondContact O-N 2.92Å
41	M	97.1	Very high	97.4	Very high	104 Å²	104	116.2 Å²	116.2	51%	0.512	55%	0.546	S	S	.	.	H	α-helix	trans	-64.9	-42.2	175.9	-76	-179.2	67.2	0	0	111.6	K37 E38 E39 E43 I44 D45	K37-M41 HydrophobicContact CG-SD 4.4Å; K37-M41 WeakPolarHBondContact O-CG 3.49Å; K37-M41 PolarHBondContact O-N 2.98Å; E38-M41 PolarHBondContact O-N 2.91Å; E39-M41 VanDerWaalsContact C-N 3.34Å; E39-M41 PolarHBondContact O-N 3.38Å; M41-E43 VanDerWaalsContact C-N 3.35Å; M41-E43 PolarHBondContact O-N 3.32Å; M41-I44 PolarHBondContact O-N 2.92Å; M41-D45 PolarHBondContact O-N 2.69Å
42	V	98	Very high	97.4	Very high	80 Å²	80	112.5 Å²	112.5	49%	0.485	53%	0.533	S	S	.	.	H	α-helix	trans	-61.7	-44	176.4	170.7	0	0	0	0	111	E38 E39 D45 Q46	E38-V42 WeakPolarHBondContact O-CG2 3.32Å; E38-V42 PolarHBondContact O-N 3.48Å; E39-V42 PolarHBondContact O-N 2.85Å; V42-D45 PolarHBondContact O-N 3.05Å; V42-Q46 HydrophobicContact CG1-CG 4.43Å; V42-Q46 WeakPolarHBondContact O-CB 3.26Å; V42-Q46 VanDerWaalsContact O-CG 3.28Å; V42-Q46 WeakPolarHBondContact O-CG 3.3Å; V42-Q46 PolarHBondContact O-N 3.26Å
43	E	97.3	Very high	97.4	Very high	138 Å²	138	113 Å²	113	65%	0.645	54%	0.539	S	S	*	.	H	α-helix	trans	-63.9	-42	178.2	-171.1	175.2	-178.7	0	0	112	E39 A40 M41 Q46 Y47	E39-E43 PolarHBondContact O-N 3.42Å; A40-E43 PolarHBondContact O-N 3.49Å; M41-E43 VanDerWaalsContact C-N 3.35Å; M41-E43 PolarHBondContact O-N 3.32Å; E43-Q46 PolarHBondContact O-N 3Å; E43-Y47 WeakPolarHBondContact O-CB 3.45Å; E43-Y47 PolarHBondContact O-N 3.46Å
44	I	97.5	Very high	97.4	Very high	112 Å²	112	110.9 Å²	110.9	57%	0.574	53%	0.527	S	S	*	.	H	α-helix	trans	-61.1	-46.2	175.4	-71.3	164.7	0	0	0	111.1	A40 M41 Y47 R48	A40-I44 WeakPolarHBondContact O-CD1 3.35Å; A40-I44 VanDerWaalsContact O-CG1 3.23Å; A40-I44 WeakPolarHBondContact O-CG1 3.33Å; A40-I44 PolarHBondContact O-N 2.92Å; M41-I44 PolarHBondContact O-N 2.92Å; I44-Y47 PolarHBondContact O-N 3.01Å; I44-R48 WeakPolarHBondContact O-CB 3.44Å; I44-R48 PolarHBondContact O-N 3.5Å
45	D	97.6	Very high	97.3	Very high	80 Å²	80	110 Å²	110	43%	0.428	52%	0.523	S	S	.	.	H	α-helix	trans	-66.3	-40	-180	-81.3	-22.5	0	0	0	111.7	M41 V42 R48 M49	M41-D45 PolarHBondContact O-N 2.69Å; V42-D45 PolarHBondContact O-N 3.05Å; D45-R48 PolarHBondContact O-N 2.98Å; D45-R48 IonicContact OD1-NH1 2.78Å; D45-M49 WeakPolarHBondContact O-CG 3.23Å; D45-M49 PolarHBondContact O-N 3.35Å
46	Q	97.8	Very high	97.2	Very high	123 Å²	123	114 Å²	114	58%	0.575	53%	0.534	S	S	*	.	H	α-helix	trans	-60.7	-46.8	173.7	-75.2	177.2	6	0	0	111.7	V42 E43 R48 M49 Q50	V42-Q46 HydrophobicContact CG1-CG 4.43Å; V42-Q46 WeakPolarHBondContact O-CB 3.26Å; V42-Q46 VanDerWaalsContact O-CG 3.28Å; V42-Q46 WeakPolarHBondContact O-CG 3.3Å; V42-Q46 PolarHBondContact O-N 3.26Å; E43-Q46 PolarHBondContact O-N 3Å; Q46-R48 VanDerWaalsContact C-N 3.33Å; Q46-R48 PolarHBondContact O-N 3.44Å; Q46-M49 PolarHBondContact O-N 3.3Å; Q46-Q50 WeakPolarHBondContact O-CB 3.48Å; Q46-Q50 PolarHBondContact O-N 3Å
47	Y	97.9	Very high	97	Very high	146 Å²	146	117.1 Å²	117.1	57%	0.573	54%	0.543	S	S	*	.	H	α-helix	trans	-61.3	-43.7	177	-177.5	-105.4	0	0	0	111.3	E43 I44 M49 Q50 R51	E43-Y47 WeakPolarHBondContact O-CB 3.45Å; E43-Y47 PolarHBondContact O-N 3.46Å; I44-Y47 PolarHBondContact O-N 3.01Å; Y47-M49 PolarHBondContact O-N 2.73Å; Y47-Q50 PolarHBondContact O-N 3.17Å; Y47-R51 HydrophobicContact CD1-CG 4.11Å; Y47-R51 HydrophobicContact CD2-CG 4.35Å; Y47-R51 HydrophobicContact CE1-CG 3.71Å; Y47-R51 HydrophobicContact CE2-CG 3.97Å; Y47-R51 HydrophobicContact CG-CG 4.42Å; Y47-R51 VanDerWaalsContact O-CG 3.3Å; Y47-R51 WeakPolarHBondContact O-CG 3.38Å; Y47-R51 PolarHBondContact O-N 3.18Å
48	R	97.8	Very high	96.8	Very high	153 Å²	153	115.1 Å²	115.1	58%	0.577	54%	0.538	S	S	*	.	H	α-helix	trans	-59.6	-47.8	176.5	-166.5	-176.8	111.1	-157.9	6.6	111.6	I44 D45 Q46 Q50 R51 D52	I44-R48 WeakPolarHBondContact O-CB 3.44Å; I44-R48 PolarHBondContact O-N 3.5Å; D45-R48 PolarHBondContact O-N 2.98Å; D45-R48 IonicContact OD1-NH1 2.78Å; Q46-R48 VanDerWaalsContact C-N 3.33Å; Q46-R48 PolarHBondContact O-N 3.44Å; R48-Q50 VanDerWaalsContact C-N 3.32Å; R48-Q50 PolarHBondContact O-N 3.44Å; R48-R51 PolarHBondContact O-N 3.5Å; R48-D52 WeakPolarHBondContact O-CB 3.47Å; R48-D52 PolarHBondContact O-N 2.9Å
49	M	97.6	Very high	96.5	Very high	137 Å²	137	113.6 Å²	113.6	68%	0.675	53%	0.531	S	S	*	.	H	α-helix	trans	-60.5	-40.7	177.3	-73.6	179.1	68.2	0	0	112.3	D45 Q46 Y47 K53	D45-M49 WeakPolarHBondContact O-CG 3.23Å; D45-M49 PolarHBondContact O-N 3.35Å; Q46-M49 PolarHBondContact O-N 3.3Å; Y47-M49 PolarHBondContact O-N 2.73Å; M49-K53 WeakPolarHBondContact O-CB 3.32Å; M49-K53 PolarHBondContact O-N 3.29Å
50	Q	97.4	Very high	96.1	Very high	109 Å²	109	111.6 Å²	111.6	51%	0.509	53%	0.529	S	S	.	.	H	α-helix	trans	-63.9	-47.2	177	-177	175.5	-6.8	0	0	111.4	Q46 Y47 R48 K53 E54	Q46-Q50 WeakPolarHBondContact O-CB 3.48Å; Q46-Q50 PolarHBondContact O-N 3Å; Y47-Q50 PolarHBondContact O-N 3.17Å; R48-Q50 VanDerWaalsContact C-N 3.32Å; R48-Q50 PolarHBondContact O-N 3.44Å; Q50-K53 WeakPolarHBondContact O-CB 3.37Å; Q50-K53 PolarHBondContact O-N 3.02Å; Q50-E54 PolarHBondContact NE2-OE1 2.88Å; Q50-E54 WeakPolarHBondContact O-CG 3.45Å; Q50-E54 PolarHBondContact O-N 3.48Å
51	R	97.6	Very high	95.7	Very high	126 Å²	126	117.3 Å²	117.3	48%	0.475	55%	0.545	S	S	.	.	H	α-helix	trans	-64.8	-39.9	178.5	-66.3	-60.5	-65.3	172.2	-9.8	112.4	Y47 R48 K53 E54 F55	Y47-R51 HydrophobicContact CD1-CG 4.11Å; Y47-R51 HydrophobicContact CD2-CG 4.35Å; Y47-R51 HydrophobicContact CE1-CG 3.71Å; Y47-R51 HydrophobicContact CE2-CG 3.97Å; Y47-R51 HydrophobicContact CG-CG 4.42Å; Y47-R51 VanDerWaalsContact O-CG 3.3Å; Y47-R51 WeakPolarHBondContact O-CG 3.38Å; Y47-R51 PolarHBondContact O-N 3.18Å; R48-R51 PolarHBondContact O-N 3.5Å; R51-K53 VanDerWaalsContact C-N 3.31Å; R51-K53 PolarHBondContact O-N 3.49Å; R51-E54 IonicContact CZ-OE2 3.74Å; R51-E54 IonicContact NE-OE2 3.66Å; R51-E54 IonicContact NH1-OE2 2.94Å; R51-E54 PolarHBondContact NH1-OE2 2.97Å; R51-E54 PolarHBondContact O-N 3.28Å; R51-F55 VanDerWaalsContact O-CB 3.3Å; R51-F55 WeakPolarHBondContact O-CB 3.31Å; R51-F55 PolarHBondContact O-N 3.27Å
52	D	96.9	Very high	95.1	Very high	72 Å²	72	117.1 Å²	117.1	39%	0.385	55%	0.545	S	S	.	.	H	α-helix	trans	-63.5	-38.7	174.7	-76.3	-12.7	0	0	0	111.4	R48 R56	R48-D52 WeakPolarHBondContact O-CB 3.47Å; R48-D52 PolarHBondContact O-N 2.9Å; D52-R56 WeakPolarHBondContact O-CB 3.34Å; D52-R56 VanDerWaalsContact O-CG 3.3Å; D52-R56 WeakPolarHBondContact O-CG 3.3Å; D52-R56 PolarHBondContact O-N 3.45Å
53	K	97.1	Very high	94.4	Very high	164 Å²	164	119.4 Å²	119.4	71%	0.713	55%	0.552	S	S	*	*	H	α-helix	trans	-66.3	-46.2	175.8	-174.5	-178.6	178.6	-176.4	0	111.7	M49 Q50 R51 F55 R56 L57	M49-K53 WeakPolarHBondContact O-CB 3.32Å; M49-K53 PolarHBondContact O-N 3.29Å; Q50-K53 WeakPolarHBondContact O-CB 3.37Å; Q50-K53 PolarHBondContact O-N 3.02Å; R51-K53 VanDerWaalsContact C-N 3.31Å; R51-K53 PolarHBondContact O-N 3.49Å; K53-F55 VanDerWaalsContact C-N 3.34Å; K53-R56 PolarHBondContact O-N 3.04Å; K53-L57 WeakPolarHBondContact O-CB 3.39Å; K53-L57 PolarHBondContact O-N 3.01Å
54	E	96.4	Very high	93.5	Very high	68 Å²	68	114.7 Å²	114.7	32%	0.318	54%	0.541	S	S	.	.	H	α-helix	trans	-59.9	-45.1	175.2	-74.3	171.6	-168.2	0	0	111.1	Q50 R51 L57 I58	Q50-E54 PolarHBondContact NE2-OE1 2.88Å; Q50-E54 WeakPolarHBondContact O-CG 3.45Å; Q50-E54 PolarHBondContact O-N 3.48Å; R51-E54 IonicContact CZ-OE2 3.74Å; R51-E54 IonicContact NE-OE2 3.66Å; R51-E54 IonicContact NH1-OE2 2.94Å; R51-E54 PolarHBondContact NH1-OE2 2.97Å; R51-E54 PolarHBondContact O-N 3.28Å; E54-L57 PolarHBondContact O-N 2.9Å; E54-I58 WeakPolarHBondContact O-CG1 3.45Å; E54-I58 PolarHBondContact O-N 3.3Å
55	F	95.7	Very high	92.5	Very high	129 Å²	129	112.2 Å²	112.2	57%	0.566	53%	0.533	S	S	*	.	H	α-helix	trans	-59.2	-49.1	176.8	178	-97.1	0	0	0	111.7	R51 K53 L57 I58 Q59	R51-F55 VanDerWaalsContact O-CB 3.3Å; R51-F55 WeakPolarHBondContact O-CB 3.31Å; R51-F55 PolarHBondContact O-N 3.27Å; K53-F55 VanDerWaalsContact C-N 3.34Å; F55-L57 VanDerWaalsContact C-N 3.31Å; F55-L57 PolarHBondContact O-N 3.39Å; F55-I58 PolarHBondContact O-N 2.88Å; F55-Q59 WeakPolarHBondContact O-CB 3.46Å; F55-Q59 PolarHBondContact O-N 3.14Å
56	R	95.4	Very high	91.5	Very high	173 Å²	173	114.9 Å²	114.9	65%	0.653	54%	0.543	S	S	*	.	H	α-helix	trans	-62	-37.2	177.8	-73.9	178.8	-169.9	-169.3	4	112.6	D52 K53 Q59 S60	D52-R56 WeakPolarHBondContact O-CB 3.34Å; D52-R56 VanDerWaalsContact O-CG 3.3Å; D52-R56 WeakPolarHBondContact O-CG 3.3Å; D52-R56 PolarHBondContact O-N 3.45Å; K53-R56 PolarHBondContact O-N 3.04Å; R56-Q59 PolarHBondContact O-N 3.39Å; R56-S60 WeakPolarHBondContact O-CB 3.3Å; R56-S60 PolarHBondContact O-N 3.47Å; R56-S60 PolarHBondContact O-OG 2.85Å
57	L	93.8	Very high	90.5	Very high	120 Å²	120	112.2 Å²	112.2	63%	0.628	54%	0.538	S	S	*	.	H	α-helix	trans	-66.1	-43.2	176.6	-177.7	69.3	0	0	0	111.7	K53 E54 F55 S60 K61	K53-L57 WeakPolarHBondContact O-CB 3.39Å; K53-L57 PolarHBondContact O-N 3.01Å; E54-L57 PolarHBondContact O-N 2.9Å; F55-L57 VanDerWaalsContact C-N 3.31Å; F55-L57 PolarHBondContact O-N 3.39Å; L57-S60 PolarHBondContact O-OG 3.22Å; L57-K61 WeakPolarHBondContact O-CB 3.48Å; L57-K61 PolarHBondContact O-N 2.96Å
58	I	92.6	Very high	89.8	Confident	102 Å²	102	110.5 Å²	110.5	52%	0.523	54%	0.539	S	S	.	.	H	α-helix	trans	-65.3	-44.5	176.1	-67.5	166.2	0	0	0	109.7	E54 F55 S60 K61 I62	E54-I58 WeakPolarHBondContact O-CG1 3.45Å; E54-I58 PolarHBondContact O-N 3.3Å; F55-I58 PolarHBondContact O-N 2.88Å; I58-S60 PolarHBondContact O-N 2.72Å; I58-K61 PolarHBondContact O-N 3.23Å; I58-I62 HydrophobicContact CG2-CD1 3.67Å; I58-I62 HydrophobicContact CG2-CG1 4.34Å; I58-I62 VanDerWaalsContact O-CG1 3.3Å; I58-I62 WeakPolarHBondContact O-CG1 3.33Å; I58-I62 PolarHBondContact O-N 3.39Å
59	Q	89.9	Confident	89.2	Confident	94 Å²	94	107.9 Å²	107.9	44%	0.439	54%	0.536	S	S	.	.	H	α-helix	trans	-59	-48.1	177.8	-174.4	-178.8	42.3	0	0	111.6	F55 R56 K61 I62 M63	F55-Q59 WeakPolarHBondContact O-CB 3.46Å; F55-Q59 PolarHBondContact O-N 3.14Å; R56-Q59 PolarHBondContact O-N 3.39Å; Q59-K61 VanDerWaalsContact C-N 3.33Å; Q59-K61 PolarHBondContact O-N 2.93Å; Q59-I62 PolarHBondContact O-N 2.84Å; Q59-M63 HydrophobicContact CG-CG 4.48Å; Q59-M63 HydrophobicContact CG-SD 4.05Å; Q59-M63 WeakPolarHBondContact O-CB 3.5Å; Q59-M63 WeakPolarHBondContact O-CG 3.44Å; Q59-M63 PolarHBondContact O-N 2.98Å
60	S	89.1	Confident	88.7	Confident	68 Å²	68	104.7 Å²	104.7	48%	0.476	53%	0.527	S	S	.	.	H	α-helix	trans	-64.7	-38.1	178.9	67.8	0	0	0	0	112.2	R56 L57 I58 G64	R56-S60 WeakPolarHBondContact O-CB 3.3Å; R56-S60 PolarHBondContact O-N 3.47Å; R56-S60 PolarHBondContact O-OG 2.85Å; L57-S60 PolarHBondContact O-OG 3.22Å; I58-S60 PolarHBondContact O-N 2.72Å; S60-G64 PolarHBondContact O-N 2.89Å
61	K	88.7	Confident	88.3	Confident	165 Å²	165	103.5 Å²	103.5	72%	0.717	52%	0.524	S	S	*	.	H	α-helix	trans	-63.2	-44.6	174.5	-174.6	176.9	-179.9	-178.2	0	111.8	L57 I58 Q59 G64 S65	L57-K61 WeakPolarHBondContact O-CB 3.48Å; L57-K61 PolarHBondContact O-N 2.96Å; I58-K61 PolarHBondContact O-N 3.23Å; Q59-K61 VanDerWaalsContact C-N 3.33Å; Q59-K61 PolarHBondContact O-N 2.93Å; K61-G64 PolarHBondContact O-N 3.39Å; K61-S65 VanDerWaalsContact O-CB 3.31Å; K61-S65 WeakPolarHBondContact O-CB 3.38Å; K61-S65 PolarHBondContact O-N 3.33Å; K61-S65 PolarHBondContact O-OG 3.26Å
62	I	85.8	Confident	88.1	Confident	101 Å²	101	102.6 Å²	102.6	52%	0.518	53%	0.525	S	S	.	.	H	α-helix	trans	-64.7	-49.5	178.6	-68.6	169.5	0	0	0	110.2	I58 Q59 G64 S65 Q66	I58-I62 HydrophobicContact CG2-CD1 3.67Å; I58-I62 HydrophobicContact CG2-CG1 4.34Å; I58-I62 VanDerWaalsContact O-CG1 3.3Å; I58-I62 WeakPolarHBondContact O-CG1 3.33Å; I58-I62 PolarHBondContact O-N 3.39Å; Q59-I62 PolarHBondContact O-N 2.84Å; I62-G64 VanDerWaalsContact C-N 3.32Å; I62-G64 PolarHBondContact O-N 3.27Å; I62-S65 WeakPolarHBondContact CA-OG 3.3Å; I62-S65 PolarHBondContact O-N 3.46Å; I62-S65 VanDerWaalsContact O-N 3.14Å; I62-S65 PolarHBondContact O-OG 3.48Å; I62-Q66 PolarHBondContact O-N 3.36Å
63	M	82	Confident	87.9	Confident	127 Å²	127	103.4 Å²	103.4	63%	0.626	53%	0.529	S	S	*	.	H	α-helix	trans	-60.6	-40.6	178.4	-70.6	-178	70.9	0	0	112.1	Q59 Q66	Q59-M63 HydrophobicContact CG-CG 4.48Å; Q59-M63 HydrophobicContact CG-SD 4.05Å; Q59-M63 WeakPolarHBondContact O-CB 3.5Å; Q59-M63 WeakPolarHBondContact O-CG 3.44Å; Q59-M63 PolarHBondContact O-N 2.98Å; M63-Q66 PolarHBondContact O-N 2.92Å
64	G	80.1	Confident	87.9	Confident	40 Å²	40	101 Å²	101	41%	0.412	52%	0.52	S	S	.	.	H	α-helix	trans	-66.2	-39.4	174	0	0	0	0	0	113	S60 K61 I62 Q66 S67	S60-G64 PolarHBondContact O-N 2.89Å; K61-G64 PolarHBondContact O-N 3.39Å; I62-G64 VanDerWaalsContact C-N 3.32Å; I62-G64 PolarHBondContact O-N 3.27Å; G64-Q66 VanDerWaalsContact C-N 3.31Å; G64-Q66 PolarHBondContact O-N 2.95Å; G64-S67 PolarHBondContact O-N 3.46Å
65	S	76	Confident	87.9	Confident	59 Å²	59	104.8 Å²	104.8	41%	0.413	54%	0.538	S	S	.	.	H	α-helix	trans	-69.9	-26.3	178.9	66.1	0	0	0	0	113.9	K61 I62 S67 N68 L69	K61-S65 VanDerWaalsContact O-CB 3.31Å; K61-S65 WeakPolarHBondContact O-CB 3.38Å; K61-S65 PolarHBondContact O-N 3.33Å; K61-S65 PolarHBondContact O-OG 3.26Å; I62-S65 WeakPolarHBondContact CA-OG 3.3Å; I62-S65 PolarHBondContact O-N 3.46Å; I62-S65 VanDerWaalsContact O-N 3.14Å; I62-S65 PolarHBondContact O-OG 3.48Å; S65-S67 VanDerWaalsContact C-N 3.3Å; S65-S67 PolarHBondContact O-N 2.9Å; S65-N68 PolarHBondContact O-N 2.93Å; S65-L69 PolarHBondContact O-N 3.41Å
66	Q	76.7	Confident	87.9	Confident	136 Å²	136	104.6 Å²	104.6	64%	0.636	54%	0.539	S	S	*	.	H	α-helix	trans	-66.1	-34.1	179.7	-168.8	177.7	-0	0	0	112	I62 M63 G64 S70	I62-Q66 PolarHBondContact O-N 3.36Å; M63-Q66 PolarHBondContact O-N 2.92Å; G64-Q66 VanDerWaalsContact C-N 3.31Å; G64-Q66 PolarHBondContact O-N 2.95Å; Q66-S70 PolarHBondContact O-N 3.32Å
67	S	76.9	Confident	88	Confident	67 Å²	67	99.8 Å²	99.8	47%	0.469	53%	0.528	S	S	.	.	H	α-helix	trans	-63.9	-51.4	173.8	-164.7	0	0	0	0	110.7	G64 S65 L69 S70 D71	G64-S67 PolarHBondContact O-N 3.46Å; S65-S67 VanDerWaalsContact C-N 3.3Å; S65-S67 PolarHBondContact O-N 2.9Å; S67-L69 VanDerWaalsContact C-N 3.27Å; S67-L69 PolarHBondContact O-N 2.91Å; S67-S70 WeakPolarHBondContact O-CB 3.44Å; S67-S70 PolarHBondContact O-N 3Å; S67-D71 PolarHBondContact O-N 3.44Å
68	N	82.9	Confident	88.2	Confident	110 Å²	110	98.2 Å²	98.2	59%	0.588	52%	0.52	S	S	*	.	H	α-helix	trans	-59.7	-38	-178.8	-60.4	-11.8	0	0	0	112.4	S65 D71 E72	S65-N68 PolarHBondContact O-N 2.93Å; N68-D71 PolarHBondContact O-N 2.87Å; N68-E72 WeakPolarHBondContact O-CB 3.3Å; N68-E72 PolarHBondContact O-N 3.29Å
69	L	84.8	Confident	88.4	Confident	98 Å²	98	95 Å²	95	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-65.4	-39.8	176.1	178.7	63.7	0	0	0	111.8	S65 S67 I73	S65-L69 PolarHBondContact O-N 3.41Å; S67-L69 VanDerWaalsContact C-N 3.27Å; S67-L69 PolarHBondContact O-N 2.91Å; L69-I73 HydrophobicContact CD1-CD1 4.07Å; L69-I73 HydrophobicContact CD1-CG1 4.32Å; L69-I73 HydrophobicContact CG-CD1 3.92Å; L69-I73 WeakPolarHBondContact O-CB 3.47Å; L69-I73 VanDerWaalsContact O-CG1 3.23Å; L69-I73 WeakPolarHBondContact O-CG1 3.44Å; L69-I73 PolarHBondContact O-N 2.98Å
70	S	86.8	Confident	88.8	Confident	70 Å²	70	95.5 Å²	95.5	49%	0.49	51%	0.513	S	S	.	.	H	α-helix	trans	-63.6	-44.6	176.8	-168.1	0	0	0	0	111.2	Q66 S67 I73 E74	Q66-S70 PolarHBondContact O-N 3.32Å; S67-S70 WeakPolarHBondContact O-CB 3.44Å; S67-S70 PolarHBondContact O-N 3Å; S70-I73 PolarHBondContact O-N 3.36Å; S70-E74 WeakPolarHBondContact O-CB 3.42Å; S70-E74 PolarHBondContact O-N 3.01Å
71	D	89.9	Confident	89.2	Confident	85 Å²	85	96.2 Å²	96.2	46%	0.455	51%	0.511	S	S	.	.	H	α-helix	trans	-63.6	-42.3	179.3	-59.9	-28.1	0	0	0	111.1	S67 N68 E74 E75	S67-D71 PolarHBondContact O-N 3.44Å; N68-D71 PolarHBondContact O-N 2.87Å; D71-E74 PolarHBondContact O-N 3.4Å; D71-E75 PolarHBondContact O-N 3.5Å
72	E	91.8	Very high	89.7	Confident	106 Å²	106	95.1 Å²	95.1	50%	0.495	51%	0.508	S	S	.	.	H	α-helix	trans	-64.7	-41.2	176.2	-173.6	179	177.5	0	0	112.1	N68 E74 E75 Q76	N68-E72 WeakPolarHBondContact O-CB 3.3Å; N68-E72 PolarHBondContact O-N 3.29Å; E72-E74 VanDerWaalsContact C-N 3.34Å; E72-E75 PolarHBondContact O-N 3.26Å; E72-Q76 WeakPolarHBondContact O-CB 3.28Å; E72-Q76 WeakPolarHBondContact O-CG 3.45Å; E72-Q76 PolarHBondContact O-N 3.43Å
73	I	94.3	Very high	90.2	Very high	90 Å²	90	94.6 Å²	94.6	46%	0.462	50%	0.504	S	S	.	.	H	α-helix	trans	-63.6	-41.8	175.2	-71.5	167.9	0	0	0	110.6	L69 S70 Q76 T77	L69-I73 HydrophobicContact CD1-CD1 4.07Å; L69-I73 HydrophobicContact CD1-CG1 4.32Å; L69-I73 HydrophobicContact CG-CD1 3.92Å; L69-I73 WeakPolarHBondContact O-CB 3.47Å; L69-I73 VanDerWaalsContact O-CG1 3.23Å; L69-I73 WeakPolarHBondContact O-CG1 3.44Å; L69-I73 PolarHBondContact O-N 2.98Å; S70-I73 PolarHBondContact O-N 3.36Å; I73-Q76 PolarHBondContact O-N 2.93Å; I73-T77 VanDerWaalsContact O-CB 3.26Å; I73-T77 WeakPolarHBondContact O-CB 3.33Å; I73-T77 PolarHBondContact O-N 2.98Å; I73-T77 PolarHBondContact O-OG1 3.15Å
74	E	95.9	Very high	91	Very high	113 Å²	113	93.5 Å²	93.5	53%	0.528	50%	0.5	S	S	.	.	H	α-helix	trans	-64	-45.7	178	-172.5	171.4	-177.4	0	0	111	S70 D71 E72 Q76 T77 L78	S70-E74 WeakPolarHBondContact O-CB 3.42Å; S70-E74 PolarHBondContact O-N 3.01Å; D71-E74 PolarHBondContact O-N 3.4Å; E72-E74 VanDerWaalsContact C-N 3.34Å; E74-Q76 PolarHBondContact O-N 3.36Å; E74-T77 PolarHBondContact O-N 3.49Å; E74-L78 HydrophobicContact CG-CD1 4.1Å; E74-L78 HydrophobicContact CG-CG 4.41Å; E74-L78 WeakPolarHBondContact O-CB 3.23Å; E74-L78 VanDerWaalsContact O-CG 3.3Å; E74-L78 WeakPolarHBondContact O-CG 3.43Å; E74-L78 PolarHBondContact O-N 3.14Å
75	E	96.6	Very high	91.8	Very high	147 Å²	147	95.8 Å²	95.8	69%	0.687	50%	0.502	S	S	*	.	H	α-helix	trans	-58.5	-48.7	175.9	-173.4	-179.7	178.8	0	0	111.8	D71 E72 T77 L78 G79	D71-E75 PolarHBondContact O-N 3.5Å; E72-E75 PolarHBondContact O-N 3.26Å; E75-T77 VanDerWaalsContact C-N 3.32Å; E75-T77 PolarHBondContact O-N 2.93Å; E75-L78 PolarHBondContact O-N 3.3Å; E75-G79 PolarHBondContact O-N 3.06Å
76	Q	96.9	Very high	92.8	Very high	126 Å²	126	94.9 Å²	94.9	59%	0.589	50%	0.502	S	S	*	.	H	α-helix	trans	-62.1	-40.2	176.8	-72.4	-177.9	11.2	0	0	112	E72 I73 E74 G79 K80	E72-Q76 WeakPolarHBondContact O-CB 3.28Å; E72-Q76 WeakPolarHBondContact O-CG 3.45Å; E72-Q76 PolarHBondContact O-N 3.43Å; I73-Q76 PolarHBondContact O-N 2.93Å; E74-Q76 PolarHBondContact O-N 3.36Å; Q76-G79 PolarHBondContact O-N 2.76Å; Q76-K80 WeakPolarHBondContact O-CB 3.37Å; Q76-K80 PolarHBondContact O-N 2.86Å
77	T	97.3	Very high	93.7	Very high	71 Å²	71	92.7 Å²	92.7	44%	0.436	49%	0.492	S	S	.	.	H	α-helix	trans	-65	-46.6	178.8	-60.6	0	0	0	0	110.8	I73 E74 E75 G79 K80 I81	I73-T77 VanDerWaalsContact O-CB 3.26Å; I73-T77 WeakPolarHBondContact O-CB 3.33Å; I73-T77 PolarHBondContact O-N 2.98Å; I73-T77 PolarHBondContact O-OG1 3.15Å; E74-T77 PolarHBondContact O-N 3.49Å; E75-T77 VanDerWaalsContact C-N 3.32Å; E75-T77 PolarHBondContact O-N 2.93Å; T77-G79 VanDerWaalsContact C-N 3.34Å; T77-G79 PolarHBondContact O-N 3.45Å; T77-K80 PolarHBondContact O-N 3.18Å; T77-I81 HydrophobicContact CG2-CD1 4.01Å; T77-I81 WeakPolarHBondContact O-CG1 3.2Å; T77-I81 PolarHBondContact O-N 2.96Å
78	L	97.4	Very high	94.6	Very high	88 Å²	88	96.1 Å²	96.1	46%	0.461	50%	0.496	S	S	.	.	H	α-helix	trans	-61.8	-42.9	176.5	-71.5	173.7	0	0	0	111.3	E74 E75 K80 I81 Q82	E74-L78 HydrophobicContact CG-CD1 4.1Å; E74-L78 HydrophobicContact CG-CG 4.41Å; E74-L78 WeakPolarHBondContact O-CB 3.23Å; E74-L78 VanDerWaalsContact O-CG 3.3Å; E74-L78 WeakPolarHBondContact O-CG 3.43Å; E74-L78 PolarHBondContact O-N 3.14Å; E75-L78 PolarHBondContact O-N 3.3Å; L78-K80 VanDerWaalsContact C-N 3.34Å; L78-K80 PolarHBondContact O-N 3.49Å; L78-I81 PolarHBondContact O-N 3.24Å; L78-Q82 WeakPolarHBondContact O-CG 3.43Å; L78-Q82 PolarHBondContact O-N 2.99Å
79	G	97.7	Very high	95.2	Very high	35 Å²	35	96 Å²	96	36%	0.361	50%	0.495	S	S	.	.	H	α-helix	trans	-58.4	-44.6	173.5	0	0	0	0	0	112.3	E75 Q76 T77 I81 Q82 E83	E75-G79 PolarHBondContact O-N 3.06Å; Q76-G79 PolarHBondContact O-N 2.76Å; T77-G79 VanDerWaalsContact C-N 3.34Å; T77-G79 PolarHBondContact O-N 3.45Å; G79-I81 PolarHBondContact O-N 2.92Å; G79-Q82 PolarHBondContact O-N 3.45Å; G79-E83 PolarHBondContact O-N 3.28Å
80	K	97.8	Very high	95.8	Very high	104 Å²	104	99 Å²	99	45%	0.452	50%	0.504	S	S	.	.	H	α-helix	trans	-66.5	-38.3	178.3	-162.4	72.8	-160.5	164	0	112.6	Q76 T77 L78 Q82 E83 L84	Q76-K80 WeakPolarHBondContact O-CB 3.37Å; Q76-K80 PolarHBondContact O-N 2.86Å; T77-K80 PolarHBondContact O-N 3.18Å; L78-K80 VanDerWaalsContact C-N 3.34Å; L78-K80 PolarHBondContact O-N 3.49Å; K80-Q82 VanDerWaalsContact C-N 3.35Å; K80-E83 WeakPolarHBondContact CD-OE2 3.37Å; K80-E83 WeakPolarHBondContact CE-OE2 3.35Å; K80-E83 IonicContact NZ-OE1 3.9Å; K80-E83 PolarHBondContact NZ-OE1 3.43Å; K80-E83 IonicContact NZ-OE2 3.98Å; K80-E83 PolarHBondContact NZ-OE2 3.47Å; K80-E83 PolarHBondContact O-N 3.49Å; K80-L84 WeakPolarHBondContact O-CB 3.31Å; K80-L84 WeakPolarHBondContact O-CG 3.47Å; K80-L84 PolarHBondContact O-N 3.02Å
81	I	97.6	Very high	96.3	Very high	82 Å²	82	100 Å²	100	42%	0.421	50%	0.501	S	S	.	.	H	α-helix	trans	-62.6	-43.9	174.4	-70.3	167	0	0	0	110.4	T77 L78 G79 L84 N85	T77-I81 HydrophobicContact CG2-CD1 4.01Å; T77-I81 WeakPolarHBondContact O-CG1 3.2Å; T77-I81 PolarHBondContact O-N 2.96Å; L78-I81 PolarHBondContact O-N 3.24Å; G79-I81 PolarHBondContact O-N 2.92Å; I81-L84 PolarHBondContact O-N 3.4Å; I81-N85 WeakPolarHBondContact CG2-ND2 3.48Å; I81-N85 WeakPolarHBondContact O-CB 3.49Å; I81-N85 PolarHBondContact O-N 3.06Å; I81-N85 PolarHBondContact O-ND2 3.5Å; I81-N85 VanDerWaalsContact O-ND2 3.11Å
82	Q	97.9	Very high	96.6	Very high	143 Å²	143	98.7 Å²	98.7	67%	0.668	49%	0.493	S	S	*	.	H	α-helix	trans	-62.3	-43.6	176.6	-72.5	177.3	3.3	0	0	111.8	L78 G79 K80 N85 G86	L78-Q82 WeakPolarHBondContact O-CG 3.43Å; L78-Q82 PolarHBondContact O-N 2.99Å; G79-Q82 PolarHBondContact O-N 3.45Å; K80-Q82 VanDerWaalsContact C-N 3.35Å; Q82-N85 PolarHBondContact O-N 3.08Å; Q82-G86 PolarHBondContact O-N 3.38Å
83	E	97.7	Very high	96.7	Very high	90 Å²	90	100.5 Å²	100.5	42%	0.421	50%	0.501	S	S	.	.	H	α-helix	trans	-60	-47.8	175.6	-168.6	-166.2	151.1	0	0	111.4	G79 K80 N85 G86 H87	G79-E83 PolarHBondContact O-N 3.28Å; K80-E83 WeakPolarHBondContact CD-OE2 3.37Å; K80-E83 WeakPolarHBondContact CE-OE2 3.35Å; K80-E83 IonicContact NZ-OE1 3.9Å; K80-E83 PolarHBondContact NZ-OE1 3.43Å; K80-E83 IonicContact NZ-OE2 3.98Å; K80-E83 PolarHBondContact NZ-OE2 3.47Å; K80-E83 PolarHBondContact O-N 3.49Å; E83-N85 PolarHBondContact O-N 2.99Å; E83-G86 WeakPolarHBondContact O-CA 3.36Å; E83-G86 PolarHBondContact O-N 3.3Å; E83-G86 VanDerWaalsContact O-N 3.14Å; E83-H87 PolarHBondContact O-CD2 2.91Å; E83-H87 PolarHBondContact O-N 2.93Å; E83-H87 IonicContact OE1-NE2 2.73Å
84	L	97.4	Very high	96.8	Very high	103 Å²	103	99.8 Å²	99.8	54%	0.539	50%	0.504	S	S	.	.	H	α-helix	trans	-59.8	-44.7	177.2	-76.2	171.7	0	0	0	112.2	K80 I81 G86 H87 Y88	K80-L84 WeakPolarHBondContact O-CB 3.31Å; K80-L84 WeakPolarHBondContact O-CG 3.47Å; K80-L84 PolarHBondContact O-N 3.02Å; I81-L84 PolarHBondContact O-N 3.4Å; L84-G86 VanDerWaalsContact C-N 3.3Å; L84-G86 PolarHBondContact O-N 2.93Å; L84-H87 PolarHBondContact O-N 3.32Å; L84-Y88 WeakPolarHBondContact O-CB 3.33Å; L84-Y88 PolarHBondContact O-N 3.34Å
85	N	97	Very high	96.9	Very high	88 Å²	88	98.5 Å²	98.5	47%	0.471	50%	0.503	S	S	.	.	H	α-helix	trans	-63.3	-38.4	175.4	-75.3	-39.1	0	0	0	111.6	I81 Q82 E83 Y88 N89	I81-N85 WeakPolarHBondContact CG2-ND2 3.48Å; I81-N85 WeakPolarHBondContact O-CB 3.49Å; I81-N85 PolarHBondContact O-N 3.06Å; I81-N85 PolarHBondContact O-ND2 3.5Å; I81-N85 VanDerWaalsContact O-ND2 3.11Å; Q82-N85 PolarHBondContact O-N 3.08Å; E83-N85 PolarHBondContact O-N 2.99Å; N85-Y88 PolarHBondContact O-N 3.46Å; N85-N89 WeakPolarHBondContact O-CB 3.37Å; N85-N89 VanDerWaalsContact O-CG 3.3Å; N85-N89 PolarHBondContact O-N 2.94Å; N85-N89 PolarHBondContact O-ND2 3.34Å; N85-N89 VanDerWaalsContact O-ND2 3.12Å
86	G	97.1	Very high	96.9	Very high	40 Å²	40	96.4 Å²	96.4	41%	0.412	50%	0.495	S	S	.	.	H	α-helix	trans	-60.2	-47.1	173.1	0	0	0	0	0	112.3	Q82 E83 L84 N89 K90	Q82-G86 PolarHBondContact O-N 3.38Å; E83-G86 WeakPolarHBondContact O-CA 3.36Å; E83-G86 PolarHBondContact O-N 3.3Å; E83-G86 VanDerWaalsContact O-N 3.14Å; L84-G86 VanDerWaalsContact C-N 3.3Å; L84-G86 PolarHBondContact O-N 2.93Å; G86-N89 PolarHBondContact O-N 3.27Å; G86-K90 VanDerWaalsContact O-CB 3.32Å; G86-K90 WeakPolarHBondContact O-CB 3.42Å; G86-K90 PolarHBondContact O-N 3.33Å
87	H	96.7	Very high	96.8	Very high	90 Å²	90	94.9 Å²	94.9	42%	0.417	49%	0.491	S	S	.	.	H	α-helix	trans	-61	-45.5	174.7	-78.1	-69.4	0	0	0	112.3	E83 L84 K90 H91	E83-H87 PolarHBondContact O-CD2 2.91Å; E83-H87 PolarHBondContact O-N 2.93Å; E83-H87 IonicContact OE1-NE2 2.73Å; L84-H87 PolarHBondContact O-N 3.32Å; H87-K90 PolarHBondContact O-N 3.49Å; H87-H91 PolarHBondContact O-CD2 3.26Å; H87-H91 PolarHBondContact O-N 2.89Å
88	Y	96.1	Very high	96.8	Very high	140 Å²	140	97.1 Å²	97.1	55%	0.549	50%	0.496	S	S	.	.	H	α-helix	trans	-56.6	-54.3	177.3	175.9	-102.7	0	0	0	111.1	L84 N85 K90 H91 M92	L84-Y88 WeakPolarHBondContact O-CB 3.33Å; L84-Y88 PolarHBondContact O-N 3.34Å; N85-Y88 PolarHBondContact O-N 3.46Å; Y88-K90 VanDerWaalsContact C-N 3.27Å; Y88-K90 PolarHBondContact O-N 2.87Å; Y88-H91 PolarHBondContact O-N 2.91Å; Y88-M92 HydrophobicContact CD1-CE 3.58Å; Y88-M92 HydrophobicContact CD1-SD 4.32Å; Y88-M92 HydrophobicContact CE1-CE 3.1Å; Y88-M92 HydrophobicContact CE1-SD 3.42Å; Y88-M92 WeakPolarHBondContact CE1-SD 3.46Å; Y88-M92 HydrophobicContact CE2-SD 4.12Å; Y88-M92 HydrophobicContact CG-CE 4.49Å; Y88-M92 WeakPolarHBondContact O-CB 3.35Å; Y88-M92 PolarHBondContact O-N 3.43Å; Y88-M92 PolarHBondContact OH-SD 2.99Å
89	N	95.6	Very high	96.7	Very high	107 Å²	107	97.2 Å²	97.2	57%	0.572	50%	0.497	S	S	*	.	H	α-helix	trans	-60.9	-36.5	-179.3	-69.7	-32.6	0	0	0	112.6	N85 G86	N85-N89 WeakPolarHBondContact O-CB 3.37Å; N85-N89 VanDerWaalsContact O-CG 3.3Å; N85-N89 PolarHBondContact O-N 2.94Å; N85-N89 PolarHBondContact O-ND2 3.34Å; N85-N89 VanDerWaalsContact O-ND2 3.12Å; G86-N89 PolarHBondContact O-N 3.27Å
90	K	96.7	Very high	96.6	Very high	162 Å²	162	100.4 Å²	100.4	70%	0.704	51%	0.505	S	S	*	.	H	α-helix	trans	-69	-37.5	179.1	-174.9	177.7	-178.9	-179.9	0	113.2	G86 H87 Y88	G86-K90 VanDerWaalsContact O-CB 3.32Å; G86-K90 WeakPolarHBondContact O-CB 3.42Å; G86-K90 PolarHBondContact O-N 3.33Å; H87-K90 PolarHBondContact O-N 3.49Å; Y88-K90 VanDerWaalsContact C-N 3.27Å; Y88-K90 PolarHBondContact O-N 2.87Å
91	H	96.1	Very high	96.5	Very high	91 Å²	91	99.3 Å²	99.3	42%	0.421	51%	0.511	S	S	.	.	H	α-helix	trans	-102.8	-16.5	-171.3	-65.1	-63.9	0	0	0	113.9	H87 Y88 E93 S94 V95	H87-H91 PolarHBondContact O-CD2 3.26Å; H87-H91 PolarHBondContact O-N 2.89Å; Y88-H91 PolarHBondContact O-N 2.91Å; H91-E93 PolarHBondContact O-N 2.78Å; H91-S94 PolarHBondContact O-N 2.91Å; H91-V95 WeakPolarHBondContact O-CG2 3.48Å; H91-V95 PolarHBondContact O-N 2.89Å
92	M	96.1	Very high	96.3	Very high	57 Å²	57	100.8 Å²	100.8	28%	0.281	52%	0.517	S	S	.	.	H	α-helix	trans	-53.8	-47.9	-175.7	169.1	162.7	36.5	0	0	113.1	Y88 S94 V95 M96	Y88-M92 HydrophobicContact CD1-CE 3.58Å; Y88-M92 HydrophobicContact CD1-SD 4.32Å; Y88-M92 HydrophobicContact CE1-CE 3.1Å; Y88-M92 HydrophobicContact CE1-SD 3.42Å; Y88-M92 WeakPolarHBondContact CE1-SD 3.46Å; Y88-M92 HydrophobicContact CE2-SD 4.12Å; Y88-M92 HydrophobicContact CG-CE 4.49Å; Y88-M92 WeakPolarHBondContact O-CB 3.35Å; Y88-M92 PolarHBondContact O-N 3.43Å; Y88-M92 PolarHBondContact OH-SD 2.99Å; M92-S94 PolarHBondContact O-N 3.25Å; M92-V95 PolarHBondContact O-N 2.95Å; M92-M96 HydrophobicContact CG-CG 4.46Å; M92-M96 WeakPolarHBondContact O-CB 3.45Å; M92-M96 VanDerWaalsContact O-CG 3.32Å; M92-M96 WeakPolarHBondContact O-CG 3.37Å; M92-M96 PolarHBondContact O-N 3.43Å
93	E	95.4	Very high	96.1	Very high	144 Å²	144	98.9 Å²	98.9	67%	0.673	52%	0.515	S	S	*	.	H	α-helix	trans	-64.2	-43.1	-179.3	-170.2	178.2	-178.8	0	0	112	H91 V95 M96 N97	H91-E93 PolarHBondContact O-N 2.78Å; E93-V95 PolarHBondContact O-N 3.34Å; E93-M96 PolarHBondContact O-N 3.43Å; E93-N97 WeakPolarHBondContact O-CB 3.5Å; E93-N97 VanDerWaalsContact O-CG 3.24Å; E93-N97 PolarHBondContact O-N 3.02Å; E93-N97 PolarHBondContact O-ND2 2.92Å
94	S	96.9	Very high	95.8	Very high	75 Å²	75	99.4 Å²	99.4	52%	0.524	53%	0.528	S	S	.	.	H	α-helix	trans	-61.2	-44	177.2	-175.5	0	0	0	0	112	H91 M92 Q98	H91-S94 PolarHBondContact O-N 2.91Å; M92-S94 PolarHBondContact O-N 3.25Å; S94-Q98 WeakPolarHBondContact O-CB 3.43Å; S94-Q98 PolarHBondContact O-N 3.41Å
95	V	96.8	Very high	95.6	Very high	85 Å²	85	98.6 Å²	98.6	52%	0.515	52%	0.524	S	S	.	.	H	α-helix	trans	-69	-41.5	179.9	174.4	0	0	0	0	110.7	H91 M92 E93 Q98 L99	H91-V95 WeakPolarHBondContact O-CG2 3.48Å; H91-V95 PolarHBondContact O-N 2.89Å; M92-V95 PolarHBondContact O-N 2.95Å; E93-V95 PolarHBondContact O-N 3.34Å; V95-Q98 PolarHBondContact O-N 3.19Å; V95-L99 WeakPolarHBondContact O-CB 3.38Å; V95-L99 PolarHBondContact O-N 3.25Å
96	M	95.9	Very high	95.1	Very high	103 Å²	103	102.2 Å²	102.2	51%	0.507	54%	0.54	S	S	.	.	H	α-helix	trans	-60.5	-46.5	175.6	-78.3	-63.1	-157.2	0	0	111.7	M92 E93 Q98 L99 L100	M92-M96 HydrophobicContact CG-CG 4.46Å; M92-M96 WeakPolarHBondContact O-CB 3.45Å; M92-M96 VanDerWaalsContact O-CG 3.32Å; M92-M96 WeakPolarHBondContact O-CG 3.37Å; M92-M96 PolarHBondContact O-N 3.43Å; E93-M96 PolarHBondContact O-N 3.43Å; M96-Q98 VanDerWaalsContact C-N 3.33Å; M96-Q98 PolarHBondContact O-N 2.89Å; M96-L99 PolarHBondContact O-N 3.09Å; M96-L100 WeakPolarHBondContact O-CB 3.39Å; M96-L100 VanDerWaalsContact O-CG 3.3Å; M96-L100 WeakPolarHBondContact O-CG 3.44Å; M96-L100 PolarHBondContact O-N 2.94Å
97	N	96.1	Very high	94.6	Very high	95 Å²	95	107.1 Å²	107.1	51%	0.508	55%	0.55	S	S	.	.	H	α-helix	trans	-62.1	-42.2	178.2	-72.4	-22.8	0	0	0	111.7	E93 S101	E93-N97 WeakPolarHBondContact O-CB 3.5Å; E93-N97 VanDerWaalsContact O-CG 3.24Å; E93-N97 PolarHBondContact O-N 3.02Å; E93-N97 PolarHBondContact O-ND2 2.92Å; N97-S101 VanDerWaalsContact O-CB 3.24Å; N97-S101 WeakPolarHBondContact O-CB 3.45Å; N97-S101 PolarHBondContact O-N 2.85Å
98	Q	95.9	Very high	94.2	Very high	117 Å²	117	108.7 Å²	108.7	55%	0.547	57%	0.568	S	S	.	*	H	α-helix	trans	-63.2	-45.1	176.3	-170.2	-177	-14.4	0	0	111.6	S94 V95 M96 S101 M102	S94-Q98 WeakPolarHBondContact O-CB 3.43Å; S94-Q98 PolarHBondContact O-N 3.41Å; V95-Q98 PolarHBondContact O-N 3.19Å; M96-Q98 VanDerWaalsContact C-N 3.33Å; M96-Q98 PolarHBondContact O-N 2.89Å; Q98-S101 PolarHBondContact O-N 3.32Å; Q98-M102 HydrophobicContact CG-CE 4.1Å; Q98-M102 WeakPolarHBondContact O-CG 3.49Å; Q98-M102 PolarHBondContact O-N 3.4Å
99	L	95.7	Very high	93.9	Very high	91 Å²	91	110.1 Å²	110.1	48%	0.476	58%	0.58	S	S	.	*	H	α-helix	trans	-62.5	-49.6	178.6	-177.9	62.4	0	0	0	111.4	V95 M96 S101 M102 V103	V95-L99 WeakPolarHBondContact O-CB 3.38Å; V95-L99 PolarHBondContact O-N 3.25Å; M96-L99 PolarHBondContact O-N 3.09Å; L99-S101 VanDerWaalsContact C-N 3.32Å; L99-S101 PolarHBondContact O-N 3.17Å; L99-M102 HydrophobicContact CD1-CE 4.46Å; L99-M102 PolarHBondContact O-N 3.04Å; L99-V103 HydrophobicContact CD1-CG2 4.37Å; L99-V103 VanDerWaalsContact O-CG2 3.31Å; L99-V103 WeakPolarHBondContact O-CG2 3.46Å; L99-V103 PolarHBondContact O-N 3.38Å
100	L	95.9	Very high	93.5	Very high	101 Å²	101	111.1 Å²	111.1	53%	0.529	58%	0.584	S	S	.	*	H	α-helix	trans	-61.5	-41.2	178	-70.2	172.6	0	0	0	111.6	M96 M102 V103 C104	M96-L100 WeakPolarHBondContact O-CB 3.39Å; M96-L100 VanDerWaalsContact O-CG 3.3Å; M96-L100 WeakPolarHBondContact O-CG 3.44Å; M96-L100 PolarHBondContact O-N 2.94Å; L100-M102 VanDerWaalsContact C-N 3.33Å; L100-M102 PolarHBondContact O-N 3.47Å; L100-V103 PolarHBondContact O-N 3.46Å; L100-C104 WeakPolarHBondContact O-CB 3.5Å; L100-C104 PolarHBondContact O-N 3.05Å; L100-C104 PolarHBondContact O-SG 3.02Å; L100-C104 VanDerWaalsContact O-SG 3.36Å
101	S	95.4	Very high	93.2	Very high	82 Å²	82	109.7 Å²	109.7	57%	0.573	58%	0.58	S	S	*	*	H	α-helix	trans	-59.7	-42.3	175.8	-175.9	0	0	0	0	112.1	N97 Q98 L99 D105	N97-S101 VanDerWaalsContact O-CB 3.24Å; N97-S101 WeakPolarHBondContact O-CB 3.45Å; N97-S101 PolarHBondContact O-N 2.85Å; Q98-S101 PolarHBondContact O-N 3.32Å; L99-S101 VanDerWaalsContact C-N 3.32Å; L99-S101 PolarHBondContact O-N 3.17Å; S101-D105 VanDerWaalsContact O-CB 3.31Å; S101-D105 WeakPolarHBondContact O-CB 3.43Å; S101-D105 PolarHBondContact O-N 3.49Å
102	M	93.3	Very high	93.1	Very high	113 Å²	113	111.7 Å²	111.7	56%	0.557	60%	0.598	S	S	*	*	H	α-helix	trans	-69.7	-38.4	177.8	-70.8	-176.3	-64.4	0	0	112.2	Q98 L99 L100	Q98-M102 HydrophobicContact CG-CE 4.1Å; Q98-M102 WeakPolarHBondContact O-CG 3.49Å; Q98-M102 PolarHBondContact O-N 3.4Å; L99-M102 HydrophobicContact CD1-CE 4.46Å; L99-M102 PolarHBondContact O-N 3.04Å; L100-M102 VanDerWaalsContact C-N 3.33Å; L100-M102 PolarHBondContact O-N 3.47Å
103	V	93.4	Very high	93	Very high	102 Å²	102	114.9 Å²	114.9	62%	0.618	62%	0.616	S	S	*	*	H	α-helix	trans	-68.8	-37.5	179.7	171.7	0	0	0	0	111.6	L99 L100	L99-V103 HydrophobicContact CD1-CG2 4.37Å; L99-V103 VanDerWaalsContact O-CG2 3.31Å; L99-V103 WeakPolarHBondContact O-CG2 3.46Å; L99-V103 PolarHBondContact O-N 3.38Å; L100-V103 PolarHBondContact O-N 3.46Å
104	C	92.9	Very high	92.9	Very high	102 Å²	102	115.5 Å²	115.5	69%	0.689	61%	0.613	S	S	*	*	H	α-helix	trans	-82.2	-15.6	-179.9	-66.4	0	0	0	0	113.8	L100 M106	L100-C104 WeakPolarHBondContact O-CB 3.5Å; L100-C104 PolarHBondContact O-N 3.05Å; L100-C104 PolarHBondContact O-SG 3.02Å; L100-C104 VanDerWaalsContact O-SG 3.36Å; C104-M106 VanDerWaalsContact C-N 3.33Å; C104-M106 PolarHBondContact O-N 3.12Å
105	D	92.5	Very high	92.5	Very high	85 Å²	85	122.4 Å²	122.4	46%	0.455	63%	0.628	S	S	.	*			trans	-80.8	74.4	177.5	-175.2	26.1	0	0	0	111.2	S101 K107	S101-D105 VanDerWaalsContact O-CB 3.31Å; S101-D105 WeakPolarHBondContact O-CB 3.43Å; S101-D105 PolarHBondContact O-N 3.49Å; D105-K107 PolarHBondContact O-N 3.47Å; D105-K107 WeakPolarHBondContact OD1-CE 3.49Å; D105-K107 IonicContact OD1-NZ 3.85Å; D105-K107 WeakPolarHBondContact OD2-CE 3.38Å; D105-K107 IonicContact OD2-NZ 2.67Å; D105-K107 PolarHBondContact OD2-NZ 3.36Å
106	M	85.8	Confident	91.9	Very high	165 Å²	165	121.9 Å²	121.9	81%	0.813	63%	0.633	S	S	*	*			trans	-72.5	112.2	174.2	-72.9	-144.4	-55.5	0	0	111	C104 P108	C104-M106 VanDerWaalsContact C-N 3.33Å; C104-M106 PolarHBondContact O-N 3.12Å; M106-P108 VanDerWaalsContact C-CD 3.44Å; M106-P108 WeakPolarHBondContact O-CD 3.49Å
107	K	87.8	Confident	91	Very high	142 Å²	142	123.4 Å²	123.4	62%	0.617	65%	0.648	S	S	*	*			trans	-107	83.7	170	-69.2	178.8	-179.6	140.6	0	110	D105 E109	D105-K107 PolarHBondContact O-N 3.47Å; D105-K107 WeakPolarHBondContact OD1-CE 3.49Å; D105-K107 IonicContact OD1-NZ 3.85Å; D105-K107 WeakPolarHBondContact OD2-CE 3.38Å; D105-K107 IonicContact OD2-NZ 2.67Å; D105-K107 PolarHBondContact OD2-NZ 3.36Å; K107-E109 PolarHBondContact O-N 2.99Å
108	P	86.9	Confident	89.1	Confident	124 Å²	124	130.1 Å²	130.1	81%	0.805	68%	0.684	S	S	*	*			trans	-65.9	110.3	175.4	25.3	-30.9	0	0	0	109	M106	M106-P108 VanDerWaalsContact C-CD 3.44Å; M106-P108 WeakPolarHBondContact O-CD 3.49Å
109	E	90	Very high	88.8	Confident	170 Å²	170	130.8 Å²	130.8	79%	0.794	69%	0.691	S	S	*	*			trans	-105.3	135.5	174	-69.4	-174.6	-178.3	0	0	109.6	K107 H111	K107-E109 PolarHBondContact O-N 2.99Å; E109-H111 PolarHBondContact O-N 3.46Å
110	I	88.7	Confident	88.4	Confident	127 Å²	127	132.9 Å²	132.9	65%	0.651	70%	0.702	S	S	*	*			trans	-71.1	130.7	169.5	-63.9	178.3	0	0	0	107	V112 Y114	I110-V112 PolarHBondContact O-N 3.32Å; I110-Y114 HydrophobicContact CG2-CD1 3.69Å; I110-Y114 HydrophobicContact CG2-CD2 4.37Å; I110-Y114 HydrophobicContact CG2-CG 3.51Å
111	H	90.8	Very high	88	Confident	133 Å²	133	134.7 Å²	134.7	62%	0.616	71%	0.712	S	S	*	*			trans	-52.2	135.1	177.7	-172.7	-84.7	0	0	0	110.6	E109 N113 Y114	E109-H111 PolarHBondContact O-N 3.46Å; H111-N113 PolarHBondContact ND1-N 3.49Å; H111-N113 PolarHBondContact O-N 3.25Å; H111-Y114 WeakPolarHBondContact O-CB 3.37Å; H111-Y114 PolarHBondContact O-N 3.43Å
112	V	93.4	Very high	87.5	Confident	133 Å²	133	137.8 Å²	137.8	81%	0.806	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.4	-21	-171.7	-65.2	0	0	0	0	115.6	I110	I110-V112 PolarHBondContact O-N 3.32Å
113	N	94	Very high	87.2	Confident	123 Å²	123	139.3 Å²	139.3	66%	0.658	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.1	3.1	-179.5	-64.5	-26.8	0	0	0	114.5	H111 R115	H111-N113 PolarHBondContact ND1-N 3.49Å; H111-N113 PolarHBondContact O-N 3.25Å; N113-R115 PolarHBondContact O-N 3.18Å
114	Y	92.4	Very high	86.8	Confident	158 Å²	158	141.8 Å²	141.8	62%	0.62	74%	0.737	S	S	*	*			trans	-63.2	126.8	177.4	-179.7	-101.9	0	0	0	110.2	I110 H111 A116	I110-Y114 HydrophobicContact CG2-CD1 3.69Å; I110-Y114 HydrophobicContact CG2-CD2 4.37Å; I110-Y114 HydrophobicContact CG2-CG 3.51Å; H111-Y114 WeakPolarHBondContact O-CB 3.37Å; H111-Y114 PolarHBondContact O-N 3.43Å; Y114-A116 HydrophobicContact CE1-CB 4.21Å
115	R	89.2	Confident	86.3	Confident	219 Å²	219	144.6 Å²	144.6	83%	0.826	74%	0.741	S	S	*	*			trans	-119.9	118.7	172.7	-63.9	-165.1	178.4	-164	0.1	108	N113 T117	N113-R115 PolarHBondContact O-N 3.18Å; R115-T117 PolarHBondContact O-N 3.5Å
116	A	84.9	Confident	85.8	Confident	75 Å²	75	149.2 Å²	149.2	62%	0.62	76%	0.763	S	S	*	*			trans	-66.5	116.7	170.5	0	0	0	0	0	108.4	Y114	Y114-A116 HydrophobicContact CE1-CB 4.21Å
117	T	75.9	Confident	85.8	Confident	134 Å²	134	147.9 Å²	147.9	82%	0.822	76%	0.759	S	S	*	*			trans	-82.9	120.5	171	48.8	0	0	0	0	108.4	R115	R115-T117 PolarHBondContact O-N 3.5Å
118	N	56.2	Low	85.7	Confident	237 Å²	237	148.5 Å²	148.5	100%	1.267	77%	0.771	S	S	*	*			trans	-68.4	0	165.1	-80.6	-10.7	0	0	0	111.1

Retrieved 118 of 118 residues in 51 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).