A0A096NCP4_PAPAN Loading...

Apolipoprotein C-III

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

AlphaFold DB , UniProt , Accession A0A096NCP4, Species PAPAN (Papio anubis, Olive baboon), Gene APOC3, Length 117 aa.

						>A0A096NCP4_PAPAN|A0A096NCP4|APOC3
MGAWGAPHRTIPCRNRGAMQPRVLLVAALLSLLASARASEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEATPTLAEAA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.1	Very low	52.6	Low	246 Å²	246	148.3 Å²	148.3	100%	1.212	84%	0.837	S	S	*	*				0	111	0	-74.4	118.8	122.7	0	0	107.5
2	G	42.5	Very low	52.3	Low	80 Å²	80	145 Å²	145	83%	0.825	83%	0.826	S	S	*	*			trans	-70.5	146.7	-172.2	0	0	0	0	0	112.6
3	A	57.9	Low	52.5	Low	85 Å²	85	143.5 Å²	143.5	70%	0.702	83%	0.828	S	S	*	*			trans	-65.6	-162	174.6	0	0	0	0	0	112.3
4	W	49.8	Very low	51.8	Low	258 Å²	258	148.1 Å²	148.1	98%	0.977	83%	0.825	S	S	*	*			trans	85.7	114.9	179.5	-46	95.8	0	0	0	112.5
5	G	44.1	Very low	52	Low	71 Å²	71	148.1 Å²	148.1	73%	0.732	82%	0.823	S	S	*	*			cis	149.9	119.7	11.3	0	0	0	0	0	106.5
6	A	59.6	Low	51.9	Low	93 Å²	93	151.6 Å²	151.6	77%	0.769	82%	0.82	S	S	*	*			trans	-76	146.6	163.7	0	0	0	0	0	108.4
7	P	54.8	Low	52.1	Low	115 Å²	115	145.6 Å²	145.6	75%	0.747	80%	0.802	S	S	*	*				-148.2	145.5	111.9	32.2	-14.2	0	0	0	115.4
8	H	60.8	Low	52.3	Low	179 Å²	179	143.1 Å²	143.1	83%	0.829	80%	0.803	S	S	*	*			trans	-58	134.3	160.6	-52.5	-86.2	0	0	0	110.8
9	R	53.2	Low	52.4	Low	226 Å²	226	142.1 Å²	142.1	85%	0.853	79%	0.793	S	S	*	*			trans	-137.4	99.6	158.9	-81.2	-164.8	175	173	0.1	110.5
10	T	56.3	Low	52.5	Low	135 Å²	135	141.2 Å²	141.2	83%	0.828	78%	0.782	S	S	*	*			trans	-85.2	107.7	157.6	44	0	0	0	0	108.9
11	I	55.7	Low	52.9	Low	143 Å²	143	139.3 Å²	139.3	73%	0.733	78%	0.776	S	S	*	*			trans	-153.6	147.4	161.5	-30.9	172.2	0	0	0	106.8
12	P	48.3	Very low	53.6	Low	109 Å²	109	137 Å²	137	71%	0.708	75%	0.754	S	S	*	*				-118.5	-177.9	-106.4	21.1	5.1	0	0	0	110.9	R14	P12-R14 PolarHBondContact O-N 3.47Å
13	C	55.6	Low	54.7	Low	126 Å²	126	136.5 Å²	136.5	85%	0.851	74%	0.735	S	S	*	*			trans	-22.4	95	170.5	-53.7	0	0	0	0	114.7	N15	C13-N15 PolarHBondContact O-N 2.95Å
14	R	42.7	Very low	55.2	Low	208 Å²	208	137.1 Å²	137.1	79%	0.785	73%	0.726	S	S	*	*			trans	-85.2	70.7	164.6	-167.9	165.1	159.8	176.8	-6.5	107.8	P12 R16	P12-R14 PolarHBondContact O-N 3.47Å; R14-R16 PolarHBondContact O-N 2.92Å
15	N	55.1	Low	56.2	Low	148 Å²	148	130.3 Å²	130.3	79%	0.791	71%	0.708	S	S	*	*			trans	-63.2	89.6	168.3	-162.1	-29.8	0	0	0	107.2	C13 G17	C13-N15 PolarHBondContact O-N 2.95Å; N15-G17 PolarHBondContact O-N 3.2Å
16	R	50.2	Low	57.8	Low	204 Å²	204	130.6 Å²	130.6	77%	0.77	70%	0.695	S	S	*	*			trans	-82.3	62.2	178.6	-161.4	-176.9	-157.4	177	3.5	107.9	R14 A18	R14-R16 PolarHBondContact O-N 2.92Å; R16-A18 VanDerWaalsContact C-N 3.34Å; R16-A18 PolarHBondContact O-N 3.4Å
17	G	54.1	Low	58.6	Low	50 Å²	50	128.7 Å²	128.7	52%	0.515	68%	0.679	S	S	.	*			trans	-62.4	101	162.8	0	0	0	0	0	107.1	N15 M19	N15-G17 PolarHBondContact O-N 3.2Å; G17-M19 PolarHBondContact O-N 2.86Å
18	A	57.2	Low	59.6	Low	100 Å²	100	126.1 Å²	126.1	83%	0.826	67%	0.668	S	S	*	*			trans	-67.7	75.8	167.9	0	0	0	0	0	108	R16 Q20	R16-A18 VanDerWaalsContact C-N 3.34Å; R16-A18 PolarHBondContact O-N 3.4Å; A18-Q20 PolarHBondContact O-N 3.16Å
19	M	53.4	Low	60.1	Low	123 Å²	123	122.3 Å²	122.3	61%	0.606	65%	0.653	S	S	*	*			trans	-64.1	123.3	170	-74.6	-88.1	178.6	0	0	107	G17 L24	G17-M19 PolarHBondContact O-N 2.86Å; M19-L24 HydrophobicContact CB-CD1 4.01Å; M19-L24 HydrophobicContact CB-CD2 3.71Å; M19-L24 HydrophobicContact CB-CG 3.74Å; M19-L24 HydrophobicContact CG-CD2 4.29Å
20	Q	54.3	Low	61.2	Low	125 Å²	125	116.5 Å²	116.5	58%	0.584	64%	0.639	S	S	*	*			trans	-45.1	127.6	177.1	-95	-178.2	-56.1	0	0	109.2	A18 R22 V23 L24	A18-Q20 PolarHBondContact O-N 3.16Å; Q20-R22 PolarHBondContact O-N 3.36Å; Q20-V23 HydrophobicContact CB-CB 4.01Å; Q20-V23 HydrophobicContact CB-CG2 3.66Å; Q20-V23 WeakPolarHBondContact O-CA 3.18Å; Q20-V23 WeakPolarHBondContact O-CB 3.42Å; Q20-V23 PolarHBondContact O-N 2.69Å; Q20-L24 PolarHBondContact O-N 3.03Å
21	P	60.8	Low	62	Low	102 Å²	102	113.8 Å²	113.8	66%	0.662	63%	0.625	S	S	*	*	H	α-helix	trans	-58.7	-26.8	-177.8	21.2	-32	0	0	0	111.7	L25	P21-L25 VanDerWaalsContact O-CB 3.27Å; P21-L25 WeakPolarHBondContact O-CB 3.49Å; P21-L25 PolarHBondContact O-N 3.48Å
22	R	58.9	Low	62.7	Low	198 Å²	198	113 Å²	113	75%	0.747	62%	0.621	S	S	*	*	H	α-helix	trans	-68.3	-40.3	171.2	-65	-178	178.1	177.7	-0.9	112.9	Q20 L24 L25 V26	Q20-R22 PolarHBondContact O-N 3.36Å; R22-L24 VanDerWaalsContact C-N 3.33Å; R22-L25 PolarHBondContact O-N 3.36Å; R22-V26 WeakPolarHBondContact O-CB 3.25Å; R22-V26 WeakPolarHBondContact O-CG2 3.06Å; R22-V26 PolarHBondContact O-N 2.93Å
23	V	66	Low	63.4	Low	68 Å²	68	112.5 Å²	112.5	41%	0.412	61%	0.612	S	S	.	*	H	α-helix	trans	-69.5	-35.5	176.2	177.9	0	0	0	0	110.1	Q20 A27	Q20-V23 HydrophobicContact CB-CB 4.01Å; Q20-V23 HydrophobicContact CB-CG2 3.66Å; Q20-V23 WeakPolarHBondContact O-CA 3.18Å; Q20-V23 WeakPolarHBondContact O-CB 3.42Å; Q20-V23 PolarHBondContact O-N 2.69Å; V23-A27 WeakPolarHBondContact O-CA 3.33Å; V23-A27 WeakPolarHBondContact O-CB 3.37Å; V23-A27 PolarHBondContact O-N 3.49Å
24	L	69.3	Low	63.7	Low	98 Å²	98	109.2 Å²	109.2	51%	0.513	60%	0.595	S	S	.	*	H	α-helix	trans	-67.2	-41.6	171.9	-67.4	175.7	0	0	0	112.3	M19 Q20 R22 A28	M19-L24 HydrophobicContact CB-CD1 4.01Å; M19-L24 HydrophobicContact CB-CD2 3.71Å; M19-L24 HydrophobicContact CB-CG 3.74Å; M19-L24 HydrophobicContact CG-CD2 4.29Å; Q20-L24 PolarHBondContact O-N 3.03Å; R22-L24 VanDerWaalsContact C-N 3.33Å; L24-A28 WeakPolarHBondContact O-CB 3.04Å; L24-A28 PolarHBondContact O-N 2.89Å
25	L	69.5	Low	64.2	Low	115 Å²	115	103.5 Å²	103.5	60%	0.602	59%	0.587	S	S	*	*	H	α-helix	trans	-70.2	-40.1	178.7	-156.9	120.9	0	0	0	111.3	P21 R22 A28 L29	P21-L25 VanDerWaalsContact O-CB 3.27Å; P21-L25 WeakPolarHBondContact O-CB 3.49Å; P21-L25 PolarHBondContact O-N 3.48Å; R22-L25 PolarHBondContact O-N 3.36Å; L25-A28 PolarHBondContact O-N 2.85Å; L25-L29 HydrophobicContact CD2-CD1 3.76Å; L25-L29 HydrophobicContact CG-CD1 4.47Å; L25-L29 VanDerWaalsContact O-CB 3.27Å; L25-L29 WeakPolarHBondContact O-CB 3.35Å; L25-L29 WeakPolarHBondContact O-CD1 3.17Å; L25-L29 VanDerWaalsContact O-CG 3.24Å; L25-L29 WeakPolarHBondContact O-CG 3.11Å; L25-L29 PolarHBondContact O-N 2.89Å
26	V	77.8	Confident	64.2	Low	78 Å²	78	98.6 Å²	98.6	47%	0.473	57%	0.567	S	S	.	*	H	α-helix	trans	-68.8	-41.8	174.2	170.1	0	0	0	0	110.7	R22 L29 L30	R22-V26 WeakPolarHBondContact O-CB 3.25Å; R22-V26 WeakPolarHBondContact O-CG2 3.06Å; R22-V26 PolarHBondContact O-N 2.93Å; V26-L29 PolarHBondContact O-N 3.45Å; V26-L30 HydrophobicContact CG1-CD1 3.66Å; V26-L30 HydrophobicContact CG1-CG 4.15Å; V26-L30 VanDerWaalsContact O-CB 3.23Å; V26-L30 WeakPolarHBondContact O-CB 3.15Å; V26-L30 WeakPolarHBondContact O-CG 3.14Å; V26-L30 PolarHBondContact O-N 2.91Å
27	A	77.6	Confident	64.3	Low	52 Å²	52	96.1 Å²	96.1	43%	0.43	56%	0.557	S	S	.	*	H	α-helix	trans	-66	-38.9	174.8	0	0	0	0	0	111.4	V23 L30 S31	V23-A27 WeakPolarHBondContact O-CA 3.33Å; V23-A27 WeakPolarHBondContact O-CB 3.37Å; V23-A27 PolarHBondContact O-N 3.49Å; A27-L30 PolarHBondContact O-N 2.9Å; A27-S31 WeakPolarHBondContact O-CB 3.24Å; A27-S31 PolarHBondContact O-N 3.25Å
28	A	75.2	Confident	63.9	Low	61 Å²	61	97.3 Å²	97.3	50%	0.504	56%	0.562	S	S	.	*	H	α-helix	trans	-65.9	-42.4	174	0	0	0	0	0	111.6	L24 L25 S31 L32	L24-A28 WeakPolarHBondContact O-CB 3.04Å; L24-A28 PolarHBondContact O-N 2.89Å; L25-A28 PolarHBondContact O-N 2.85Å; A28-S31 PolarHBondContact O-N 3.41Å; A28-L32 WeakPolarHBondContact O-CB 3.48Å; A28-L32 PolarHBondContact O-N 2.96Å
29	L	71.3	Confident	63.4	Low	99 Å²	99	96.8 Å²	96.8	52%	0.518	55%	0.552	S	S	.	*	H	α-helix	trans	-64.4	-44.4	174.6	-80.3	162.5	0	0	0	111.6	L25 V26 L32 L33	L25-L29 HydrophobicContact CD2-CD1 3.76Å; L25-L29 HydrophobicContact CG-CD1 4.47Å; L25-L29 VanDerWaalsContact O-CB 3.27Å; L25-L29 WeakPolarHBondContact O-CB 3.35Å; L25-L29 WeakPolarHBondContact O-CD1 3.17Å; L25-L29 VanDerWaalsContact O-CG 3.24Å; L25-L29 WeakPolarHBondContact O-CG 3.11Å; L25-L29 PolarHBondContact O-N 2.89Å; V26-L29 PolarHBondContact O-N 3.45Å; L29-L32 PolarHBondContact O-N 3.36Å; L29-L33 WeakPolarHBondContact O-CB 3.37Å; L29-L33 PolarHBondContact O-N 3.1Å
30	L	74.9	Confident	63.2	Low	105 Å²	105	95.6 Å²	95.6	55%	0.55	55%	0.545	S	S	.	.	H	α-helix	trans	-69.7	-34.8	178.2	-73.1	173.1	0	0	0	111.9	V26 A27 L33 A34	V26-L30 HydrophobicContact CG1-CD1 3.66Å; V26-L30 HydrophobicContact CG1-CG 4.15Å; V26-L30 VanDerWaalsContact O-CB 3.23Å; V26-L30 WeakPolarHBondContact O-CB 3.15Å; V26-L30 WeakPolarHBondContact O-CG 3.14Å; V26-L30 PolarHBondContact O-N 2.91Å; A27-L30 PolarHBondContact O-N 2.9Å; L30-L33 PolarHBondContact O-N 3.45Å; L30-A34 WeakPolarHBondContact O-CB 2.97Å; L30-A34 PolarHBondContact O-N 3.33Å
31	S	74.4	Confident	62.9	Low	78 Å²	78	93.4 Å²	93.4	55%	0.545	55%	0.548	S	S	.	.	H	α-helix	trans	-72.9	-37.9	176	-157.7	0	0	0	0	111.2	A27 A28 S35	A27-S31 WeakPolarHBondContact O-CB 3.24Å; A27-S31 PolarHBondContact O-N 3.25Å; A28-S31 PolarHBondContact O-N 3.41Å; S31-S35 PolarHBondContact O-N 3.42Å
32	L	69.4	Low	62.3	Low	125 Å²	125	96.7 Å²	96.7	65%	0.654	56%	0.555	S	S	*	*	H	α-helix	trans	-66.5	-41	172.2	-172.6	65.8	0	0	0	111.1	A28 L29 S35 A36	A28-L32 WeakPolarHBondContact O-CB 3.48Å; A28-L32 PolarHBondContact O-N 2.96Å; L29-L32 PolarHBondContact O-N 3.36Å; L32-S35 PolarHBondContact O-N 3.08Å; L32-A36 WeakPolarHBondContact O-CB 3.14Å; L32-A36 PolarHBondContact O-N 2.58Å
33	L	64.5	Low	61.9	Low	99 Å²	99	90.4 Å²	90.4	52%	0.518	54%	0.536	S	S	.	.	H	α-helix	trans	-70.3	-36.1	177	-168.1	65.9	0	0	0	111.7	L29 L30 A36 R37	L29-L33 WeakPolarHBondContact O-CB 3.37Å; L29-L33 PolarHBondContact O-N 3.1Å; L30-L33 PolarHBondContact O-N 3.45Å; L33-A36 PolarHBondContact O-N 2.88Å; L33-R37 HydrophobicContact CD1-CG 4.4Å; L33-R37 HydrophobicContact CG-CG 4.23Å; L33-R37 VanDerWaalsContact O-CB 3.24Å; L33-R37 WeakPolarHBondContact O-CB 3.38Å; L33-R37 WeakPolarHBondContact O-CG 3.35Å; L33-R37 PolarHBondContact O-N 3.18Å
34	A	60.3	Low	60.9	Low	58 Å²	58	93.3 Å²	93.3	48%	0.479	55%	0.554	S	S	.	*	H	α-helix	trans	-68.6	-37.8	174.1	0	0	0	0	0	111.6	L30 R37 A38	L30-A34 WeakPolarHBondContact O-CB 2.97Å; L30-A34 PolarHBondContact O-N 3.33Å; A34-R37 PolarHBondContact O-N 3.31Å; A34-A38 VanDerWaalsContact O-CB 3.25Å; A34-A38 WeakPolarHBondContact O-CB 3.03Å; A34-A38 PolarHBondContact O-N 2.85Å
35	S	55	Low	60	Low	88 Å²	88	94.3 Å²	94.3	62%	0.615	57%	0.57	S	S	*	*	H	α-helix	trans	-65.1	-38.5	170.4	-88.6	0	0	0	0	112.6	S31 L32	S31-S35 PolarHBondContact O-N 3.42Å; L32-S35 PolarHBondContact O-N 3.08Å
36	A	53.8	Low	59.2	Low	45 Å²	45	91.7 Å²	91.7	37%	0.372	56%	0.556	S	S	.	*	H	α-helix	trans	-64.7	-50.3	173.3	0	0	0	0	0	110.5	L32 L33 A38 S39 E40	L32-A36 WeakPolarHBondContact O-CB 3.14Å; L32-A36 PolarHBondContact O-N 2.58Å; L33-A36 PolarHBondContact O-N 2.88Å; A36-A38 PolarHBondContact O-N 2.84Å; A36-S39 WeakPolarHBondContact O-CA 3.3Å; A36-S39 VanDerWaalsContact O-CB 3.27Å; A36-S39 WeakPolarHBondContact O-CB 3.48Å; A36-S39 PolarHBondContact O-N 3.08Å; A36-E40 WeakPolarHBondContact O-CG 2.82Å
37	R	52.2	Low	58	Low	152 Å²	152	93.5 Å²	93.5	57%	0.574	56%	0.562	S	S	*	*	H	α-helix	trans	-70.6	-27.9	-175.5	-66.7	-72.5	-109.9	-176.3	-0.6	114.2	L33 A34 S39 E40 A41	L33-R37 HydrophobicContact CD1-CG 4.4Å; L33-R37 HydrophobicContact CG-CG 4.23Å; L33-R37 VanDerWaalsContact O-CB 3.24Å; L33-R37 WeakPolarHBondContact O-CB 3.38Å; L33-R37 WeakPolarHBondContact O-CG 3.35Å; L33-R37 PolarHBondContact O-N 3.18Å; A34-R37 PolarHBondContact O-N 3.31Å; R37-S39 PolarHBondContact O-N 2.67Å; R37-E40 WeakPolarHBondContact CD-OE2 3.39Å; R37-E40 IonicContact NH1-OE2 3.6Å; R37-E40 PolarHBondContact O-N 3.34Å; R37-A41 WeakPolarHBondContact O-CB 3.41Å; R37-A41 PolarHBondContact O-N 3.42Å; R37-A41 VanDerWaalsContact O-N 3.13Å
38	A	45.8	Very low	56.9	Low	75 Å²	75	94 Å²	94	62%	0.62	57%	0.573	S	S	*	*	H	α-helix	trans	-64.7	-22.9	170.5	0	0	0	0	0	112.1	A34 A36	A34-A38 VanDerWaalsContact O-CB 3.25Å; A34-A38 WeakPolarHBondContact O-CB 3.03Å; A34-A38 PolarHBondContact O-N 2.85Å; A36-A38 PolarHBondContact O-N 2.84Å
39	S	47.1	Very low	55.8	Low	89 Å²	89	97.8 Å²	97.8	62%	0.622	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.7	-10.2	170.9	-166	0	0	0	0	113.7	A36 R37	A36-S39 WeakPolarHBondContact O-CA 3.3Å; A36-S39 VanDerWaalsContact O-CB 3.27Å; A36-S39 WeakPolarHBondContact O-CB 3.48Å; A36-S39 PolarHBondContact O-N 3.08Å; R37-S39 PolarHBondContact O-N 2.67Å
40	E	50	Low	54.9	Low	98 Å²	98	96.7 Å²	96.7	46%	0.458	57%	0.571	S	S	.	*	T	Hydrogen-bonded Turn	trans	-115.5	0.1	-173.7	-53.2	-174.8	148.5	0	0	113.1	A36 R37	A36-E40 WeakPolarHBondContact O-CG 2.82Å; R37-E40 WeakPolarHBondContact CD-OE2 3.39Å; R37-E40 IonicContact NH1-OE2 3.6Å; R37-E40 PolarHBondContact O-N 3.34Å
41	A	47.4	Very low	53.8	Low	78 Å²	78	99 Å²	99	65%	0.645	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.9	-9.8	-173.4	0	0	0	0	0	114	R37 D43	R37-A41 WeakPolarHBondContact O-CB 3.41Å; R37-A41 PolarHBondContact O-N 3.42Å; R37-A41 VanDerWaalsContact O-N 3.13Å; A41-D43 PolarHBondContact O-N 2.93Å
42	E	48.7	Very low	52.9	Low	172 Å²	172	97.8 Å²	97.8	80%	0.804	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.2	-7.7	172.4	-56.4	-168.7	101.4	0	0	112	T44	E42-T44 PolarHBondContact O-N 2.89Å
43	D	48.7	Very low	52	Low	65 Å²	65	99.4 Å²	99.4	35%	0.348	58%	0.578	S	S	.	*			trans	-110.7	38.1	-156.5	-89	-37.9	0	0	0	113.7	A41 S45 L46	A41-D43 PolarHBondContact O-N 2.93Å; D43-S45 PolarHBondContact O-N 2.86Å; D43-L46 HydrophobicContact CB-CB 3.43Å; D43-L46 VanDerWaalsContact CB-CB 3.43Å; D43-L46 HydrophobicContact CB-CD1 4.05Å; D43-L46 HydrophobicContact CB-CG 4.28Å; D43-L46 WeakPolarHBondContact O-CB 3.18Å; D43-L46 PolarHBondContact O-N 2.89Å; D43-L46 WeakPolarHBondContact OD1-CB 3.46Å; D43-L46 WeakPolarHBondContact OD1-CD1 3.26Å; D43-L46 WeakPolarHBondContact OD2-CD1 3.36Å
44	T	46.6	Very low	51.5	Low	130 Å²	130	99.5 Å²	99.5	80%	0.798	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.5	-16.5	163.9	51.1	0	0	0	0	112.3	E42	E42-T44 PolarHBondContact O-N 2.89Å
45	S	50.7	Low	51.3	Low	119 Å²	119	103.7 Å²	103.7	83%	0.832	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.5	-16.1	168.6	-140.3	0	0	0	0	113.7	D43	D43-S45 PolarHBondContact O-N 2.86Å
46	L	51.1	Low	51.1	Low	60 Å²	60	106 Å²	106	31%	0.314	59%	0.587	S	S	.	*	T	Hydrogen-bonded Turn	trans	-93	-1.9	-174.8	-149.3	144.2	0	0	0	113.1	D43 G48 F49 M50	D43-L46 HydrophobicContact CB-CB 3.43Å; D43-L46 VanDerWaalsContact CB-CB 3.43Å; D43-L46 HydrophobicContact CB-CD1 4.05Å; D43-L46 HydrophobicContact CB-CG 4.28Å; D43-L46 WeakPolarHBondContact O-CB 3.18Å; D43-L46 PolarHBondContact O-N 2.89Å; D43-L46 WeakPolarHBondContact OD1-CB 3.46Å; D43-L46 WeakPolarHBondContact OD1-CD1 3.26Å; D43-L46 WeakPolarHBondContact OD2-CD1 3.36Å; L46-G48 PolarHBondContact O-N 3.14Å; L46-F49 HydrophobicContact CD2-CB 4.02Å; L46-F49 HydrophobicContact CG-CB 4.01Å; L46-F49 CarbonylContact O-C 3.54Å; L46-F49 WeakPolarHBondContact O-CA 3.49Å; L46-F49 WeakPolarHBondContact O-CB 3.48Å; L46-F49 PolarHBondContact O-N 3.48Å; L46-M50 HydrophobicContact CD2-CG 3.72Å; L46-M50 WeakPolarHBondContact O-CG 3.49Å; L46-M50 PolarHBondContact O-N 3.25Å
47	L	53	Low	51.1	Low	115 Å²	115	106.5 Å²	106.5	60%	0.602	59%	0.592	S	S	*	*	H	α-helix	trans	-61.1	-30.7	173.6	-95.3	164.2	0	0	0	112.8	F49 Q51	L47-F49 VanDerWaalsContact C-N 3.28Å; L47-F49 PolarHBondContact O-N 2.81Å; L47-Q51 PolarHBondContact O-N 3.28Å
48	G	55.3	Low	51.1	Low	64 Å²	64	103.3 Å²	103.3	66%	0.66	59%	0.589	S	S	*	*	H	α-helix	trans	-68.3	-27.6	171.3	0	0	0	0	0	113.1	L46	L46-G48 PolarHBondContact O-N 3.14Å
49	F	52.3	Low	51.6	Low	139 Å²	139	106.5 Å²	106.5	61%	0.61	59%	0.589	S	S	*	*	H	α-helix	trans	-88.2	-33.8	179.6	-144.4	-94	0	0	0	112.2	L46 L47 Q51 G52 Y53	L46-F49 HydrophobicContact CD2-CB 4.02Å; L46-F49 HydrophobicContact CG-CB 4.01Å; L46-F49 CarbonylContact O-C 3.54Å; L46-F49 WeakPolarHBondContact O-CA 3.49Å; L46-F49 WeakPolarHBondContact O-CB 3.48Å; L46-F49 PolarHBondContact O-N 3.48Å; L47-F49 VanDerWaalsContact C-N 3.28Å; L47-F49 PolarHBondContact O-N 2.81Å; F49-Q51 PolarHBondContact O-N 3.01Å; F49-G52 PolarHBondContact O-N 3.17Å; F49-Y53 AromaticContact CD1-CD2 3.98Å; F49-Y53 HydrophobicContact CD1-CD2 3.98Å; F49-Y53 HydrophobicContact CD1-CE2 4.37Å; F49-Y53 AromaticContact CE1-CD2 3.85Å; F49-Y53 HydrophobicContact CE1-CD2 3.85Å; F49-Y53 AromaticContact CE1-CE2 3.81Å; F49-Y53 HydrophobicContact CE1-CE2 3.81Å; F49-Y53 PolarHBondContact O-N 3.49Å; F49-Y53 VanDerWaalsContact O-N 3.14Å
50	M	50.7	Low	52	Low	77 Å²	77	106.5 Å²	106.5	38%	0.379	59%	0.585	S	S	.	*	H	α-helix	trans	-62.5	-30.6	174.9	-73.9	-174.7	88.3	0	0	112.6	L46 G52 Y53 M54	L46-M50 HydrophobicContact CD2-CG 3.72Å; L46-M50 WeakPolarHBondContact O-CG 3.49Å; L46-M50 PolarHBondContact O-N 3.25Å; M50-G52 VanDerWaalsContact C-N 3.32Å; M50-G52 PolarHBondContact O-N 2.81Å; M50-Y53 PolarHBondContact O-N 3.49Å; M50-M54 HydrophobicContact CB-CE 3.93Å; M50-M54 WeakPolarHBondContact O-CB 3.34Å; M50-M54 PolarHBondContact O-N 3.45Å
51	Q	52.2	Low	52.4	Low	152 Å²	152	104.8 Å²	104.8	71%	0.71	59%	0.588	S	S	*	*	H	α-helix	trans	-69.1	-32	179.5	-156.1	172.6	16.7	0	0	112.2	L47 F49	L47-Q51 PolarHBondContact O-N 3.28Å; F49-Q51 PolarHBondContact O-N 3.01Å
52	G	55.4	Low	52.9	Low	54 Å²	54	107.9 Å²	107.9	56%	0.557	59%	0.587	S	S	*	*	H	α-helix	trans	-75.1	-35.2	170.5	0	0	0	0	0	113.1	F49 M50	F49-G52 PolarHBondContact O-N 3.17Å; M50-G52 VanDerWaalsContact C-N 3.32Å; M50-G52 PolarHBondContact O-N 2.81Å
53	Y	51.8	Low	53.4	Low	158 Å²	158	105.2 Å²	105.2	62%	0.62	58%	0.578	S	S	*	*	H	α-helix	trans	-79.7	-34.9	-178.7	-112.7	-91.2	0	0	0	114.2	F49 M50 Q55 H56 A57	F49-Y53 AromaticContact CD1-CD2 3.98Å; F49-Y53 HydrophobicContact CD1-CD2 3.98Å; F49-Y53 HydrophobicContact CD1-CE2 4.37Å; F49-Y53 AromaticContact CE1-CD2 3.85Å; F49-Y53 HydrophobicContact CE1-CD2 3.85Å; F49-Y53 AromaticContact CE1-CE2 3.81Å; F49-Y53 HydrophobicContact CE1-CE2 3.81Å; F49-Y53 PolarHBondContact O-N 3.49Å; F49-Y53 VanDerWaalsContact O-N 3.14Å; M50-Y53 PolarHBondContact O-N 3.49Å; Y53-Q55 VanDerWaalsContact C-N 3.26Å; Y53-Q55 PolarHBondContact O-N 2.84Å; Y53-H56 PolarHBondContact O-N 3.32Å; Y53-H56 VanDerWaalsContact O-N 3.08Å; Y53-A57 WeakPolarHBondContact O-CB 3.11Å; Y53-A57 PolarHBondContact O-N 2.85Å
54	M	54	Low	53.8	Low	101 Å²	101	104.8 Å²	104.8	50%	0.498	58%	0.584	S	S	.	*	H	α-helix	trans	-60.7	-35.5	175.4	-91.1	-173.6	-99.3	0	0	112.1	M50 H56 T58	M50-M54 HydrophobicContact CB-CE 3.93Å; M50-M54 WeakPolarHBondContact O-CB 3.34Å; M50-M54 PolarHBondContact O-N 3.45Å; M54-H56 VanDerWaalsContact C-N 3.28Å; M54-H56 PolarHBondContact O-N 3.12Å; M54-T58 WeakPolarHBondContact O-CB 3.42Å; M54-T58 PolarHBondContact O-N 2.93Å; M54-T58 PolarHBondContact O-OG1 2.94Å
55	Q	54.8	Low	54.2	Low	146 Å²	146	104.3 Å²	104.3	68%	0.682	58%	0.576	S	S	*	*	H	α-helix	trans	-62.6	-34.8	174.9	-86.1	-110	3.3	0	0	112.6	Y53	Y53-Q55 VanDerWaalsContact C-N 3.26Å; Y53-Q55 PolarHBondContact O-N 2.84Å
56	H	51.7	Low	54.5	Low	136 Å²	136	101.1 Å²	101.1	63%	0.63	55%	0.551	S	S	*	*	H	α-helix	trans	-84.4	-42.3	-179.6	-156.6	-101.8	0	0	0	111.9	Y53 M54 K59 T60	Y53-H56 PolarHBondContact O-N 3.32Å; Y53-H56 VanDerWaalsContact O-N 3.08Å; M54-H56 VanDerWaalsContact C-N 3.28Å; M54-H56 PolarHBondContact O-N 3.12Å; H56-K59 PolarHBondContact O-N 3.29Å; H56-T60 PolarHBondContact O-N 3.42Å; H56-T60 PolarHBondContact O-OG1 3.38Å
57	A	53.4	Low	54.5	Low	56 Å²	56	102.4 Å²	102.4	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-70.5	-35	179.3	0	0	0	0	0	113	Y53 K59 T60 A61	Y53-A57 WeakPolarHBondContact O-CB 3.11Å; Y53-A57 PolarHBondContact O-N 2.85Å; A57-K59 VanDerWaalsContact C-N 3.3Å; A57-K59 PolarHBondContact O-N 2.85Å; A57-T60 PolarHBondContact O-N 3.4Å; A57-A61 VanDerWaalsContact O-CB 3.3Å; A57-A61 WeakPolarHBondContact O-CB 3.27Å; A57-A61 PolarHBondContact O-N 2.91Å
58	T	53	Low	54.5	Low	86 Å²	86	100.8 Å²	100.8	53%	0.528	56%	0.56	S	S	.	*	H	α-helix	trans	-67.7	-31.9	176.2	-55.5	0	0	0	0	111.3	M54 K62	M54-T58 WeakPolarHBondContact O-CB 3.42Å; M54-T58 PolarHBondContact O-N 2.93Å; M54-T58 PolarHBondContact O-OG1 2.94Å; T58-K62 WeakPolarHBondContact O-CB 3.14Å; T58-K62 PolarHBondContact O-N 3.04Å
59	K	55.9	Low	54.4	Low	141 Å²	141	104.8 Å²	104.8	61%	0.613	56%	0.561	S	S	*	*	H	α-helix	trans	-65.8	-48.7	174.1	-108.5	-177.8	174.6	118.9	0	111.6	H56 A57 K62 D63	H56-K59 PolarHBondContact O-N 3.29Å; A57-K59 VanDerWaalsContact C-N 3.3Å; A57-K59 PolarHBondContact O-N 2.85Å; K59-K62 PolarHBondContact O-N 3.28Å; K59-D63 PolarHBondContact O-N 3.48Å
60	T	55.4	Low	54.5	Low	89 Å²	89	105.7 Å²	105.7	55%	0.546	57%	0.568	S	S	.	*	H	α-helix	trans	-66.7	-39.5	178.6	-52.7	0	0	0	0	112.7	H56 A57 K62 A64	H56-T60 PolarHBondContact O-N 3.42Å; H56-T60 PolarHBondContact O-OG1 3.38Å; A57-T60 PolarHBondContact O-N 3.4Å; T60-K62 VanDerWaalsContact C-N 3.31Å; T60-K62 PolarHBondContact O-N 2.77Å; T60-A64 VanDerWaalsContact O-CB 3.24Å; T60-A64 WeakPolarHBondContact O-CB 3.27Å; T60-A64 PolarHBondContact O-N 3.41Å
61	A	58.1	Low	54.7	Low	62 Å²	62	106.3 Å²	106.3	51%	0.512	58%	0.579	S	S	.	*	H	α-helix	trans	-65.1	-37.5	175.1	0	0	0	0	0	111.4	A57 L65	A57-A61 VanDerWaalsContact O-CB 3.3Å; A57-A61 WeakPolarHBondContact O-CB 3.27Å; A57-A61 PolarHBondContact O-N 2.91Å; A61-L65 WeakPolarHBondContact O-CB 3.42Å; A61-L65 PolarHBondContact O-N 2.77Å
62	K	58	Low	54.7	Low	144 Å²	144	105.2 Å²	105.2	63%	0.626	57%	0.574	S	S	*	*	H	α-helix	trans	-74.5	-35.8	179.5	-162.4	176.3	175.4	-178.9	0	112.3	T58 K59 T60 T66	T58-K62 WeakPolarHBondContact O-CB 3.14Å; T58-K62 PolarHBondContact O-N 3.04Å; K59-K62 PolarHBondContact O-N 3.28Å; T60-K62 VanDerWaalsContact C-N 3.31Å; T60-K62 PolarHBondContact O-N 2.77Å; K62-T66 VanDerWaalsContact O-CB 3.25Å; K62-T66 WeakPolarHBondContact O-CB 3.24Å; K62-T66 PolarHBondContact O-N 3.43Å; K62-T66 PolarHBondContact O-OG1 3.47Å
63	D	59.2	Low	54.8	Low	116 Å²	116	106.1 Å²	106.1	62%	0.62	57%	0.569	S	S	*	*	H	α-helix	trans	-70.7	-38	172.8	-77.2	-17.4	0	0	0	111.9	K59 S67	K59-D63 PolarHBondContact O-N 3.48Å; D63-S67 WeakPolarHBondContact O-CB 3.27Å; D63-S67 PolarHBondContact O-N 2.8Å
64	A	57.1	Low	55.2	Low	55 Å²	55	102.4 Å²	102.4	46%	0.455	57%	0.57	S	S	.	*	H	α-helix	trans	-68.5	-39.6	173.4	0	0	0	0	0	112.2	T60 V68	T60-A64 VanDerWaalsContact O-CB 3.24Å; T60-A64 WeakPolarHBondContact O-CB 3.27Å; T60-A64 PolarHBondContact O-N 3.41Å; A64-V68 WeakPolarHBondContact O-CG2 3.12Å; A64-V68 PolarHBondContact O-N 2.79Å; A64-V68 VanDerWaalsContact O-N 3.1Å
65	L	55.3	Low	55.5	Low	121 Å²	121	105.2 Å²	105.2	63%	0.634	58%	0.582	S	S	*	*	H	α-helix	trans	-69.5	-38.6	177.1	-160.2	75.9	0	0	0	111.5	A61 Q69	A61-L65 WeakPolarHBondContact O-CB 3.42Å; A61-L65 PolarHBondContact O-N 2.77Å; L65-Q69 WeakPolarHBondContact O-CB 3.34Å; L65-Q69 PolarHBondContact O-N 3.34Å
66	T	56	Low	55.9	Low	51 Å²	51	103 Å²	103	31%	0.313	57%	0.572	S	S	.	*	H	α-helix	trans	-68.9	-42.2	176.3	-56.6	0	0	0	0	111.2	K62 V68 Q69 E70	K62-T66 VanDerWaalsContact O-CB 3.25Å; K62-T66 WeakPolarHBondContact O-CB 3.24Å; K62-T66 PolarHBondContact O-N 3.43Å; K62-T66 PolarHBondContact O-OG1 3.47Å; T66-V68 VanDerWaalsContact C-N 3.33Å; T66-V68 PolarHBondContact O-N 2.74Å; T66-Q69 PolarHBondContact O-N 2.88Å; T66-E70 HydrophobicContact CG2-CG 4.34Å; T66-E70 WeakPolarHBondContact O-CB 3.05Å; T66-E70 PolarHBondContact O-N 3.49Å
67	S	52.3	Low	56.4	Low	87 Å²	87	99 Å²	99	61%	0.608	56%	0.562	S	S	*	*	H	α-helix	trans	-61.4	-37.6	175.6	179.2	0	0	0	0	113	D63	D63-S67 WeakPolarHBondContact O-CB 3.27Å; D63-S67 PolarHBondContact O-N 2.8Å
68	V	53.5	Low	56.8	Low	81 Å²	81	105.6 Å²	105.6	49%	0.491	58%	0.575	S	S	.	*	H	α-helix	trans	-72.9	-40.6	173.8	170.5	0	0	0	0	111.4	A64 T66 E70 V73	A64-V68 WeakPolarHBondContact O-CG2 3.12Å; A64-V68 PolarHBondContact O-N 2.79Å; A64-V68 VanDerWaalsContact O-N 3.1Å; T66-V68 VanDerWaalsContact C-N 3.33Å; T66-V68 PolarHBondContact O-N 2.74Å; V68-E70 VanDerWaalsContact C-N 3.34Å; V68-E70 PolarHBondContact O-N 3.19Å; V68-V73 HydrophobicContact CG1-CB 4.45Å; V68-V73 HydrophobicContact CG1-CG1 3.62Å; V68-V73 HydrophobicContact CG1-CG2 3.98Å; V68-V73 WeakPolarHBondContact O-CG2 3.42Å
69	Q	53.1	Low	57.4	Low	149 Å²	149	102.9 Å²	102.9	70%	0.696	57%	0.565	S	S	*	*	H	α-helix	trans	-67.1	-32.3	-177.9	-170.7	172.3	42.3	0	0	112.8	L65 T66	L65-Q69 WeakPolarHBondContact O-CB 3.34Å; L65-Q69 PolarHBondContact O-N 3.34Å; T66-Q69 PolarHBondContact O-N 2.88Å
70	E	53.4	Low	57.8	Low	158 Å²	158	105.4 Å²	105.4	74%	0.738	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	-11.1	-174.2	-79.4	-164.9	156.9	0	0	116	T66 V68	T66-E70 HydrophobicContact CG2-CG 4.34Å; T66-E70 WeakPolarHBondContact O-CB 3.05Å; T66-E70 PolarHBondContact O-N 3.49Å; V68-E70 VanDerWaalsContact C-N 3.34Å; V68-E70 PolarHBondContact O-N 3.19Å
71	S	54.2	Low	58.4	Low	90 Å²	90	105.7 Å²	105.7	63%	0.629	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.4	-51.5	-171.8	-105.1	0	0	0	0	118.7
72	Q	53.1	Low	58.8	Low	129 Å²	129	106.9 Å²	106.9	60%	0.603	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-145.3	-8.9	-161.5	-73.9	-175.9	59.9	0	0	117.6	A74 Q75 Q76	Q72-A74 PolarHBondContact O-N 3.44Å; Q72-Q75 PolarHBondContact O-N 3.46Å; Q72-Q76 WeakPolarHBondContact O-CB 3.24Å; Q72-Q76 PolarHBondContact O-N 3.13Å
73	V	58.3	Low	59.1	Low	73 Å²	73	105.8 Å²	105.8	44%	0.442	57%	0.574	S	S	.	*	H	α-helix	trans	-69.4	-29.2	-176.9	-80	0	0	0	0	114.2	V68 A77	V68-V73 HydrophobicContact CG1-CB 4.45Å; V68-V73 HydrophobicContact CG1-CG1 3.62Å; V68-V73 HydrophobicContact CG1-CG2 3.98Å; V68-V73 WeakPolarHBondContact O-CG2 3.42Å; V73-A77 WeakPolarHBondContact O-CA 3.2Å; V73-A77 WeakPolarHBondContact O-CB 3.5Å; V73-A77 PolarHBondContact O-N 3.02Å
74	A	59.4	Low	59.5	Low	79 Å²	79	101.5 Å²	101.5	65%	0.653	56%	0.557	S	S	*	*	H	α-helix	trans	-73.7	-37.4	178.9	0	0	0	0	0	113.1	Q72 R78	Q72-A74 PolarHBondContact O-N 3.44Å; A74-R78 PolarHBondContact O-N 2.93Å
75	Q	61	Low	59.9	Low	160 Å²	160	105.9 Å²	105.9	75%	0.748	57%	0.566	S	S	*	*	H	α-helix	trans	-82.3	-38.1	176.3	-74.3	-171.4	-27.6	0	0	111.9	Q72 R78 G79	Q72-Q75 PolarHBondContact O-N 3.46Å; Q75-R78 WeakPolarHBondContact O-CB 3.39Å; Q75-R78 PolarHBondContact O-N 3.42Å; Q75-R78 VanDerWaalsContact O-N 3.16Å; Q75-G79 PolarHBondContact O-N 3.01Å
76	Q	61.6	Low	60.2	Low	101 Å²	101	103.3 Å²	103.3	47%	0.472	56%	0.558	S	S	.	*	H	α-helix	trans	-66.7	-40	174.4	-166.6	171.1	5.8	0	0	110.7	Q72 R78 G79 W80	Q72-Q76 WeakPolarHBondContact O-CB 3.24Å; Q72-Q76 PolarHBondContact O-N 3.13Å; Q76-R78 VanDerWaalsContact C-N 3.26Å; Q76-R78 PolarHBondContact O-N 3.33Å; Q76-G79 PolarHBondContact O-N 3.39Å; Q76-G79 VanDerWaalsContact O-N 3.08Å; Q76-W80 PolarHBondContact O-N 3Å
77	A	63.7	Low	60.6	Low	50 Å²	50	104.5 Å²	104.5	41%	0.413	57%	0.568	S	S	.	*	H	α-helix	trans	-60.5	-35.4	171.4	0	0	0	0	0	112.2	V73 V81	V73-A77 WeakPolarHBondContact O-CA 3.2Å; V73-A77 WeakPolarHBondContact O-CB 3.5Å; V73-A77 PolarHBondContact O-N 3.02Å; A77-V81 WeakPolarHBondContact O-CB 3.27Å; A77-V81 WeakPolarHBondContact O-CG2 3.48Å; A77-V81 PolarHBondContact O-N 2.74Å
78	R	60.8	Low	61.5	Low	195 Å²	195	105.7 Å²	105.7	74%	0.736	57%	0.567	S	S	*	*	H	α-helix	trans	-63.8	-43.9	171.9	-81	-172.2	176.2	179.5	0.6	111.9	A74 Q75 Q76 T82	A74-R78 PolarHBondContact O-N 2.93Å; Q75-R78 WeakPolarHBondContact O-CB 3.39Å; Q75-R78 PolarHBondContact O-N 3.42Å; Q75-R78 VanDerWaalsContact O-N 3.16Å; Q76-R78 VanDerWaalsContact C-N 3.26Å; Q76-R78 PolarHBondContact O-N 3.33Å; R78-T82 WeakPolarHBondContact O-CB 3.49Å; R78-T82 PolarHBondContact O-N 2.81Å; R78-T82 PolarHBondContact O-OG1 3.36Å
79	G	65.8	Low	62.5	Low	30 Å²	30	107 Å²	107	31%	0.309	57%	0.567	S	S	.	*	H	α-helix	trans	-60.1	-51.2	175.1	0	0	0	0	0	112.7	Q75 Q76 V81 T82 D83	Q75-G79 PolarHBondContact O-N 3.01Å; Q76-G79 PolarHBondContact O-N 3.39Å; Q76-G79 VanDerWaalsContact O-N 3.08Å; G79-V81 PolarHBondContact O-N 3.18Å; G79-T82 PolarHBondContact O-N 3.07Å; G79-D83 WeakPolarHBondContact O-CB 3.17Å; G79-D83 PolarHBondContact O-N 2.91Å
80	W	65.1	Low	63.6	Low	193 Å²	193	104.4 Å²	104.4	73%	0.731	56%	0.558	S	S	*	*	H	α-helix	trans	-67.3	-33.1	-179.9	-75.1	71.8	0	0	0	113.4	Q76 G84	Q76-W80 PolarHBondContact O-N 3Å; W80-G84 WeakPolarHBondContact O-CA 3.22Å; W80-G84 PolarHBondContact O-N 2.9Å
81	V	67.4	Low	64.4	Low	95 Å²	95	104.9 Å²	104.9	58%	0.576	55%	0.554	S	S	*	*	H	α-helix	trans	-71.5	-40.7	172.2	170.7	0	0	0	0	110.2	A77 G79 F85	A77-V81 WeakPolarHBondContact O-CB 3.27Å; A77-V81 WeakPolarHBondContact O-CG2 3.48Å; A77-V81 PolarHBondContact O-N 2.74Å; G79-V81 PolarHBondContact O-N 3.18Å; V81-F85 WeakPolarHBondContact O-CA 3.22Å; V81-F85 WeakPolarHBondContact O-CB 3.13Å; V81-F85 PolarHBondContact O-N 2.79Å
82	T	66.1	Low	65.4	Low	87 Å²	87	109.3 Å²	109.3	53%	0.534	56%	0.557	S	S	.	*	H	α-helix	trans	-73.6	-41.9	-176.9	-41.8	0	0	0	0	111.9	R78 G79 S86	R78-T82 WeakPolarHBondContact O-CB 3.49Å; R78-T82 PolarHBondContact O-N 2.81Å; R78-T82 PolarHBondContact O-OG1 3.36Å; G79-T82 PolarHBondContact O-N 3.07Å; T82-S86 WeakPolarHBondContact O-CB 3.49Å; T82-S86 PolarHBondContact O-N 2.79Å; T82-S86 VanDerWaalsContact O-N 3.17Å; T82-S86 PolarHBondContact O-OG 3.38Å
83	D	65.2	Low	66.2	Low	122 Å²	122	106.5 Å²	106.5	65%	0.652	55%	0.552	S	S	*	*	H	α-helix	trans	-75.4	-42.6	176.8	-69.4	-26.9	0	0	0	111.7	G79 S87	G79-D83 WeakPolarHBondContact O-CB 3.17Å; G79-D83 PolarHBondContact O-N 2.91Å; D83-S87 PolarHBondContact O-N 2.89Å; D83-S87 VanDerWaalsContact O-N 3.12Å
84	G	67.3	Low	67.1	Low	26 Å²	26	106.9 Å²	106.9	27%	0.268	55%	0.554	S	S	.	*	H	α-helix	trans	-68.1	-40.9	176.6	0	0	0	0	0	112.6	W80 S87 L88	W80-G84 WeakPolarHBondContact O-CA 3.22Å; W80-G84 PolarHBondContact O-N 2.9Å; G84-S87 PolarHBondContact O-N 2.83Å; G84-L88 WeakPolarHBondContact O-CB 3.49Å; G84-L88 WeakPolarHBondContact O-CD1 3.4Å; G84-L88 PolarHBondContact O-N 3.03Å
85	F	65.1	Low	68.1	Low	147 Å²	147	107 Å²	107	65%	0.645	55%	0.547	S	S	*	.	H	α-helix	trans	-68.7	-36.2	176.9	-169.8	-99.1	0	0	0	111.8	V81 K89	V81-F85 WeakPolarHBondContact O-CA 3.22Å; V81-F85 WeakPolarHBondContact O-CB 3.13Å; V81-F85 PolarHBondContact O-N 2.79Å; F85-K89 VanDerWaalsContact O-CB 3.26Å; F85-K89 WeakPolarHBondContact O-CB 3.27Å; F85-K89 PolarHBondContact O-N 2.8Å
86	S	62.6	Low	68.9	Low	66 Å²	66	106 Å²	106	46%	0.462	54%	0.54	S	S	.	.	H	α-helix	trans	-65.2	-43.5	175	-70.2	0	0	0	0	112.1	T82 K89	T82-S86 WeakPolarHBondContact O-CB 3.49Å; T82-S86 PolarHBondContact O-N 2.79Å; T82-S86 VanDerWaalsContact O-N 3.17Å; T82-S86 PolarHBondContact O-OG 3.38Å; S86-K89 WeakPolarHBondContact O-CB 3.15Å; S86-K89 PolarHBondContact O-N 3.47Å
87	S	64.1	Low	69.8	Low	76 Å²	76	106.3 Å²	106.3	53%	0.531	55%	0.545	S	S	.	.	H	α-helix	trans	-71.7	-33.7	178.4	-173.7	0	0	0	0	113	D83 G84 Y91	D83-S87 PolarHBondContact O-N 2.89Å; D83-S87 VanDerWaalsContact O-N 3.12Å; G84-S87 PolarHBondContact O-N 2.83Å; S87-Y91 WeakPolarHBondContact O-CD2 3.21Å
88	L	70.8	Confident	70.5	Confident	112 Å²	112	111.2 Å²	111.2	59%	0.586	56%	0.557	S	S	*	*	H	α-helix	trans	-83.1	-13.6	175.4	-82.3	98.2	0	0	0	113.4	G84 D90 Y91 W92	G84-L88 WeakPolarHBondContact O-CB 3.49Å; G84-L88 WeakPolarHBondContact O-CD1 3.4Å; G84-L88 PolarHBondContact O-N 3.03Å; L88-D90 VanDerWaalsContact C-N 3.32Å; L88-D90 PolarHBondContact O-N 3.36Å; L88-Y91 PolarHBondContact O-N 3.47Å; L88-W92 WeakPolarHBondContact O-CB 3.47Å; L88-W92 PolarHBondContact O-N 2.78Å
89	K	73.6	Confident	71.3	Confident	109 Å²	109	106.8 Å²	106.8	47%	0.474	55%	0.547	S	S	.	.	H	α-helix	trans	-58.9	-43.7	178.5	-179	-176.8	63	64.6	0	111.6	F85 S86 W92 S93	F85-K89 VanDerWaalsContact O-CB 3.26Å; F85-K89 WeakPolarHBondContact O-CB 3.27Å; F85-K89 PolarHBondContact O-N 2.8Å; S86-K89 WeakPolarHBondContact O-CB 3.15Å; S86-K89 PolarHBondContact O-N 3.47Å; K89-W92 PolarHBondContact O-N 2.75Å; K89-S93 VanDerWaalsContact O-CB 3.27Å; K89-S93 WeakPolarHBondContact O-CB 3.19Å; K89-S93 PolarHBondContact O-N 2.74Å
90	D	76.2	Confident	71.6	Confident	95 Å²	95	108.2 Å²	108.2	51%	0.508	55%	0.552	S	S	.	*	H	α-helix	trans	-75.2	-34.4	-176.1	-62.2	-24.3	0	0	0	111.5	L88 T94	L88-D90 VanDerWaalsContact C-N 3.32Å; L88-D90 PolarHBondContact O-N 3.36Å; D90-T94 PolarHBondContact O-N 2.98Å; D90-T94 PolarHBondContact O-OG1 2.87Å
91	Y	71.8	Confident	71.7	Confident	168 Å²	168	100.7 Å²	100.7	66%	0.659	54%	0.535	S	S	*	.	H	α-helix	trans	-66.3	-44.4	169.3	-75.1	-75.6	0	0	0	112	S87 L88 S93 T94 V95	S87-Y91 WeakPolarHBondContact O-CD2 3.21Å; L88-Y91 PolarHBondContact O-N 3.47Å; Y91-S93 VanDerWaalsContact C-N 3.32Å; Y91-S93 PolarHBondContact O-N 3.5Å; Y91-T94 PolarHBondContact O-N 2.86Å; Y91-V95 VanDerWaalsContact O-CG2 3.27Å; Y91-V95 WeakPolarHBondContact O-CG2 3.13Å; Y91-V95 PolarHBondContact O-N 2.84Å
92	W	74.7	Confident	71.7	Confident	182 Å²	182	103.8 Å²	103.8	69%	0.689	54%	0.541	S	S	*	.	H	α-helix	trans	-66.4	-35.1	177.5	-170.7	-104.2	0	0	0	111.7	L88 K89 V95 K96	L88-W92 WeakPolarHBondContact O-CB 3.47Å; L88-W92 PolarHBondContact O-N 2.78Å; K89-W92 PolarHBondContact O-N 2.75Å; W92-V95 PolarHBondContact O-N 2.76Å; W92-K96 WeakPolarHBondContact O-CB 3.3Å; W92-K96 PolarHBondContact O-N 3.47Å
93	S	69.3	Low	71.7	Confident	71 Å²	71	109.2 Å²	109.2	50%	0.497	55%	0.552	S	S	.	*	H	α-helix	trans	-65.4	-42.6	173.7	-167.4	0	0	0	0	111.1	K89 Y91 K96 D97	K89-S93 VanDerWaalsContact O-CB 3.27Å; K89-S93 WeakPolarHBondContact O-CB 3.19Å; K89-S93 PolarHBondContact O-N 2.74Å; Y91-S93 VanDerWaalsContact C-N 3.32Å; Y91-S93 PolarHBondContact O-N 3.5Å; S93-K96 PolarHBondContact O-N 2.87Å; S93-D97 VanDerWaalsContact O-CB 3.22Å; S93-D97 WeakPolarHBondContact O-CB 3.48Å; S93-D97 PolarHBondContact O-N 3.42Å
94	T	78	Confident	71.6	Confident	80 Å²	80	110.1 Å²	110.1	49%	0.491	56%	0.557	S	S	.	*	H	α-helix	trans	-66.1	-40.1	176.5	-55.9	0	0	0	0	111.6	D90 Y91 K98	D90-T94 PolarHBondContact O-N 2.98Å; D90-T94 PolarHBondContact O-OG1 2.87Å; Y91-T94 PolarHBondContact O-N 2.86Å; T94-K98 WeakPolarHBondContact O-CB 3.23Å; T94-K98 WeakPolarHBondContact O-CG 3.13Å; T94-K98 PolarHBondContact O-N 2.89Å; T94-K98 VanDerWaalsContact O-N 3.07Å
95	V	79	Confident	71.1	Confident	82 Å²	82	115.4 Å²	115.4	50%	0.497	58%	0.578	S	S	.	*	H	α-helix	trans	-66.7	-43.2	175.4	171.5	0	0	0	0	110.5	Y91 W92 L99	Y91-V95 VanDerWaalsContact O-CG2 3.27Å; Y91-V95 WeakPolarHBondContact O-CG2 3.13Å; Y91-V95 PolarHBondContact O-N 2.84Å; W92-V95 PolarHBondContact O-N 2.76Å; V95-L99 WeakPolarHBondContact O-CB 3.25Å; V95-L99 PolarHBondContact O-N 3.05Å
96	K	79.8	Confident	70.6	Confident	139 Å²	139	113.3 Å²	113.3	60%	0.604	57%	0.573	S	S	*	*	H	α-helix	trans	-63.9	-44.1	177.3	-177.9	177.2	174.7	174.5	0	111.5	W92 S93 L99 S100	W92-K96 WeakPolarHBondContact O-CB 3.3Å; W92-K96 PolarHBondContact O-N 3.47Å; S93-K96 PolarHBondContact O-N 2.87Å; K96-L99 CarbonylContact O-C 3.58Å; K96-L99 PolarHBondContact O-N 3.32Å; K96-S100 WeakPolarHBondContact O-CB 3.46Å; K96-S100 PolarHBondContact O-N 3.36Å; K96-S100 PolarHBondContact O-OG 3Å
97	D	79.1	Confident	70.1	Confident	108 Å²	108	116.1 Å²	116.1	58%	0.578	59%	0.59	S	S	*	*	H	α-helix	trans	-62	-45.8	178.8	-177.1	-97.4	0	0	0	111.7	S93 L99 S100 G101	S93-D97 VanDerWaalsContact O-CB 3.22Å; S93-D97 WeakPolarHBondContact O-CB 3.48Å; S93-D97 PolarHBondContact O-N 3.42Å; D97-L99 VanDerWaalsContact C-N 3.3Å; D97-L99 PolarHBondContact O-N 3.1Å; D97-S100 VanDerWaalsContact CA-OG 3.3Å; D97-S100 WeakPolarHBondContact CA-OG 3.02Å; D97-S100 PolarHBondContact O-N 3.23Å; D97-S100 PolarHBondContact O-OG 2.77Å; D97-G101 PolarHBondContact O-N 2.97Å
98	K	78.9	Confident	69.5	Low	152 Å²	152	121.2 Å²	121.2	66%	0.661	61%	0.606	S	S	*	*	H	α-helix	trans	-65.8	-33.3	173.9	-71.4	-165.8	-177.6	-63.5	0	112.6	T94 F102	T94-K98 WeakPolarHBondContact O-CB 3.23Å; T94-K98 WeakPolarHBondContact O-CG 3.13Å; T94-K98 PolarHBondContact O-N 2.89Å; T94-K98 VanDerWaalsContact O-N 3.07Å; K98-F102 WeakPolarHBondContact O-CB 3.37Å; K98-F102 PolarHBondContact O-N 3.41Å; K98-F102 VanDerWaalsContact O-N 3.1Å
99	L	76.9	Confident	68.4	Low	103 Å²	103	119.3 Å²	119.3	54%	0.539	61%	0.606	S	S	.	*	H	α-helix	trans	-75.6	-35.2	177.3	-161	76.2	0	0	0	112.1	V95 K96 D97 F102 W103	V95-L99 WeakPolarHBondContact O-CB 3.25Å; V95-L99 PolarHBondContact O-N 3.05Å; K96-L99 CarbonylContact O-C 3.58Å; K96-L99 PolarHBondContact O-N 3.32Å; D97-L99 VanDerWaalsContact C-N 3.3Å; D97-L99 PolarHBondContact O-N 3.1Å; L99-F102 PolarHBondContact O-N 2.95Å; L99-W103 WeakPolarHBondContact O-CB 3.44Å; L99-W103 PolarHBondContact O-N 3.33Å
100	S	71.8	Confident	67	Low	59 Å²	59	119.6 Å²	119.6	41%	0.413	62%	0.617	S	S	.	*	H	α-helix	trans	-69.6	-42.8	173.2	48.2	0	0	0	0	111.2	K96 D97 F102 W103 D104	K96-S100 WeakPolarHBondContact O-CB 3.46Å; K96-S100 PolarHBondContact O-N 3.36Å; K96-S100 PolarHBondContact O-OG 3Å; D97-S100 VanDerWaalsContact CA-OG 3.3Å; D97-S100 WeakPolarHBondContact CA-OG 3.02Å; D97-S100 PolarHBondContact O-N 3.23Å; D97-S100 PolarHBondContact O-OG 2.77Å; S100-F102 PolarHBondContact O-N 3.49Å; S100-W103 PolarHBondContact O-N 3.49Å; S100-D104 WeakPolarHBondContact O-CB 3.39Å; S100-D104 PolarHBondContact O-N 2.96Å
101	G	67.3	Low	65.8	Low	36 Å²	36	121.1 Å²	121.1	37%	0.371	63%	0.632	S	S	.	*	H	α-helix	trans	-60.9	-34.5	173.2	0	0	0	0	0	112.3	D97 L105	D97-G101 PolarHBondContact O-N 2.97Å; G101-L105 VanDerWaalsContact O-CD1 3.22Å; G101-L105 WeakPolarHBondContact O-CD1 3.22Å; G101-L105 WeakPolarHBondContact O-CG 3.22Å; G101-L105 PolarHBondContact O-N 3.03Å
102	F	68.3	Low	64.7	Low	159 Å²	159	118.5 Å²	118.5	70%	0.697	63%	0.634	S	S	*	*	H	α-helix	trans	-70.5	-32.6	173.4	-165.5	88.5	0	0	0	113.1	K98 L99 S100	K98-F102 WeakPolarHBondContact O-CB 3.37Å; K98-F102 PolarHBondContact O-N 3.41Å; K98-F102 VanDerWaalsContact O-N 3.1Å; L99-F102 PolarHBondContact O-N 2.95Å; S100-F102 PolarHBondContact O-N 3.49Å
103	W	66.1	Low	63.5	Low	201 Å²	201	116.2 Å²	116.2	76%	0.761	63%	0.634	S	S	*	*	H	α-helix	trans	-80.2	-31.4	178.3	-107.2	98.8	0	0	0	113.8	L99 S100 L105	L99-W103 WeakPolarHBondContact O-CB 3.44Å; L99-W103 PolarHBondContact O-N 3.33Å; S100-W103 PolarHBondContact O-N 3.49Å; W103-L105 VanDerWaalsContact C-N 3.27Å; W103-L105 PolarHBondContact O-N 3.36Å
104	D	62.4	Low	62.4	Low	142 Å²	142	118.2 Å²	118.2	76%	0.759	66%	0.655	S	S	*	*	H	α-helix	trans	-71.5	-25.2	177.5	-143.6	-95.1	0	0	0	111.7	S100 N106	S100-D104 WeakPolarHBondContact O-CB 3.39Å; S100-D104 PolarHBondContact O-N 2.96Å; D104-N106 VanDerWaalsContact C-N 3.26Å; D104-N106 PolarHBondContact O-N 2.83Å
105	L	56.8	Low	61.1	Low	136 Å²	136	123 Å²	123	71%	0.712	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.3	2	-178.8	-78.5	166.6	0	0	0	115.4	G101 W103	G101-L105 VanDerWaalsContact O-CD1 3.22Å; G101-L105 WeakPolarHBondContact O-CD1 3.22Å; G101-L105 WeakPolarHBondContact O-CG 3.22Å; G101-L105 PolarHBondContact O-N 3.03Å; W103-L105 VanDerWaalsContact C-N 3.27Å; W103-L105 PolarHBondContact O-N 3.36Å
106	N	55.7	Low	59.7	Low	103 Å²	103	122.9 Å²	122.9	55%	0.551	68%	0.68	S	S	*	*			trans	-143.3	92.4	177.1	-159.3	28.9	0	0	0	114.4	D104 A109	D104-N106 VanDerWaalsContact C-N 3.26Å; D104-N106 PolarHBondContact O-N 2.83Å; N106-A109 PolarHBondContact OD1-N 2.92Å
107	P	50.7	Low	57.7	Low	126 Å²	126	125 Å²	125	82%	0.818	72%	0.723	S	S	*	*	S	Bend		-125.3	11.7	125	36.6	-31	0	0	0	114.3
108	E	51.7	Low	56.6	Low	183 Å²	183	125.9 Å²	125.9	86%	0.855	73%	0.73	S	S	*	*	S	Bend	trans	-142	48.6	179.7	-151.5	-179.8	107	0	0	113.9
109	A	47.3	Very low	55.4	Low	72 Å²	72	124.5 Å²	124.5	60%	0.595	73%	0.734	S	S	*	*			trans	-117.6	87.1	162.9	0	0	0	0	0	110.3	N106	N106-A109 PolarHBondContact OD1-N 2.92Å
110	T	44.4	Very low	54.2	Low	115 Å²	115	125.7 Å²	125.7	71%	0.706	75%	0.745	S	S	*	*			trans	-27.6	131	157.4	-53.8	0	0	0	0	112.2	T112	T110-T112 VanDerWaalsContact C-N 3.28Å; T110-T112 PolarHBondContact O-N 2.87Å
111	P	51.1	Low	53.2	Low	127 Å²	127	129.6 Å²	129.6	83%	0.825	76%	0.764	S	S	*	*	S	Bend	trans	-79	79.2	-179.1	33.7	-32.4	0	0	0	108.7
112	T	50.3	Low	52.3	Low	112 Å²	112	135.4 Å²	135.4	69%	0.687	79%	0.789	S	S	*	*			trans	-149.8	116.7	167.5	-59	0	0	0	0	110.2	T110	T110-T112 VanDerWaalsContact C-N 3.28Å; T110-T112 PolarHBondContact O-N 2.87Å
113	L	48.8	Very low	51.2	Low	135 Å²	135	133.9 Å²	133.9	71%	0.707	80%	0.795	S	S	*	*			trans	82.2	73.4	155.9	-143.9	133.8	0	0	0	117	A116	L113-A116 HydrophobicContact CD2-CB 4.42Å
114	A	45.5	Very low	50.2	Low	113 Å²	113	129.1 Å²	129.1	93%	0.934	80%	0.797	S	S	*	*	S	Bend	trans	-117.6	48.8	141.9	0	0	0	0	0	109.3
115	E	52.1	Low	49.2	Very low	181 Å²	181	128.1 Å²	128.1	85%	0.846	80%	0.8	S	S	*	*			trans	-144.3	93.7	162.5	-167.6	-172.8	138.2	0	0	106.9
116	A	47.9	Very low	48.6	Very low	79 Å²	79	127.4 Å²	127.4	65%	0.653	81%	0.807	S	S	*	*			trans	-174.8	118.1	151.4	0	0	0	0	0	110	L113	L113-A116 HydrophobicContact CD2-CB 4.42Å
117	A	37.7	Very low	47.9	Very low	183 Å²	183	129.6 Å²	129.6	100%	1.512	83%	0.831	S	S	*	*			trans	77.2	0	166	0	0	0	0	0	118.1

Retrieved 117 of 117 residues in 54.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).