A0A096NDU2_PAPAN Loading...

V-type proton ATPase subunit

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession A0A096NDU2, Species PAPAN (Papio anubis, Olive baboon), Gene n/a, Length 81 aa.

						>A0A096NDU2_PAPAN|A0A096NDU2
MAYQGLTVPLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.2	Very low	77	Confident	213 Å²	213	94.7 Å²	94.7	100%	1.049	53%	0.529	S	S	*	.				0	-34.8	0	-163.5	167.2	-85.2	0	0	113.1	Y3 Q4	M1-Y3 VanDerWaalsContact C-N 3.27Å; M1-Y3 PolarHBondContact O-N 3.44Å; M1-Q4 PolarHBondContact O-N 3.2Å
2	A	51.6	Low	78.6	Confident	80 Å²	80	93.8 Å²	93.8	66%	0.661	53%	0.528	S	S	*	.	H	α-helix	trans	-57.6	-32.4	173.3	0	0	0	0	0	114.8	Q4	A2-Q4 PolarHBondContact O-N 3.16Å
3	Y	58.6	Low	80	Confident	162 Å²	162	91.8 Å²	91.8	64%	0.635	51%	0.513	S	S	*	.	H	α-helix	trans	-62.7	-35.8	-179.7	-70.8	-81.6	0	0	0	114	M1 G5 L6 T7	M1-Y3 VanDerWaalsContact C-N 3.27Å; M1-Y3 PolarHBondContact O-N 3.44Å; Y3-G5 VanDerWaalsContact C-N 3.34Å; Y3-G5 PolarHBondContact O-N 3Å; Y3-L6 PolarHBondContact O-N 3.1Å; Y3-L6 VanDerWaalsContact O-N 3.12Å; Y3-T7 PolarHBondContact O-N 3.38Å; Y3-T7 PolarHBondContact O-OG1 3.14Å
4	Q	62.3	Low	81.1	Confident	145 Å²	145	88.4 Å²	88.4	68%	0.678	50%	0.498	S	S	*	.	H	α-helix	trans	-64	-39.4	-172.8	-64.9	-70.1	-56.3	0	0	112.3	M1 A2 L6	M1-Q4 PolarHBondContact O-N 3.2Å; A2-Q4 PolarHBondContact O-N 3.16Å; Q4-L6 VanDerWaalsContact C-N 3.32Å; Q4-L6 PolarHBondContact O-N 3.1Å
5	G	78.9	Confident	82.2	Confident	60 Å²	60	89.1 Å²	89.1	62%	0.619	51%	0.505	S	S	*	.	H	α-helix	trans	-70.6	-27.5	177.5	0	0	0	0	0	113.4	Y3 P9	Y3-G5 VanDerWaalsContact C-N 3.34Å; Y3-G5 PolarHBondContact O-N 3Å; G5-P9 WeakPolarHBondContact O-CD 3.49Å; G5-P9 WeakPolarHBondContact O-CG 3.42Å
6	L	85.8	Confident	83.1	Confident	29 Å²	29	90.2 Å²	90.2	15%	0.152	50%	0.502	C	S	.	.	H	α-helix	trans	-90.8	-25.6	179.4	-168.4	69.9	0	0	0	113.4	Y3 Q4 V8 P9 L10 I56 L60	Y3-L6 PolarHBondContact O-N 3.1Å; Y3-L6 VanDerWaalsContact O-N 3.12Å; Q4-L6 VanDerWaalsContact C-N 3.32Å; Q4-L6 PolarHBondContact O-N 3.1Å; L6-V8 VanDerWaalsContact C-N 3.27Å; L6-V8 PolarHBondContact O-N 2.89Å; L6-P9 VanDerWaalsContact O-CD 3.28Å; L6-P9 WeakPolarHBondContact O-CD 3.36Å; L6-L10 HydrophobicContact CD2-CD1 3.78Å; L6-L10 HydrophobicContact CD2-CG 4.33Å; L6-L10 HydrophobicContact CG-CD1 3.72Å; L6-L10 HydrophobicContact CG-CG 3.93Å; L6-L10 WeakPolarHBondContact O-CB 3.38Å; L6-L10 WeakPolarHBondContact O-CG 3.21Å; L6-L10 PolarHBondContact O-N 3.02Å; L6-I56 HydrophobicContact CD1-CG2 3.4Å; L6-I56 HydrophobicContact CD2-CG2 3.96Å; L6-I56 HydrophobicContact CG-CG2 4.25Å; L6-L60 HydrophobicContact CD2-CD1 4.02Å; L6-L60 HydrophobicContact CD2-CD2 3.39Å; L6-L60 HydrophobicContact CD2-CG 3.81Å
7	T	89.3	Confident	84	Confident	57 Å²	57	87.9 Å²	87.9	35%	0.35	48%	0.484	S	S	.	.	H	α-helix	trans	-54.8	-44.5	178	-63.1	0	0	0	0	111.6	Y3 L10 I11	Y3-T7 PolarHBondContact O-N 3.38Å; Y3-T7 PolarHBondContact O-OG1 3.14Å; T7-L10 PolarHBondContact O-N 3.01Å; T7-I11 HydrophobicContact CG2-CD1 3.67Å; T7-I11 HydrophobicContact CG2-CG1 4.43Å; T7-I11 VanDerWaalsContact O-CG1 3.31Å; T7-I11 WeakPolarHBondContact O-CG1 3.23Å; T7-I11 PolarHBondContact O-N 3.11Å
8	V	91.8	Very high	84.6	Confident	95 Å²	95	85.2 Å²	85.2	58%	0.576	48%	0.48	S	S	*	.	H	α-helix	trans	-64.1	-54.5	-179.3	175.2	0	0	0	0	111.7	L6 L10 I11 V12	L6-V8 VanDerWaalsContact C-N 3.27Å; L6-V8 PolarHBondContact O-N 2.89Å; V8-L10 VanDerWaalsContact C-N 3.32Å; V8-L10 PolarHBondContact O-N 3.37Å; V8-I11 PolarHBondContact O-N 3.48Å; V8-V12 HydrophobicContact CG1-CG2 4.31Å; V8-V12 WeakPolarHBondContact O-CB 3.34Å; V8-V12 WeakPolarHBondContact O-CG2 3.41Å; V8-V12 PolarHBondContact O-N 3.09Å
9	P	92.8	Very high	85.3	Confident	50 Å²	50	86.3 Å²	86.3	33%	0.325	48%	0.479	S	S	.	.	H	α-helix	trans	-54.3	-43.2	174.5	-27.2	31.3	0	0	0	114.1	G5 L6 M13 W52	G5-P9 WeakPolarHBondContact O-CD 3.49Å; G5-P9 WeakPolarHBondContact O-CG 3.42Å; L6-P9 VanDerWaalsContact O-CD 3.28Å; L6-P9 WeakPolarHBondContact O-CD 3.36Å; P9-M13 VanDerWaalsContact O-CB 3.29Å; P9-M13 WeakPolarHBondContact O-CB 3.3Å; P9-M13 VanDerWaalsContact O-CG 3.27Å; P9-M13 WeakPolarHBondContact O-CG 3.27Å; P9-M13 PolarHBondContact O-N 3.46Å; P9-W52 HydrophobicContact CB-CZ2 4.19Å
10	L	93.5	Very high	85.8	Confident	49 Å²	49	83.4 Å²	83.4	26%	0.257	46%	0.464	S	S	.	.	H	α-helix	trans	-60.6	-51.8	179.2	-74.3	169.2	0	0	0	111.3	L6 T7 V8 V12 S14 W52 L53	L6-L10 HydrophobicContact CD2-CD1 3.78Å; L6-L10 HydrophobicContact CD2-CG 4.33Å; L6-L10 HydrophobicContact CG-CD1 3.72Å; L6-L10 HydrophobicContact CG-CG 3.93Å; L6-L10 WeakPolarHBondContact O-CB 3.38Å; L6-L10 WeakPolarHBondContact O-CG 3.21Å; L6-L10 PolarHBondContact O-N 3.02Å; T7-L10 PolarHBondContact O-N 3.01Å; V8-L10 VanDerWaalsContact C-N 3.32Å; V8-L10 PolarHBondContact O-N 3.37Å; L10-V12 PolarHBondContact O-N 3.45Å; L10-S14 VanDerWaalsContact O-CB 3.29Å; L10-S14 WeakPolarHBondContact O-CB 3.5Å; L10-S14 PolarHBondContact O-N 3.3Å; L10-S14 PolarHBondContact O-OG 3.49Å; L10-W52 HydrophobicContact CD2-CH2 3.9Å; L10-W52 HydrophobicContact CD2-CZ3 4.06Å; L10-W52 HydrophobicContact CG-CH2 4.47Å; L10-L53 HydrophobicContact CD2-CD1 3.84Å
11	I	94.8	Very high	86.2	Confident	102 Å²	102	80.1 Å²	80.1	52%	0.523	45%	0.449	S	S	.	.	H	α-helix	trans	-61.2	-48.3	-179.7	-67	169.9	0	0	0	110.6	T7 V8 M13 S14 V15	T7-I11 HydrophobicContact CG2-CD1 3.67Å; T7-I11 HydrophobicContact CG2-CG1 4.43Å; T7-I11 VanDerWaalsContact O-CG1 3.31Å; T7-I11 WeakPolarHBondContact O-CG1 3.23Å; T7-I11 PolarHBondContact O-N 3.11Å; V8-I11 PolarHBondContact O-N 3.48Å; I11-M13 PolarHBondContact O-N 3.25Å; I11-S14 PolarHBondContact O-N 2.9Å; I11-V15 HydrophobicContact CG2-CG2 4.38Å; I11-V15 WeakPolarHBondContact O-CB 3.27Å; I11-V15 VanDerWaalsContact O-CG2 3.27Å; I11-V15 WeakPolarHBondContact O-CG2 3.42Å; I11-V15 PolarHBondContact O-N 3.04Å
12	V	95.9	Very high	88.4	Confident	84 Å²	84	78.1 Å²	78.1	51%	0.509	44%	0.435	S	S	.	.	H	α-helix	trans	-62.2	-47.5	-176.9	172	0	0	0	0	111.2	V8 L10 V15 F16	V8-V12 HydrophobicContact CG1-CG2 4.31Å; V8-V12 WeakPolarHBondContact O-CB 3.34Å; V8-V12 WeakPolarHBondContact O-CG2 3.41Å; V8-V12 PolarHBondContact O-N 3.09Å; L10-V12 PolarHBondContact O-N 3.45Å; V12-V15 PolarHBondContact O-N 3.32Å; V12-F16 VanDerWaalsContact O-CB 3.26Å; V12-F16 WeakPolarHBondContact O-CB 3.15Å; V12-F16 PolarHBondContact O-N 2.96Å
13	M	96.1	Very high	90.4	Very high	68 Å²	68	78 Å²	78	34%	0.335	42%	0.422	S	S	.	.	H	α-helix	trans	-70.7	-37.2	-177.9	-68.5	-63.4	-176.9	0	0	112.5	P9 I11 W17 W52	P9-M13 VanDerWaalsContact O-CB 3.29Å; P9-M13 WeakPolarHBondContact O-CB 3.3Å; P9-M13 VanDerWaalsContact O-CG 3.27Å; P9-M13 WeakPolarHBondContact O-CG 3.27Å; P9-M13 PolarHBondContact O-N 3.46Å; I11-M13 PolarHBondContact O-N 3.25Å; M13-W17 PolarHBondContact O-N 3.49Å; M13-W52 HydrophobicContact CB-CD2 4.23Å; M13-W52 HydrophobicContact CB-CE3 3.91Å; M13-W52 HydrophobicContact CB-CH2 3.63Å; M13-W52 HydrophobicContact CB-CZ2 3.97Å; M13-W52 HydrophobicContact CB-CZ3 3.6Å; M13-W52 HydrophobicContact CG-CD2 4.15Å; M13-W52 HydrophobicContact CG-CE3 4.32Å; M13-W52 HydrophobicContact CG-CH2 3.76Å; M13-W52 HydrophobicContact CG-CZ2 3.55Å; M13-W52 HydrophobicContact CG-CZ3 4.14Å
14	S	95.8	Very high	92.1	Very high	43 Å²	43	72.4 Å²	72.4	30%	0.301	41%	0.405	S	S	.	.	H	α-helix	trans	-64.6	-43.2	174.5	-61.8	0	0	0	0	111.7	L10 I11 G18 Y49	L10-S14 VanDerWaalsContact O-CB 3.29Å; L10-S14 WeakPolarHBondContact O-CB 3.5Å; L10-S14 PolarHBondContact O-N 3.3Å; L10-S14 PolarHBondContact O-OG 3.49Å; I11-S14 PolarHBondContact O-N 2.9Å; S14-G18 WeakPolarHBondContact O-CA 3.49Å; S14-G18 PolarHBondContact O-N 2.89Å; S14-Y49 WeakPolarHBondContact OG-CE2 3.31Å; S14-Y49 PolarHBondContact OG-OH 3.15Å
15	V	97.4	Very high	93.6	Very high	99 Å²	99	66.1 Å²	66.1	60%	0.6	38%	0.377	S	S	*	.	H	α-helix	trans	-66.9	-44	177.1	171.5	0	0	0	0	110.9	I11 V12 F19	I11-V15 HydrophobicContact CG2-CG2 4.38Å; I11-V15 WeakPolarHBondContact O-CB 3.27Å; I11-V15 VanDerWaalsContact O-CG2 3.27Å; I11-V15 WeakPolarHBondContact O-CG2 3.42Å; I11-V15 PolarHBondContact O-N 3.04Å; V12-V15 PolarHBondContact O-N 3.32Å; V15-F19 VanDerWaalsContact O-CB 3.23Å; V15-F19 WeakPolarHBondContact O-CB 3.23Å; V15-F19 PolarHBondContact O-N 2.84Å
16	F	97.4	Very high	94.3	Very high	107 Å²	107	73.2 Å²	73.2	47%	0.469	39%	0.385	S	S	.	.	H	α-helix	trans	-58.8	-55	178.8	173.6	-98.5	0	0	0	111.7	V12 F19 V20	V12-F16 VanDerWaalsContact O-CB 3.26Å; V12-F16 WeakPolarHBondContact O-CB 3.15Å; V12-F16 PolarHBondContact O-N 2.96Å; F16-F19 WeakPolarHBondContact O-CB 3.28Å; F16-F19 PolarHBondContact O-N 2.93Å; F16-V20 HydrophobicContact CE1-CG2 4.37Å; F16-V20 HydrophobicContact CE2-CG2 4.37Å; F16-V20 HydrophobicContact CZ-CG2 4.19Å; F16-V20 WeakPolarHBondContact O-CG2 3.46Å; F16-V20 PolarHBondContact O-N 3.45Å
17	W	97.4	Very high	94.6	Very high	51 Å²	51	78.9 Å²	78.9	19%	0.193	41%	0.409	C	S	.	.	H	α-helix	trans	-72.1	-32.8	-178.5	-74.5	115.3	0	0	0	112.8	M13 V20 G21 C48 Y49	M13-W17 PolarHBondContact O-N 3.49Å; W17-V20 HydrophobicContact CE3-CB 4.22Å; W17-V20 HydrophobicContact CE3-CG1 4.25Å; W17-V20 HydrophobicContact CZ3-CG1 4.23Å; W17-V20 PolarHBondContact O-N 3.01Å; W17-G21 PolarHBondContact O-N 3.33Å; W17-C48 HydrophobicContact CD2-CB 4.35Å; W17-C48 HydrophobicContact CE3-CB 4.46Å; W17-C48 HydrophobicContact CH2-CB 3.53Å; W17-C48 HydrophobicContact CZ2-CB 3.4Å; W17-C48 HydrophobicContact CZ3-CB 4.08Å; W17-Y49 HydrophobicContact CB-CD2 4.2Å; W17-Y49 HydrophobicContact CB-CG 4.37Å; W17-Y49 HydrophobicContact CG-CD2 4.41Å
18	G	95.9	Very high	94.8	Very high	40 Å²	40	77.3 Å²	77.3	41%	0.412	40%	0.398	S	S	.	.	H	α-helix	trans	-61.1	-42.8	170.8	0	0	0	0	0	112.2	S14 G21 F22	S14-G18 WeakPolarHBondContact O-CA 3.49Å; S14-G18 PolarHBondContact O-N 2.89Å; G18-G21 PolarHBondContact O-N 2.87Å; G18-F22 WeakPolarHBondContact O-CB 3.4Å; G18-F22 PolarHBondContact O-N 3.21Å
19	F	96.7	Very high	94.8	Very high	106 Å²	106	77.9 Å²	77.9	47%	0.465	40%	0.404	S	S	.	.	I	π-helix	trans	-62.3	-47.6	174.7	-179.3	-85.8	0	0	0	111.6	V15 F16 G21 F22 L23 V24	V15-F19 VanDerWaalsContact O-CB 3.23Å; V15-F19 WeakPolarHBondContact O-CB 3.23Å; V15-F19 PolarHBondContact O-N 2.84Å; F16-F19 WeakPolarHBondContact O-CB 3.28Å; F16-F19 PolarHBondContact O-N 2.93Å; F19-G21 PolarHBondContact O-N 2.93Å; F19-F22 PolarHBondContact O-N 3.49Å; F19-L23 HydrophobicContact CD2-CB 3.8Å; F19-L23 HydrophobicContact CD2-CD1 3.24Å; F19-L23 HydrophobicContact CD2-CG 4.12Å; F19-L23 HydrophobicContact CE2-CB 3.82Å; F19-L23 HydrophobicContact CE2-CD1 3.6Å; F19-L23 HydrophobicContact CE2-CG 4.26Å; F19-L23 HydrophobicContact CG-CB 4.2Å; F19-L23 HydrophobicContact CG-CD1 4.17Å; F19-L23 HydrophobicContact CZ-CB 4.26Å; F19-L23 WeakPolarHBondContact O-CA 3.26Å; F19-L23 WeakPolarHBondContact O-CB 3.35Å; F19-L23 PolarHBondContact O-N 2.94Å; F19-V24 HydrophobicContact CD1-CG2 3.89Å; F19-V24 HydrophobicContact CE1-CG2 3.63Å; F19-V24 PolarHBondContact O-N 3.48Å; F19-V24 VanDerWaalsContact O-N 3.16Å
20	V	96	Very high	94.8	Very high	28 Å²	28	85.4 Å²	85.4	17%	0.17	43%	0.431	C	S	.	.	I	π-helix	trans	-62.9	-41.5	179.2	174	0	0	0	0	111.9	F16 W17 P25	F16-V20 HydrophobicContact CE1-CG2 4.37Å; F16-V20 HydrophobicContact CE2-CG2 4.37Å; F16-V20 HydrophobicContact CZ-CG2 4.19Å; F16-V20 WeakPolarHBondContact O-CG2 3.46Å; F16-V20 PolarHBondContact O-N 3.45Å; W17-V20 HydrophobicContact CE3-CB 4.22Å; W17-V20 HydrophobicContact CE3-CG1 4.25Å; W17-V20 HydrophobicContact CZ3-CG1 4.23Å; W17-V20 PolarHBondContact O-N 3.01Å; V20-P25 WeakPolarHBondContact O-CD 3.07Å
21	G	94.7	Very high	94.9	Very high	15 Å²	15	85 Å²	85	16%	0.155	44%	0.439	C	S	.	.	I	π-helix	trans	-79.3	-24.6	-178.3	0	0	0	0	0	114.7	W17 G18 F19 P25 V42 S45	W17-G21 PolarHBondContact O-N 3.33Å; G18-G21 PolarHBondContact O-N 2.87Å; F19-G21 PolarHBondContact O-N 2.93Å; G21-P25 WeakPolarHBondContact O-CG 3.32Å; G21-V42 WeakPolarHBondContact O-CG2 3.5Å; G21-S45 VanDerWaalsContact CA-OG 3.23Å; G21-S45 WeakPolarHBondContact CA-OG 3.38Å
22	F	93.1	Very high	94.9	Very high	171 Å²	171	86.8 Å²	86.8	75%	0.75	46%	0.457	S	S	*	.	I	π-helix	trans	-115.1	-50.7	-172.7	-170	-103.7	0	0	0	113.7	G18 F19	G18-F22 WeakPolarHBondContact O-CB 3.4Å; G18-F22 PolarHBondContact O-N 3.21Å; F19-F22 PolarHBondContact O-N 3.49Å
23	L	94.4	Very high	94.9	Very high	76 Å²	76	87.9 Å²	87.9	40%	0.398	46%	0.461	S	S	.	.	I	π-helix	trans	-79.5	-44.4	-174.9	-83.7	157.6	0	0	0	112.2	F19 W26 F27	F19-L23 HydrophobicContact CD2-CB 3.8Å; F19-L23 HydrophobicContact CD2-CD1 3.24Å; F19-L23 HydrophobicContact CD2-CG 4.12Å; F19-L23 HydrophobicContact CE2-CB 3.82Å; F19-L23 HydrophobicContact CE2-CD1 3.6Å; F19-L23 HydrophobicContact CE2-CG 4.26Å; F19-L23 HydrophobicContact CG-CB 4.2Å; F19-L23 HydrophobicContact CG-CD1 4.17Å; F19-L23 HydrophobicContact CZ-CB 4.26Å; F19-L23 WeakPolarHBondContact O-CA 3.26Å; F19-L23 WeakPolarHBondContact O-CB 3.35Å; F19-L23 PolarHBondContact O-N 2.94Å; L23-W26 VanDerWaalsContact O-CB 3.3Å; L23-W26 WeakPolarHBondContact O-CB 3.4Å; L23-W26 PolarHBondContact O-N 2.89Å; L23-W26 VanDerWaalsContact O-N 3.1Å; L23-F27 WeakPolarHBondContact O-CD2 3.4Å
24	V	93.9	Very high	94.8	Very high	45 Å²	45	88.8 Å²	88.8	27%	0.273	46%	0.46	S	S	.	.	G	3₁₀ helix	trans	-59.7	-41.9	-178.2	-180	0	0	0	0	113.2	F19 W26 F27 L41	F19-V24 HydrophobicContact CD1-CG2 3.89Å; F19-V24 HydrophobicContact CE1-CG2 3.63Å; F19-V24 PolarHBondContact O-N 3.48Å; F19-V24 VanDerWaalsContact O-N 3.16Å; V24-W26 PolarHBondContact O-N 2.98Å; V24-W26 VanDerWaalsContact O-N 3.1Å; V24-F27 PolarHBondContact O-N 3.42Å; V24-L41 HydrophobicContact CG1-CD1 3.84Å
25	P	94	Very high	94.7	Very high	13 Å²	13	89 Å²	89	8%	0.084	47%	0.469	C	S	.	.	G	3₁₀ helix	trans	-54.3	-28.5	174.5	-32.9	39.7	0	0	0	115.2	V20 G21 F27 R34 I38 V42	V20-P25 WeakPolarHBondContact O-CD 3.07Å; G21-P25 WeakPolarHBondContact O-CG 3.32Å; P25-F27 VanDerWaalsContact C-N 3.34Å; P25-R34 PolarHBondContact O-NH2 3.28Å; P25-I38 HydrophobicContact CB-CG1 4.09Å; P25-I38 HydrophobicContact CB-CG2 4.01Å; P25-I38 HydrophobicContact CG-CG2 4.47Å; P25-V42 HydrophobicContact CG-CG2 4.2Å
26	W	93.1	Very high	94.7	Very high	210 Å²	210	88.2 Å²	88.2	80%	0.795	46%	0.464	S	S	*	.	G	3₁₀ helix	trans	-69	-33.9	177.5	-165.1	-94.4	0	0	0	112.2	L23 V24 I28	L23-W26 VanDerWaalsContact O-CB 3.3Å; L23-W26 WeakPolarHBondContact O-CB 3.4Å; L23-W26 PolarHBondContact O-N 2.89Å; L23-W26 VanDerWaalsContact O-N 3.1Å; V24-W26 PolarHBondContact O-N 2.98Å; V24-W26 VanDerWaalsContact O-N 3.1Å; W26-I28 VanDerWaalsContact C-N 3.31Å; W26-I28 PolarHBondContact O-N 2.92Å
27	F	93.2	Very high	94.6	Very high	148 Å²	148	86.7 Å²	86.7	65%	0.649	46%	0.46	S	S	*	.	G	3₁₀ helix	trans	-84.2	0.8	-178.3	-64.5	-73.5	0	0	0	114	L23 V24 P25	L23-F27 WeakPolarHBondContact O-CD2 3.4Å; V24-F27 PolarHBondContact O-N 3.42Å; P25-F27 VanDerWaalsContact C-N 3.34Å
28	I	93.2	Very high	94.6	Very high	23 Å²	23	86 Å²	86	12%	0.118	46%	0.46	C	S	.	.			trans	-76.1	124.6	-179.4	-60.7	-154.6	0	0	0	111.4	W26 R34 I37 I38 L41	W26-I28 VanDerWaalsContact C-N 3.31Å; W26-I28 PolarHBondContact O-N 2.92Å; I28-R34 HydrophobicContact CG2-CG 3.96Å; I28-R34 PolarHBondContact O-NE 3.3Å; I28-I37 HydrophobicContact CD1-CB 4.08Å; I28-I37 HydrophobicContact CD1-CG2 3.36Å; I28-I38 HydrophobicContact CD1-CG1 4.23Å; I28-L41 HydrophobicContact CD1-CD1 3.54Å
29	P	92.4	Very high	94.6	Very high	108 Å²	108	88 Å²	88	70%	0.701	46%	0.464	S	S	*	.			trans	-62.8	153.7	-178	25.8	-34.3	0	0	0	112.1	G31	P29-G31 PolarHBondContact O-N 2.92Å
30	K	92.6	Very high	94.6	Very high	207 Å²	207	89 Å²	89	90%	0.9	47%	0.472	S	S	*	.	S	Bend	trans	-71.1	112.3	177	-64.7	179.1	-176.5	174.7	0	109.1
31	G	94.1	Very high	94.6	Very high	41 Å²	41	89.8 Å²	89.8	42%	0.423	48%	0.475	S	S	.	.	S	Bend	trans	-154.3	171.6	175.8	0	0	0	0	0	111.4	P29 N33 R34	P29-G31 PolarHBondContact O-N 2.92Å; G31-N33 PolarHBondContact O-N 3.48Å; G31-N33 VanDerWaalsContact O-N 3.14Å; G31-R34 WeakPolarHBondContact O-CB 3.2Å; G31-R34 PolarHBondContact O-N 3.44Å; G31-R34 VanDerWaalsContact O-N 3.11Å
32	P	96.1	Very high	94.7	Very high	139 Å²	139	91.8 Å²	91.8	90%	0.903	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.5	-33.2	-175.4	-25.2	34	0	0	0	113.5
33	N	95.8	Very high	94.9	Very high	108 Å²	108	87.6 Å²	87.6	58%	0.578	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.1	9.4	-175.3	-60.1	-24	0	0	0	113.7	G31 G35 V36 I37	G31-N33 PolarHBondContact O-N 3.48Å; G31-N33 VanDerWaalsContact O-N 3.14Å; N33-G35 VanDerWaalsContact C-N 3.3Å; N33-G35 PolarHBondContact O-N 3.03Å; N33-V36 PolarHBondContact O-N 2.95Å; N33-V36 VanDerWaalsContact O-N 3.15Å; N33-I37 HydrophobicContact CB-CD1 4.27Å; N33-I37 WeakPolarHBondContact O-CG1 3.29Å; N33-I37 PolarHBondContact O-N 3.37Å
34	R	93.3	Very high	95.1	Very high	87 Å²	87	87 Å²	87	33%	0.328	47%	0.474	S	S	.	.	H	α-helix	trans	-56.1	-43.3	-173.9	-178.9	173.1	-170	-82.9	-3	112.6	P25 I28 G31 I37 I38	P25-R34 PolarHBondContact O-NH2 3.28Å; I28-R34 HydrophobicContact CG2-CG 3.96Å; I28-R34 PolarHBondContact O-NE 3.3Å; G31-R34 WeakPolarHBondContact O-CB 3.2Å; G31-R34 PolarHBondContact O-N 3.44Å; G31-R34 VanDerWaalsContact O-N 3.11Å; R34-I37 PolarHBondContact O-N 3.49Å; R34-I38 HydrophobicContact CG-CD1 3.8Å; R34-I38 VanDerWaalsContact O-CG1 3.27Å; R34-I38 WeakPolarHBondContact O-CG1 3.45Å; R34-I38 PolarHBondContact O-N 2.91Å; R34-I38 VanDerWaalsContact O-N 3.09Å
35	G	94.4	Very high	95.2	Very high	47 Å²	47	85.1 Å²	85.1	49%	0.485	46%	0.463	S	S	.	.	H	α-helix	trans	-61.1	-46.7	178.7	0	0	0	0	0	112.3	N33 I37 I38 T39	N33-G35 VanDerWaalsContact C-N 3.3Å; N33-G35 PolarHBondContact O-N 3.03Å; G35-I37 PolarHBondContact O-N 3.33Å; G35-I38 PolarHBondContact O-N 2.96Å; G35-T39 WeakPolarHBondContact O-CG2 3.46Å; G35-T39 PolarHBondContact O-N 3.46Å; G35-T39 PolarHBondContact O-OG1 3.46Å
36	V	96.7	Very high	95.4	Very high	82 Å²	82	88 Å²	88	50%	0.497	48%	0.48	S	S	.	.	H	α-helix	trans	-63	-43.5	179.8	-178.9	0	0	0	0	111.3	N33 I38 T39 M40	N33-V36 PolarHBondContact O-N 2.95Å; N33-V36 VanDerWaalsContact O-N 3.15Å; V36-I38 VanDerWaalsContact C-N 3.34Å; V36-I38 PolarHBondContact O-N 3.33Å; V36-T39 WeakPolarHBondContact CA-OG1 3.29Å; V36-T39 PolarHBondContact O-N 3Å; V36-T39 PolarHBondContact O-OG1 3.47Å; V36-M40 HydrophobicContact CG1-CG 4.33Å; V36-M40 HydrophobicContact CG1-SD 3.92Å; V36-M40 WeakPolarHBondContact O-CB 3.23Å; V36-M40 WeakPolarHBondContact O-CG 3.44Å; V36-M40 PolarHBondContact O-N 2.88Å
37	I	96	Very high	95.6	Very high	75 Å²	75	81.5 Å²	81.5	39%	0.385	47%	0.466	S	S	.	.	H	α-helix	trans	-65.1	-41.9	179.8	-58.1	159.7	0	0	0	110.5	I28 N33 R34 G35 M40 L41	I28-I37 HydrophobicContact CD1-CB 4.08Å; I28-I37 HydrophobicContact CD1-CG2 3.36Å; N33-I37 HydrophobicContact CB-CD1 4.27Å; N33-I37 WeakPolarHBondContact O-CG1 3.29Å; N33-I37 PolarHBondContact O-N 3.37Å; R34-I37 PolarHBondContact O-N 3.49Å; G35-I37 PolarHBondContact O-N 3.33Å; I37-M40 PolarHBondContact O-N 2.71Å; I37-L41 HydrophobicContact CG2-CD1 4.33Å; I37-L41 WeakPolarHBondContact O-CG 3.44Å; I37-L41 PolarHBondContact O-N 3.06Å
38	I	96.4	Very high	95.8	Very high	37 Å²	37	76.9 Å²	76.9	19%	0.19	45%	0.451	C	S	.	.	H	α-helix	trans	-62.9	-46.8	177.1	-69.4	170.9	0	0	0	110.9	P25 I28 R34 G35 V36 M40 L41 V42	P25-I38 HydrophobicContact CB-CG1 4.09Å; P25-I38 HydrophobicContact CB-CG2 4.01Å; P25-I38 HydrophobicContact CG-CG2 4.47Å; I28-I38 HydrophobicContact CD1-CG1 4.23Å; R34-I38 HydrophobicContact CG-CD1 3.8Å; R34-I38 VanDerWaalsContact O-CG1 3.27Å; R34-I38 WeakPolarHBondContact O-CG1 3.45Å; R34-I38 PolarHBondContact O-N 2.91Å; R34-I38 VanDerWaalsContact O-N 3.09Å; G35-I38 PolarHBondContact O-N 2.96Å; V36-I38 VanDerWaalsContact C-N 3.34Å; V36-I38 PolarHBondContact O-N 3.33Å; I38-M40 VanDerWaalsContact C-N 3.33Å; I38-M40 PolarHBondContact O-N 3.22Å; I38-L41 PolarHBondContact O-N 3.43Å; I38-V42 HydrophobicContact CG2-CG2 4.19Å; I38-V42 VanDerWaalsContact O-CG2 3.28Å; I38-V42 WeakPolarHBondContact O-CG2 3.32Å; I38-V42 PolarHBondContact O-N 2.8Å
39	T	96	Very high	96	Very high	81 Å²	81	78.6 Å²	78.6	50%	0.497	46%	0.457	S	S	.	.	H	α-helix	trans	-65.1	-38.1	-180	55.4	0	0	0	0	111.7	G35 V36 T43	G35-T39 WeakPolarHBondContact O-CG2 3.46Å; G35-T39 PolarHBondContact O-N 3.46Å; G35-T39 PolarHBondContact O-OG1 3.46Å; V36-T39 WeakPolarHBondContact CA-OG1 3.29Å; V36-T39 PolarHBondContact O-N 3Å; V36-T39 PolarHBondContact O-OG1 3.47Å; T39-T43 VanDerWaalsContact O-CB 3.23Å; T39-T43 WeakPolarHBondContact O-CB 3.42Å; T39-T43 PolarHBondContact O-N 3.39Å; T39-T43 PolarHBondContact O-OG1 3Å
40	M	96.8	Very high	96.2	Very high	127 Å²	127	77.5 Å²	77.5	63%	0.626	44%	0.444	S	S	*	.	H	α-helix	trans	-61.9	-45.7	173.9	-72.2	177.7	80.8	0	0	111.8	V36 I37 I38 C44	V36-M40 HydrophobicContact CG1-CG 4.33Å; V36-M40 HydrophobicContact CG1-SD 3.92Å; V36-M40 WeakPolarHBondContact O-CB 3.23Å; V36-M40 WeakPolarHBondContact O-CG 3.44Å; V36-M40 PolarHBondContact O-N 2.88Å; I37-M40 PolarHBondContact O-N 2.71Å; I38-M40 VanDerWaalsContact C-N 3.33Å; I38-M40 PolarHBondContact O-N 3.22Å; M40-C44 WeakPolarHBondContact O-CB 3.28Å; M40-C44 PolarHBondContact O-N 3.48Å
41	L	96.6	Very high	96.4	Very high	46 Å²	46	75.4 Å²	75.4	24%	0.241	44%	0.436	C	S	.	.	H	α-helix	trans	-64.8	-47.3	178.3	-75.8	176.7	0	0	0	112.6	V24 I28 I37 I38 C44 S45	V24-L41 HydrophobicContact CG1-CD1 3.84Å; I28-L41 HydrophobicContact CD1-CD1 3.54Å; I37-L41 HydrophobicContact CG2-CD1 4.33Å; I37-L41 WeakPolarHBondContact O-CG 3.44Å; I37-L41 PolarHBondContact O-N 3.06Å; I38-L41 PolarHBondContact O-N 3.43Å; L41-C44 PolarHBondContact O-N 2.94Å; L41-S45 WeakPolarHBondContact O-CB 3.04Å; L41-S45 PolarHBondContact O-N 2.92Å; L41-S45 PolarHBondContact O-OG 2.68Å
42	V	97.2	Very high	96.6	Very high	56 Å²	56	76 Å²	76	34%	0.339	43%	0.425	S	S	.	.	H	α-helix	trans	-62.9	-50.4	180	175	0	0	0	0	109.9	G21 P25 I38 C44 S45 V46	G21-V42 WeakPolarHBondContact O-CG2 3.5Å; P25-V42 HydrophobicContact CG-CG2 4.2Å; I38-V42 HydrophobicContact CG2-CG2 4.19Å; I38-V42 VanDerWaalsContact O-CG2 3.28Å; I38-V42 WeakPolarHBondContact O-CG2 3.32Å; I38-V42 PolarHBondContact O-N 2.8Å; V42-C44 PolarHBondContact O-N 3.31Å; V42-S45 PolarHBondContact O-N 3.12Å; V42-S45 PolarHBondContact O-OG 2.94Å; V42-V46 WeakPolarHBondContact O-CG2 3.27Å; V42-V46 PolarHBondContact O-N 3.35Å
43	T	97.4	Very high	96.5	Very high	83 Å²	83	70.9 Å²	70.9	51%	0.509	39%	0.39	S	S	.	.	H	α-helix	trans	-61.7	-44.6	-179.3	-50.6	0	0	0	0	111.1	T39 S45 V46 C47	T39-T43 VanDerWaalsContact O-CB 3.23Å; T39-T43 WeakPolarHBondContact O-CB 3.42Å; T39-T43 PolarHBondContact O-N 3.39Å; T39-T43 PolarHBondContact O-OG1 3Å; T43-S45 PolarHBondContact O-N 3.48Å; T43-V46 PolarHBondContact O-N 3.38Å; T43-C47 WeakPolarHBondContact O-CB 3.32Å; T43-C47 PolarHBondContact O-N 3.47Å; T43-C47 PolarHBondContact O-SG 2.84Å
44	C	96.9	Very high	96.6	Very high	63 Å²	63	71 Å²	71	43%	0.426	39%	0.389	S	S	.	.	H	α-helix	trans	-58.3	-48.9	175.3	177.7	0	0	0	0	111.4	M40 L41 V42 V46 C47 C48	M40-C44 WeakPolarHBondContact O-CB 3.28Å; M40-C44 PolarHBondContact O-N 3.48Å; L41-C44 PolarHBondContact O-N 2.94Å; V42-C44 PolarHBondContact O-N 3.31Å; C44-V46 VanDerWaalsContact C-N 3.34Å; C44-V46 PolarHBondContact O-N 2.84Å; C44-C47 PolarHBondContact O-N 3.05Å; C44-C48 VanDerWaalsContact O-CB 3.32Å; C44-C48 WeakPolarHBondContact O-CB 3.41Å; C44-C48 PolarHBondContact O-N 3.08Å; C44-C48 PolarHBondContact O-SG 3.32Å
45	S	97.4	Very high	96.6	Very high	7 Å²	7	69.1 Å²	69.1	5%	0.049	39%	0.393	C	S	.	.	H	α-helix	trans	-59.3	-43.1	-178.4	71.1	0	0	0	0	112.8	G21 L41 V42 T43 Y49	G21-S45 VanDerWaalsContact CA-OG 3.23Å; G21-S45 WeakPolarHBondContact CA-OG 3.38Å; L41-S45 WeakPolarHBondContact O-CB 3.04Å; L41-S45 PolarHBondContact O-N 2.92Å; L41-S45 PolarHBondContact O-OG 2.68Å; V42-S45 PolarHBondContact O-N 3.12Å; V42-S45 PolarHBondContact O-OG 2.94Å; T43-S45 PolarHBondContact O-N 3.48Å; S45-Y49 WeakPolarHBondContact O-CB 3.29Å; S45-Y49 PolarHBondContact O-N 2.98Å
46	V	97.4	Very high	96.6	Very high	73 Å²	73	68.7 Å²	68.7	44%	0.442	38%	0.379	S	S	.	.	H	α-helix	trans	-66.8	-49.6	177.8	174.5	0	0	0	0	111	V42 T43 C44 Y49 L50	V42-V46 WeakPolarHBondContact O-CG2 3.27Å; V42-V46 PolarHBondContact O-N 3.35Å; T43-V46 PolarHBondContact O-N 3.38Å; C44-V46 VanDerWaalsContact C-N 3.34Å; C44-V46 PolarHBondContact O-N 2.84Å; V46-Y49 PolarHBondContact O-N 3.36Å; V46-L50 HydrophobicContact CG1-CD1 3.79Å; V46-L50 HydrophobicContact CG1-CG 4.38Å; V46-L50 WeakPolarHBondContact O-CB 3.23Å; V46-L50 VanDerWaalsContact O-CG 3.29Å; V46-L50 WeakPolarHBondContact O-CG 3.2Å; V46-L50 PolarHBondContact O-N 3.37Å
47	C	97.8	Very high	96.3	Very high	74 Å²	74	69 Å²	69	50%	0.5	38%	0.377	S	S	.	.	H	α-helix	trans	-62.1	-46.5	-178.6	-68.6	0	0	0	0	112.1	T43 C44 L50 F51	T43-C47 WeakPolarHBondContact O-CB 3.32Å; T43-C47 PolarHBondContact O-N 3.47Å; T43-C47 PolarHBondContact O-SG 2.84Å; C44-C47 PolarHBondContact O-N 3.05Å; C47-L50 PolarHBondContact O-N 3.28Å; C47-F51 VanDerWaalsContact O-CB 3.3Å; C47-F51 WeakPolarHBondContact O-CB 3.3Å; C47-F51 PolarHBondContact O-N 3.35Å
48	C	97.3	Very high	96.2	Very high	50 Å²	50	69.2 Å²	69.2	34%	0.338	39%	0.39	S	S	.	.	H	α-helix	trans	-67.2	-40.7	-179.2	-67.8	0	0	0	0	112	W17 C44 W52	W17-C48 HydrophobicContact CD2-CB 4.35Å; W17-C48 HydrophobicContact CE3-CB 4.46Å; W17-C48 HydrophobicContact CH2-CB 3.53Å; W17-C48 HydrophobicContact CZ2-CB 3.4Å; W17-C48 HydrophobicContact CZ3-CB 4.08Å; C44-C48 VanDerWaalsContact O-CB 3.32Å; C44-C48 WeakPolarHBondContact O-CB 3.41Å; C44-C48 PolarHBondContact O-N 3.08Å; C44-C48 PolarHBondContact O-SG 3.32Å; C48-W52 WeakPolarHBondContact O-CB 3.37Å; C48-W52 PolarHBondContact O-N 2.9Å; C48-W52 VanDerWaalsContact O-N 3.08Å
49	Y	97.3	Very high	95.9	Very high	60 Å²	60	74.2 Å²	74.2	24%	0.235	41%	0.413	C	S	.	.	H	α-helix	trans	-64	-46.9	175.4	177.9	-106.7	0	0	0	111.9	S14 W17 S45 V46 W52 L53	S14-Y49 WeakPolarHBondContact OG-CE2 3.31Å; S14-Y49 PolarHBondContact OG-OH 3.15Å; W17-Y49 HydrophobicContact CB-CD2 4.2Å; W17-Y49 HydrophobicContact CB-CG 4.37Å; W17-Y49 HydrophobicContact CG-CD2 4.41Å; S45-Y49 WeakPolarHBondContact O-CB 3.29Å; S45-Y49 PolarHBondContact O-N 2.98Å; V46-Y49 PolarHBondContact O-N 3.36Å; Y49-W52 HydrophobicContact CD2-CE3 4.39Å; Y49-W52 HydrophobicContact CE2-CE3 4.31Å; Y49-W52 HydrophobicContact CE2-CZ3 4.24Å; Y49-W52 PolarHBondContact O-N 3.42Å; Y49-L53 HydrophobicContact CE1-CD2 3.87Å; Y49-L53 VanDerWaalsContact O-CB 3.23Å; Y49-L53 WeakPolarHBondContact O-CB 3.41Å; Y49-L53 PolarHBondContact O-N 3.24Å
50	L	96.9	Very high	95.6	Very high	85 Å²	85	73 Å²	73	45%	0.445	40%	0.403	S	S	.	.	H	α-helix	trans	-62.8	-45	178.9	-74.4	175	0	0	0	111.9	V46 C47 W52 L53 I54	V46-L50 HydrophobicContact CG1-CD1 3.79Å; V46-L50 HydrophobicContact CG1-CG 4.38Å; V46-L50 WeakPolarHBondContact O-CB 3.23Å; V46-L50 VanDerWaalsContact O-CG 3.29Å; V46-L50 WeakPolarHBondContact O-CG 3.2Å; V46-L50 PolarHBondContact O-N 3.37Å; C47-L50 PolarHBondContact O-N 3.28Å; L50-W52 VanDerWaalsContact C-N 3.34Å; L50-W52 PolarHBondContact O-N 3.15Å; L50-L53 PolarHBondContact O-N 3.44Å; L50-I54 WeakPolarHBondContact O-CB 3.25Å; L50-I54 WeakPolarHBondContact O-CD1 3.44Å; L50-I54 WeakPolarHBondContact O-CG1 3.43Å; L50-I54 PolarHBondContact O-N 3.25Å
51	F	97.5	Very high	95.4	Very high	163 Å²	163	73 Å²	73	72%	0.715	41%	0.406	S	S	*	.	H	α-helix	trans	-56.7	-49.1	177.1	177.9	-96.2	0	0	0	111.4	C47 A55	C47-F51 VanDerWaalsContact O-CB 3.3Å; C47-F51 WeakPolarHBondContact O-CB 3.3Å; C47-F51 PolarHBondContact O-N 3.35Å; F51-A55 PolarHBondContact O-N 3.3Å
52	W	96.5	Very high	95.2	Very high	52 Å²	52	75.3 Å²	75.3	20%	0.197	42%	0.424	C	S	.	.	H	α-helix	trans	-63.5	-46.9	177.7	173.7	82.1	0	0	0	112.3	P9 L10 M13 C48 Y49 L50 I54 A55 I56	P9-W52 HydrophobicContact CB-CZ2 4.19Å; L10-W52 HydrophobicContact CD2-CH2 3.9Å; L10-W52 HydrophobicContact CD2-CZ3 4.06Å; L10-W52 HydrophobicContact CG-CH2 4.47Å; M13-W52 HydrophobicContact CB-CD2 4.23Å; M13-W52 HydrophobicContact CB-CE3 3.91Å; M13-W52 HydrophobicContact CB-CH2 3.63Å; M13-W52 HydrophobicContact CB-CZ2 3.97Å; M13-W52 HydrophobicContact CB-CZ3 3.6Å; M13-W52 HydrophobicContact CG-CD2 4.15Å; M13-W52 HydrophobicContact CG-CE3 4.32Å; M13-W52 HydrophobicContact CG-CH2 3.76Å; M13-W52 HydrophobicContact CG-CZ2 3.55Å; M13-W52 HydrophobicContact CG-CZ3 4.14Å; C48-W52 WeakPolarHBondContact O-CB 3.37Å; C48-W52 PolarHBondContact O-N 2.9Å; C48-W52 VanDerWaalsContact O-N 3.08Å; Y49-W52 HydrophobicContact CD2-CE3 4.39Å; Y49-W52 HydrophobicContact CE2-CE3 4.31Å; Y49-W52 HydrophobicContact CE2-CZ3 4.24Å; Y49-W52 PolarHBondContact O-N 3.42Å; L50-W52 VanDerWaalsContact C-N 3.34Å; L50-W52 PolarHBondContact O-N 3.15Å; W52-I54 PolarHBondContact O-N 3.33Å; W52-A55 PolarHBondContact O-N 3.27Å; W52-I56 HydrophobicContact CD2-CG1 4.38Å; W52-I56 HydrophobicContact CZ2-CG1 3.87Å; W52-I56 PolarHBondContact O-N 2.94Å; W52-I56 VanDerWaalsContact O-N 3.15Å
53	L	95.6	Very high	95.1	Very high	32 Å²	32	79.6 Å²	79.6	17%	0.168	44%	0.443	C	S	.	.	H	α-helix	trans	-61.2	-45.9	-176.9	-179.9	64.5	0	0	0	111	L10 Y49 L50 A55 I56 L57	L10-L53 HydrophobicContact CD2-CD1 3.84Å; Y49-L53 HydrophobicContact CE1-CD2 3.87Å; Y49-L53 VanDerWaalsContact O-CB 3.23Å; Y49-L53 WeakPolarHBondContact O-CB 3.41Å; Y49-L53 PolarHBondContact O-N 3.24Å; L50-L53 PolarHBondContact O-N 3.44Å; L53-A55 VanDerWaalsContact C-N 3.34Å; L53-A55 PolarHBondContact O-N 3.44Å; L53-I56 PolarHBondContact O-N 3.3Å; L53-L57 HydrophobicContact CD1-CD1 4.1Å; L53-L57 HydrophobicContact CD1-CG 4.08Å; L53-L57 HydrophobicContact CD2-CD1 4.39Å; L53-L57 HydrophobicContact CG-CD1 3.83Å; L53-L57 HydrophobicContact CG-CG 4.2Å; L53-L57 WeakPolarHBondContact O-CB 3.43Å; L53-L57 VanDerWaalsContact O-CG 3.25Å; L53-L57 WeakPolarHBondContact O-CG 3.21Å; L53-L57 PolarHBondContact O-N 2.95Å
54	I	96.5	Very high	94.9	Very high	110 Å²	110	84.3 Å²	84.3	56%	0.564	46%	0.457	S	S	*	.	H	α-helix	trans	-61.9	-43.7	179.5	-66.9	165.1	0	0	0	110.6	L50 W52 I56 L57 A58	L50-I54 WeakPolarHBondContact O-CB 3.25Å; L50-I54 WeakPolarHBondContact O-CD1 3.44Å; L50-I54 WeakPolarHBondContact O-CG1 3.43Å; L50-I54 PolarHBondContact O-N 3.25Å; W52-I54 PolarHBondContact O-N 3.33Å; I54-I56 VanDerWaalsContact C-N 3.29Å; I54-I56 PolarHBondContact O-N 2.88Å; I54-L57 PolarHBondContact O-N 3.45Å; I54-A58 WeakPolarHBondContact O-CB 3.44Å; I54-A58 PolarHBondContact O-N 3.45Å
55	A	94.9	Very high	94.8	Very high	48 Å²	48	83.6 Å²	83.6	40%	0.397	46%	0.461	S	S	.	.	H	α-helix	trans	-59.2	-40.7	179	0	0	0	0	0	112.4	F51 W52 L53	F51-A55 PolarHBondContact O-N 3.3Å; W52-A55 PolarHBondContact O-N 3.27Å; L53-A55 VanDerWaalsContact C-N 3.34Å; L53-A55 PolarHBondContact O-N 3.44Å
56	I	92.8	Very high	94.7	Very high	38 Å²	38	88.6 Å²	88.6	20%	0.195	49%	0.493	C	S	.	.	H	α-helix	trans	-72	-44.8	176.9	-70.9	-59.1	0	0	0	111.9	L6 W52 L53 I54 A58 Q59 L60	L6-I56 HydrophobicContact CD1-CG2 3.4Å; L6-I56 HydrophobicContact CD2-CG2 3.96Å; L6-I56 HydrophobicContact CG-CG2 4.25Å; W52-I56 HydrophobicContact CD2-CG1 4.38Å; W52-I56 HydrophobicContact CZ2-CG1 3.87Å; W52-I56 PolarHBondContact O-N 2.94Å; W52-I56 VanDerWaalsContact O-N 3.15Å; L53-I56 PolarHBondContact O-N 3.3Å; I54-I56 VanDerWaalsContact C-N 3.29Å; I54-I56 PolarHBondContact O-N 2.88Å; I56-A58 PolarHBondContact O-N 3Å; I56-Q59 PolarHBondContact O-N 3.3Å; I56-L60 PolarHBondContact O-N 3.43Å
57	L	91.4	Very high	94.6	Very high	89 Å²	89	93.9 Å²	93.9	47%	0.466	51%	0.513	S	S	.	.	H	α-helix	trans	-61.9	-33.4	179.5	-70.9	178.7	0	0	0	111.6	L53 I54 Q59 L60	L53-L57 HydrophobicContact CD1-CD1 4.1Å; L53-L57 HydrophobicContact CD1-CG 4.08Å; L53-L57 HydrophobicContact CD2-CD1 4.39Å; L53-L57 HydrophobicContact CG-CD1 3.83Å; L53-L57 HydrophobicContact CG-CG 4.2Å; L53-L57 WeakPolarHBondContact O-CB 3.43Å; L53-L57 VanDerWaalsContact O-CG 3.25Å; L53-L57 WeakPolarHBondContact O-CG 3.21Å; L53-L57 PolarHBondContact O-N 2.95Å; I54-L57 PolarHBondContact O-N 3.45Å; L57-Q59 PolarHBondContact O-N 3.33Å; L57-L60 HydrophobicContact CD2-CD1 3.45Å; L57-L60 VanDerWaalsContact CD2-CD1 3.45Å; L57-L60 PolarHBondContact O-N 3.23Å
58	A	93.6	Very high	94.5	Very high	80 Å²	80	94 Å²	94	66%	0.661	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.1	-21.6	175	0	0	0	0	0	113.5	I54 I56	I54-A58 WeakPolarHBondContact O-CB 3.44Å; I54-A58 PolarHBondContact O-N 3.45Å; I56-A58 PolarHBondContact O-N 3Å
59	Q	91.1	Very high	94.5	Very high	142 Å²	142	99.6 Å²	99.6	66%	0.664	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.6	-4.2	-178.1	-64.4	-179.3	-9.5	0	0	113.9	I56 L57 N61 P62	I56-Q59 PolarHBondContact O-N 3.3Å; L57-Q59 PolarHBondContact O-N 3.33Å; Q59-N61 PolarHBondContact O-N 2.95Å; Q59-P62 WeakPolarHBondContact O-CD 3.47Å
60	L	89	Confident	94.5	Very high	54 Å²	54	102.4 Å²	102.4	28%	0.283	55%	0.546	S	S	.	.	S	Bend	trans	-65.5	-37.8	-173.3	-97.7	172.2	0	0	0	114.3	L6 I56 L57	L6-L60 HydrophobicContact CD2-CD1 4.02Å; L6-L60 HydrophobicContact CD2-CD2 3.39Å; L6-L60 HydrophobicContact CD2-CG 3.81Å; I56-L60 PolarHBondContact O-N 3.43Å; L57-L60 HydrophobicContact CD2-CD1 3.45Å; L57-L60 VanDerWaalsContact CD2-CD1 3.45Å; L57-L60 PolarHBondContact O-N 3.23Å
61	N	91.3	Very high	94.5	Very high	128 Å²	128	105.7 Å²	105.7	68%	0.684	56%	0.559	S	S	*	*	S	Bend	trans	-133.3	74.4	179.9	-64	-67.5	0	0	0	109.1	Q59	Q59-N61 PolarHBondContact O-N 2.95Å
62	P	93	Very high	94.5	Very high	95 Å²	95	100.8 Å²	100.8	62%	0.617	54%	0.543	S	S	*	.			trans	-70.2	137.2	-175.7	29.7	-33	0	0	0	110.3	Q59	Q59-P62 WeakPolarHBondContact O-CD 3.47Å
63	L	94.6	Very high	94.4	Very high	145 Å²	145	102.2 Å²	102.2	76%	0.759	55%	0.553	S	S	*	*	S	Bend	trans	-81.8	-28.8	176	-76.7	75.6	0	0	0	112
64	F	94.6	Very high	94.4	Very high	183 Å²	183	108.8 Å²	108.8	80%	0.803	58%	0.576	S	S	*	*			trans	-138.9	148.5	-174.9	-51.9	-73.4	0	0	0	110.6
65	G	94.1	Very high	94.4	Very high	48 Å²	48	110.4 Å²	110.4	50%	0.495	58%	0.576	S	S	.	*			trans	-99.2	168.6	174	0	0	0	0	0	113.1	Q67	G65-Q67 PolarHBondContact O-NE2 3.31Å
66	P	95.5	Very high	94.5	Very high	112 Å²	112	112 Å²	112	73%	0.727	58%	0.577	S	S	*	*			trans	-63.9	141	176.8	28.3	-34.6	0	0	0	111.5	L68	P66-L68 HydrophobicContact CB-CD1 3.9Å; P66-L68 HydrophobicContact CG-CD1 3.87Å
67	Q	95.6	Very high	94.6	Very high	183 Å²	183	117.2 Å²	117.2	86%	0.855	60%	0.599	S	S	*	*			trans	-97.7	111.2	175.6	-61	-61.6	-62.4	0	0	109.2	G65	G65-Q67 PolarHBondContact O-NE2 3.31Å
68	L	95.9	Very high	94.8	Very high	78 Å²	78	122 Å²	122	41%	0.408	61%	0.612	S	S	.	*			trans	-116.5	151.7	-175.2	-66.1	117.9	0	0	0	111.8	P66 T72 I73 L76	P66-L68 HydrophobicContact CB-CD1 3.9Å; P66-L68 HydrophobicContact CG-CD1 3.87Å; L68-T72 HydrophobicContact CD2-CG2 3.67Å; L68-I73 HydrophobicContact CB-CD1 4.2Å; L68-I73 HydrophobicContact CB-CG1 3.77Å; L68-L76 HydrophobicContact CD2-CD1 3.76Å
69	K	97.3	Very high	95	Very high	167 Å²	167	123.1 Å²	123.1	73%	0.726	60%	0.603	S	S	*	*			trans	-76.3	150.4	171.8	-66.8	179.2	178.7	178.7	0	110.3	E71 T72 I73	K69-E71 VanDerWaalsContact C-N 3.3Å; K69-E71 PolarHBondContact O-N 2.81Å; K69-T72 WeakPolarHBondContact O-CB 3.41Å; K69-T72 PolarHBondContact O-N 2.95Å; K69-I73 WeakPolarHBondContact O-CG1 3.1Å; K69-I73 PolarHBondContact O-N 3.21Å
70	N	96.7	Very high	95.1	Very high	118 Å²	118	126.7 Å²	126.7	63%	0.631	61%	0.611	S	S	*	*	H	α-helix	trans	-52.9	-44.3	-179.2	-78.4	-4.1	0	0	0	113.2	T72 I73 W74	N70-T72 VanDerWaalsContact C-N 3.29Å; N70-T72 PolarHBondContact O-N 3.33Å; N70-I73 PolarHBondContact O-N 3.12Å; N70-I73 VanDerWaalsContact O-N 3.16Å; N70-W74 VanDerWaalsContact O-CD1 3.25Å; N70-W74 PolarHBondContact O-N 3.43Å
71	E	97.1	Very high	94.7	Very high	154 Å²	154	132.3 Å²	132.3	72%	0.72	65%	0.65	S	S	*	*	H	α-helix	trans	-57.9	-41.8	177.3	-53.8	-55.3	149.9	0	0	112	K69 W74 Y75	K69-E71 VanDerWaalsContact C-N 3.3Å; K69-E71 PolarHBondContact O-N 2.81Å; E71-W74 PolarHBondContact O-N 3.38Å; E71-Y75 WeakPolarHBondContact O-CB 3.17Å; E71-Y75 PolarHBondContact O-N 3.38Å
72	T	96.5	Very high	94.8	Very high	61 Å²	61	132.5 Å²	132.5	37%	0.374	65%	0.648	S	S	.	*	H	α-helix	trans	-69.4	-36.2	178.4	-47.5	0	0	0	0	111.8	L68 K69 N70 Y75 L76	L68-T72 HydrophobicContact CD2-CG2 3.67Å; K69-T72 WeakPolarHBondContact O-CB 3.41Å; K69-T72 PolarHBondContact O-N 2.95Å; N70-T72 VanDerWaalsContact C-N 3.29Å; N70-T72 PolarHBondContact O-N 3.33Å; T72-Y75 PolarHBondContact O-N 2.97Å; T72-L76 HydrophobicContact CG2-CD1 4.15Å; T72-L76 WeakPolarHBondContact O-CB 3.44Å; T72-L76 WeakPolarHBondContact O-CG 3.48Å; T72-L76 PolarHBondContact O-N 3.38Å
73	I	96.3	Very high	94.9	Very high	81 Å²	81	134.5 Å²	134.5	42%	0.415	65%	0.65	S	S	.	*	H	α-helix	trans	-64.8	-45.9	176.1	-65	168.5	0	0	0	110.2	L68 K69 N70 L76 K77	L68-I73 HydrophobicContact CB-CD1 4.2Å; L68-I73 HydrophobicContact CB-CG1 3.77Å; K69-I73 WeakPolarHBondContact O-CG1 3.1Å; K69-I73 PolarHBondContact O-N 3.21Å; N70-I73 PolarHBondContact O-N 3.12Å; N70-I73 VanDerWaalsContact O-N 3.16Å; I73-L76 PolarHBondContact O-N 2.9Å; I73-K77 WeakPolarHBondContact O-CB 3.42Å; I73-K77 PolarHBondContact O-N 2.97Å
74	W	95.6	Very high	94.9	Very high	170 Å²	170	133.9 Å²	133.9	64%	0.644	64%	0.644	S	S	*	*	H	α-helix	trans	-61.4	-44.5	176	-81.7	112.6	0	0	0	112.1	N70 E71 K77 Y78	N70-W74 VanDerWaalsContact O-CD1 3.25Å; N70-W74 PolarHBondContact O-N 3.43Å; E71-W74 PolarHBondContact O-N 3.38Å; W74-K77 PolarHBondContact O-N 3.45Å; W74-Y78 PolarHBondContact O-N 3.16Å; W74-Y78 VanDerWaalsContact O-N 3.12Å
75	Y	96.5	Very high	95	Very high	144 Å²	144	131 Å²	131	57%	0.565	64%	0.635	S	S	*	*	H	α-helix	trans	-59.1	-49.3	175.7	-177.6	-89.2	0	0	0	112	E71 T72 K77 Y78 H79	E71-Y75 WeakPolarHBondContact O-CB 3.17Å; E71-Y75 PolarHBondContact O-N 3.38Å; T72-Y75 PolarHBondContact O-N 2.97Å; Y75-K77 VanDerWaalsContact C-N 3.35Å; Y75-K77 PolarHBondContact O-N 2.97Å; Y75-Y78 PolarHBondContact O-N 3.03Å; Y75-H79 AromaticContact CD1-CD2 3.84Å; Y75-H79 AromaticContact CD2-CD2 3.44Å; Y75-H79 VanDerWaalsContact CD2-CD2 3.44Å; Y75-H79 WeakPolarHBondContact CD2-CD2 3.39Å; Y75-H79 AromaticContact CD2-NE2 3.66Å; Y75-H79 HydrophobicContact CE1-CB 4.31Å; Y75-H79 AromaticContact CE1-CD2 3.58Å; Y75-H79 AromaticContact CE1-CG 4Å; Y75-H79 AromaticContact CE2-CD2 3.17Å; Y75-H79 WeakPolarHBondContact CE2-CD2 3.5Å; Y75-H79 AromaticContact CE2-NE2 3.1Å; Y75-H79 WeakPolarHBondContact CE2-NE2 3.41Å; Y75-H79 AromaticContact CG-CD2 3.77Å; Y75-H79 AromaticContact CZ-CD2 3.23Å; Y75-H79 AromaticContact CZ-CG 3.83Å; Y75-H79 AromaticContact CZ-NE2 3.44Å; Y75-H79 WeakPolarHBondContact O-CB 3.4Å; Y75-H79 PolarHBondContact O-CD2 2.98Å; Y75-H79 VanDerWaalsContact O-CD2 3.31Å; Y75-H79 PolarHBondContact O-N 3.45Å
76	L	96.2	Very high	95	Very high	82 Å²	82	136.2 Å²	136.2	43%	0.429	64%	0.643	S	S	.	*	H	α-helix	trans	-59.9	-44	178.4	-82.1	162.8	0	0	0	111.9	L68 T72 I73 Y78 H79 W80	L68-L76 HydrophobicContact CD2-CD1 3.76Å; T72-L76 HydrophobicContact CG2-CD1 4.15Å; T72-L76 WeakPolarHBondContact O-CB 3.44Å; T72-L76 WeakPolarHBondContact O-CG 3.48Å; T72-L76 PolarHBondContact O-N 3.38Å; I73-L76 PolarHBondContact O-N 2.9Å; L76-Y78 VanDerWaalsContact C-N 3.26Å; L76-Y78 PolarHBondContact O-N 3.5Å; L76-H79 PolarHBondContact O-N 3.35Å; L76-W80 CarbonylContact O-C 3.58Å; L76-W80 WeakPolarHBondContact O-CA 3.42Å; L76-W80 PolarHBondContact O-N 3.24Å
77	K	94.9	Very high	95	Very high	148 Å²	148	137.8 Å²	137.8	64%	0.643	64%	0.638	S	S	*	*	H	α-helix	trans	-61.5	-34.5	178.6	-176.7	176.2	-179.8	179.5	0	112.8	I73 W74 Y75	I73-K77 WeakPolarHBondContact O-CB 3.42Å; I73-K77 PolarHBondContact O-N 2.97Å; W74-K77 PolarHBondContact O-N 3.45Å; Y75-K77 VanDerWaalsContact C-N 3.35Å; Y75-K77 PolarHBondContact O-N 2.97Å
78	Y	96.3	Very high	95	Very high	189 Å²	189	134.6 Å²	134.6	74%	0.741	62%	0.622	S	S	*	*	H	α-helix	trans	-79.2	-41.4	178.7	-176.9	-98.4	0	0	0	112.4	W74 Y75 L76	W74-Y78 PolarHBondContact O-N 3.16Å; W74-Y78 VanDerWaalsContact O-N 3.12Å; Y75-Y78 PolarHBondContact O-N 3.03Å; L76-Y78 VanDerWaalsContact C-N 3.26Å; L76-Y78 PolarHBondContact O-N 3.5Å
79	H	96.9	Very high	94.9	Very high	104 Å²	104	138.9 Å²	138.9	48%	0.481	64%	0.639	S	S	.	*	H	α-helix	trans	-87	-26.1	-174.6	-78.3	-77.9	0	0	0	114.8	Y75 L76	Y75-H79 AromaticContact CD1-CD2 3.84Å; Y75-H79 AromaticContact CD2-CD2 3.44Å; Y75-H79 VanDerWaalsContact CD2-CD2 3.44Å; Y75-H79 WeakPolarHBondContact CD2-CD2 3.39Å; Y75-H79 AromaticContact CD2-NE2 3.66Å; Y75-H79 HydrophobicContact CE1-CB 4.31Å; Y75-H79 AromaticContact CE1-CD2 3.58Å; Y75-H79 AromaticContact CE1-CG 4Å; Y75-H79 AromaticContact CE2-CD2 3.17Å; Y75-H79 WeakPolarHBondContact CE2-CD2 3.5Å; Y75-H79 AromaticContact CE2-NE2 3.1Å; Y75-H79 WeakPolarHBondContact CE2-NE2 3.41Å; Y75-H79 AromaticContact CG-CD2 3.77Å; Y75-H79 AromaticContact CZ-CD2 3.23Å; Y75-H79 AromaticContact CZ-CG 3.83Å; Y75-H79 AromaticContact CZ-NE2 3.44Å; Y75-H79 WeakPolarHBondContact O-CB 3.4Å; Y75-H79 PolarHBondContact O-CD2 2.98Å; Y75-H79 VanDerWaalsContact O-CD2 3.31Å; Y75-H79 PolarHBondContact O-N 3.45Å; L76-H79 PolarHBondContact O-N 3.35Å
80	W	93.9	Very high	94.7	Very high	217 Å²	217	136.6 Å²	136.6	82%	0.822	63%	0.631	S	S	*	*			trans	-129.6	75.2	-179.4	-161.6	-78.7	0	0	0	109.6	L76	L76-W80 CarbonylContact O-C 3.58Å; L76-W80 WeakPolarHBondContact O-CA 3.42Å; L76-W80 PolarHBondContact O-N 3.24Å
81	P	79.3	Confident	94.5	Very high	171 Å²	171	138.3 Å²	138.3	100%	1.11	63%	0.631	S	S	*	*			trans	-66.3	0	-176.7	28.9	-35.3	0	0	0	113.6

Retrieved 81 of 81 residues in 24.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).