A0A096NEC5_PAPAN Loading...

Secreted LY6/PLAUR domain containing 1

AlphaFold DB , UniProt , Accession A0A096NEC5, Species PAPAN (Papio anubis, Olive baboon), Gene SLURP1, Length 103 aa.

						>A0A096NEC5_PAPAN|A0A096NEC5|SLURP1
MASRWAVQLLLVAAWSMGCGEALKCYTCEQPMVSASCKTITHCKPEDTACMTTLVTVEAEFPFNQSPVVTRSCSRSCMATDPDSIGAAHLIYCCFRDLCNSEL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.7	Low	73.9	Confident	209 Å²	209	126.2 Å²	126.2	100%	1.03	65%	0.652	S	S	*	*				0	-36.6	0	-68.7	169.6	-153.6	0	0	112.9	S3 R4 W5	M1-S3 VanDerWaalsContact C-N 3.34Å; M1-S3 PolarHBondContact O-N 2.75Å; M1-R4 PolarHBondContact O-N 3.29Å; M1-W5 VanDerWaalsContact O-CD1 3.29Å
2	A	59.3	Low	74.6	Confident	83 Å²	83	123.9 Å²	123.9	69%	0.686	65%	0.648	S	S	*	*	H	α-helix	trans	-58.4	-33.6	179.2	0	0	0	0	0	116	R4 W5 A6	A2-R4 PolarHBondContact O-N 2.81Å; A2-W5 PolarHBondContact O-N 2.93Å; A2-A6 PolarHBondContact O-N 2.94Å
3	S	67.4	Low	75	Confident	89 Å²	89	118.6 Å²	118.6	62%	0.622	63%	0.633	S	S	*	*	H	α-helix	trans	-65.4	-32.4	-176.8	166.1	0	0	0	0	114.2	M1 W5 A6 V7	M1-S3 VanDerWaalsContact C-N 3.34Å; M1-S3 PolarHBondContact O-N 2.75Å; S3-W5 VanDerWaalsContact C-N 3.34Å; S3-W5 PolarHBondContact O-N 3.05Å; S3-A6 PolarHBondContact O-N 2.7Å; S3-V7 WeakPolarHBondContact O-CG2 3.14Å; S3-V7 PolarHBondContact O-N 3.4Å
4	R	74.3	Confident	75.1	Confident	207 Å²	207	114.7 Å²	114.7	78%	0.781	63%	0.625	S	S	*	*	H	α-helix	trans	-68.9	-33.8	-178.8	-65.3	-177.9	78	-177.1	3.5	112.4	M1 A2 Q8	M1-R4 PolarHBondContact O-N 3.29Å; A2-R4 PolarHBondContact O-N 2.81Å; R4-Q8 WeakPolarHBondContact O-CG 3.23Å; R4-Q8 PolarHBondContact O-N 3.46Å
5	W	73.9	Confident	75	Confident	193 Å²	193	121.9 Å²	121.9	73%	0.731	64%	0.64	S	S	*	*	H	α-helix	trans	-72	-38.7	178.2	-63.2	84.7	0	0	0	111.7	M1 A2 S3 V7 Q8 L9	M1-W5 VanDerWaalsContact O-CD1 3.29Å; A2-W5 PolarHBondContact O-N 2.93Å; S3-W5 VanDerWaalsContact C-N 3.34Å; S3-W5 PolarHBondContact O-N 3.05Å; W5-V7 PolarHBondContact O-N 2.86Å; W5-Q8 PolarHBondContact O-N 3.47Å; W5-L9 PolarHBondContact O-N 2.94Å
6	A	78.7	Confident	74.7	Confident	51 Å²	51	120.3 Å²	120.3	42%	0.421	64%	0.642	S	S	.	*	H	α-helix	trans	-62.9	-41.5	175.1	0	0	0	0	0	112	A2 S3 L9 L10	A2-A6 PolarHBondContact O-N 2.94Å; S3-A6 PolarHBondContact O-N 2.7Å; A6-L9 PolarHBondContact O-N 3.46Å; A6-L10 WeakPolarHBondContact O-CG 3.12Å; A6-L10 PolarHBondContact O-N 2.8Å; A6-L10 VanDerWaalsContact O-N 3.15Å
7	V	81.7	Confident	74.1	Confident	77 Å²	77	122.8 Å²	122.8	47%	0.467	65%	0.651	S	S	.	*	H	α-helix	trans	-65.6	-40.8	177.3	173.8	0	0	0	0	111.7	S3 W5 L10 L11	S3-V7 WeakPolarHBondContact O-CG2 3.14Å; S3-V7 PolarHBondContact O-N 3.4Å; W5-V7 PolarHBondContact O-N 2.86Å; V7-L10 PolarHBondContact O-N 3.28Å; V7-L11 HydrophobicContact CG1-CD1 3.9Å; V7-L11 WeakPolarHBondContact O-CD1 3.15Å; V7-L11 WeakPolarHBondContact O-CG 3.11Å; V7-L11 PolarHBondContact O-N 3.45Å; V7-L11 VanDerWaalsContact O-N 3.12Å
8	Q	80.4	Confident	73.3	Confident	135 Å²	135	119.6 Å²	119.6	63%	0.631	65%	0.652	S	S	*	*	H	α-helix	trans	-63	-42.4	176.9	-69.6	-100.5	-34.6	0	0	112.1	R4 W5 L10 L11 V12	R4-Q8 WeakPolarHBondContact O-CG 3.23Å; R4-Q8 PolarHBondContact O-N 3.46Å; W5-Q8 PolarHBondContact O-N 3.47Å; Q8-L10 PolarHBondContact O-N 3.25Å; Q8-L11 PolarHBondContact O-N 3.01Å; Q8-V12 WeakPolarHBondContact O-CG2 3.32Å; Q8-V12 PolarHBondContact O-N 3.18Å; Q8-V12 VanDerWaalsContact O-N 3.16Å
9	L	83.6	Confident	72.7	Confident	129 Å²	129	120 Å²	120	68%	0.675	66%	0.663	S	S	*	*	H	α-helix	trans	-63.3	-40.2	177	-80.5	160.3	0	0	0	112.5	W5 A6 V12 A13	W5-L9 PolarHBondContact O-N 2.94Å; A6-L9 PolarHBondContact O-N 3.46Å; L9-V12 PolarHBondContact O-N 2.81Å; L9-A13 PolarHBondContact O-N 3.49Å; L9-A13 VanDerWaalsContact O-N 3.08Å
10	L	80.9	Confident	72.3	Confident	125 Å²	125	117.8 Å²	117.8	65%	0.654	67%	0.669	S	S	*	*	H	α-helix	trans	-66.1	-38.4	177.6	-71.3	168.7	0	0	0	112.5	A6 V7 Q8 A13 A14	A6-L10 WeakPolarHBondContact O-CG 3.12Å; A6-L10 PolarHBondContact O-N 2.8Å; A6-L10 VanDerWaalsContact O-N 3.15Å; V7-L10 PolarHBondContact O-N 3.28Å; Q8-L10 PolarHBondContact O-N 3.25Å; L10-A13 PolarHBondContact O-N 2.7Å; L10-A14 PolarHBondContact O-N 2.03Å
11	L	79.7	Confident	72.3	Confident	90 Å²	90	119.6 Å²	119.6	47%	0.471	67%	0.672	S	S	.	*	H	α-helix	trans	-65.2	-42.1	177.1	-77	157	0	0	0	112	V7 Q8 A14 W15	V7-L11 HydrophobicContact CG1-CD1 3.9Å; V7-L11 WeakPolarHBondContact O-CD1 3.15Å; V7-L11 WeakPolarHBondContact O-CG 3.11Å; V7-L11 PolarHBondContact O-N 3.45Å; V7-L11 VanDerWaalsContact O-N 3.12Å; Q8-L11 PolarHBondContact O-N 3.01Å; L11-A14 PolarHBondContact O-N 2.82Å; L11-W15 PolarHBondContact O-N 3.03Å
12	V	83	Confident	73.8	Confident	99 Å²	99	111.3 Å²	111.3	60%	0.6	64%	0.636	S	S	*	*	H	α-helix	trans	-65.8	-41	176.9	175	0	0	0	0	111.2	Q8 L9 W15 S16	Q8-V12 WeakPolarHBondContact O-CG2 3.32Å; Q8-V12 PolarHBondContact O-N 3.18Å; Q8-V12 VanDerWaalsContact O-N 3.16Å; L9-V12 PolarHBondContact O-N 2.81Å; V12-W15 PolarHBondContact O-N 3.16Å; V12-S16 PolarHBondContact O-N 2.89Å; V12-S16 VanDerWaalsContact O-N 3.12Å
13	A	79.5	Confident	75.5	Confident	55 Å²	55	108.4 Å²	108.4	46%	0.455	61%	0.609	S	S	.	*	H	α-helix	trans	-63.2	-42.5	176.9	0	0	0	0	0	112	L9 L10 W15 S16	L9-A13 PolarHBondContact O-N 3.49Å; L9-A13 VanDerWaalsContact O-N 3.08Å; L10-A13 PolarHBondContact O-N 2.7Å; A13-W15 VanDerWaalsContact C-N 3.31Å; A13-W15 PolarHBondContact O-N 2.84Å; A13-S16 PolarHBondContact O-N 3.18Å; A13-S16 PolarHBondContact O-OG 3.46Å
14	A	76	Confident	76.9	Confident	64 Å²	64	107.2 Å²	107.2	53%	0.529	59%	0.593	S	S	.	*	H	α-helix	trans	-63.5	-34.8	178.2	0	0	0	0	0	113	L10 L11	L10-A14 PolarHBondContact O-N 2.03Å; L11-A14 PolarHBondContact O-N 2.82Å
15	W	73.4	Confident	78	Confident	223 Å²	223	97.3 Å²	97.3	85%	0.845	56%	0.556	S	S	*	*	H	α-helix	trans	-78	-20.4	176.4	-73	-1.5	0	0	0	114.1	L11 V12 A13 M17	L11-W15 PolarHBondContact O-N 3.03Å; V12-W15 PolarHBondContact O-N 3.16Å; A13-W15 VanDerWaalsContact C-N 3.31Å; A13-W15 PolarHBondContact O-N 2.84Å; W15-M17 PolarHBondContact O-N 3.34Å
16	S	70.9	Confident	79.1	Confident	96 Å²	96	90.2 Å²	90.2	67%	0.671	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.6	-12	176.4	72.4	0	0	0	0	113.7	V12 A13 G18	V12-S16 PolarHBondContact O-N 2.89Å; V12-S16 VanDerWaalsContact O-N 3.12Å; A13-S16 PolarHBondContact O-N 3.18Å; A13-S16 PolarHBondContact O-OG 3.46Å; S16-G18 PolarHBondContact O-N 3.03Å
17	M	63.5	Low	79.9	Confident	163 Å²	163	88.9 Å²	88.9	80%	0.803	52%	0.516	S	S	*	.			trans	-82.7	84.2	-179.7	-145.7	143.3	70.5	0	0	109.2	W15	W15-M17 PolarHBondContact O-N 3.34Å
18	G	61	Low	80.5	Confident	65 Å²	65	85.8 Å²	85.8	67%	0.67	50%	0.498	S	S	*	.	P	Polyproline II helix	trans	-58.1	140	177.2	0	0	0	0	0	111.7	S16 G20	S16-G18 PolarHBondContact O-N 3.03Å; G18-G20 PolarHBondContact O-N 2.8Å
19	C	61	Low	80.9	Confident	127 Å²	127	88.9 Å²	88.9	86%	0.858	51%	0.512	S	S	*	.	P	Polyproline II helix	trans	-60	121.6	165.7	-65.3	0	0	0	0	107.9	E21	C19-E21 PolarHBondContact O-N 3.47Å
20	G	65.1	Low	81.2	Confident	76 Å²	76	89.6 Å²	89.6	78%	0.784	51%	0.512	S	S	*	.	P	Polyproline II helix	trans	-60.3	126.5	174.7	0	0	0	0	0	109.8	G18	G18-G20 PolarHBondContact O-N 2.8Å
21	E	71.9	Confident	81.5	Confident	156 Å²	156	87.4 Å²	87.4	73%	0.729	51%	0.505	S	S	*	.	P	Polyproline II helix	trans	-63.5	141.3	169.4	-75.2	-73.7	132.2	0	0	109.4	C19	C19-E21 PolarHBondContact O-N 3.47Å
22	A	85.2	Confident	81.9	Confident	34 Å²	34	86 Å²	86	28%	0.281	50%	0.497	S	S	.	.	P	Polyproline II helix	trans	-70.1	132.5	174.6	0	0	0	0	0	109.9	K24	A22-K24 PolarHBondContact O-N 2.76Å
23	L	94.4	Very high	82.2	Confident	23 Å²	23	84.3 Å²	84.3	12%	0.12	49%	0.487	C	S	.	.	P	Polyproline II helix	trans	-53.2	136.4	178.7	-176.9	72.2	0	0	0	110.6	C43 D97	L23-C43 HydrophobicContact CB-CB 4.24Å; L23-C43 WeakPolarHBondContact O-CB 3.16Å; L23-C43 PolarHBondContact O-N 3.25Å; L23-C43 PolarHBondContact O-SG 2.75Å; L23-C43 VanDerWaalsContact O-SG 3.34Å; L23-D97 WeakPolarHBondContact CA-OD1 3.19Å
24	K	96.7	Very high	82.6	Confident	63 Å²	63	82.5 Å²	82.5	27%	0.274	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	131.9	173.5	-66.5	169.1	-177.2	163.8	0	109.4	A22 T41 H42 D97 L98	A22-K24 PolarHBondContact O-N 2.76Å; K24-T41 WeakPolarHBondContact CA-O 3.4Å; K24-H42 WeakPolarHBondContact CE-CE1 3.47Å; K24-D97 HydrophobicContact CB-CB 4.29Å; K24-D97 PolarHBondContact N-OD1 3.12Å; K24-D97 CarbonylContact O-C 3.52Å; K24-D97 VanDerWaalsContact O-CA 3.3Å; K24-D97 WeakPolarHBondContact O-CA 3.41Å; K24-L98 HydrophobicContact CB-CD2 3.95Å; K24-L98 HydrophobicContact CB-CG 4.26Å; K24-L98 PolarHBondContact O-N 3.38Å
25	C	97.3	Very high	83.1	Confident	0 Å²	0	82.8 Å²	82.8	0%	0	47%	0.473	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.7	158.3	175.8	-61.4	0	0	0	0	110.4	T27 T41 C43 C50	C25-T27 HydrophobicContact CB-CG2 4.43Å; C25-T41 PolarHBondContact N-O 3.09Å; C25-T41 PolarHBondContact O-N 3.34Å; C25-C43 PolarHBondContact SG-SG 2.99Å; C25-C50 HydrophobicContact CB-CB 3.79Å; C25-C50 WeakPolarHBondContact CB-SG 3.27Å; C25-C50 WeakPolarHBondContact SG-CA 3.41Å; C25-C50 WeakPolarHBondContact SG-CB 3.27Å; C25-C50 CovalentContact SG-SG 2.03Å; C25-C50 PolarHBondContact SG-SG 3.26Å
26	Y	97.1	Very high	84	Confident	43 Å²	43	75 Å²	75	17%	0.169	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	135.6	161.1	-68.4	-67.4	0	0	0	109.5	K38 T39 I40 R71 L98 N100 S101	Y26-K38 VanDerWaalsContact CD1-CA 3.47Å; Y26-K38 HydrophobicContact CD1-CB 3.84Å; Y26-K38 WeakPolarHBondContact CD1-O 3.04Å; Y26-K38 HydrophobicContact CE1-CB 3.97Å; Y26-K38 VanDerWaalsContact CE1-O 3.32Å; Y26-K38 WeakPolarHBondContact CE1-O 3.12Å; Y26-K38 HydrophobicContact CG-CB 4.5Å; Y26-T39 CarbonylContact C-O 3.47Å; Y26-T39 VanDerWaalsContact CA-O 3.27Å; Y26-T39 WeakPolarHBondContact CA-O 3.07Å; Y26-I40 HydrophobicContact CD1-CG1 3.95Å; Y26-I40 HydrophobicContact CE1-CD1 4.24Å; Y26-I40 HydrophobicContact CE1-CG1 3.5Å; Y26-I40 VanDerWaalsContact CE1-CG1 3.5Å; Y26-R71 WeakPolarHBondContact O-CB 3.49Å; Y26-L98 HydrophobicContact CD2-CB 4.34Å; Y26-L98 HydrophobicContact CD2-CD2 4.36Å; Y26-L98 HydrophobicContact CE1-CD2 4.44Å; Y26-L98 HydrophobicContact CE2-CB 3.76Å; Y26-L98 HydrophobicContact CE2-CD2 4.12Å; Y26-L98 HydrophobicContact CE2-CG 4.42Å; Y26-N100 PolarHBondContact N-OD1 2.02Å; Y26-N100 PolarHBondContact O-ND2 3.41Å; Y26-S101 VanDerWaalsContact CD2-CA 3.48Å
27	T	96	Very high	85	Confident	23 Å²	23	70.4 Å²	70.4	14%	0.141	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.3	156.3	179.6	65.6	0	0	0	0	111.9	C25 T39 T41 R71	C25-T27 HydrophobicContact CB-CG2 4.43Å; T27-T39 PolarHBondContact N-O 3.3Å; T27-T39 VanDerWaalsContact O-CB 3.27Å; T27-T39 WeakPolarHBondContact O-CB 3.04Å; T27-T41 HydrophobicContact CG2-CG2 4.39Å; T27-T41 WeakPolarHBondContact OG1-CB 3.41Å; T27-T41 PolarHBondContact OG1-OG1 3.03Å; T27-R71 CarbonylContact C-O 3.5Å; T27-R71 WeakPolarHBondContact CA-O 3.08Å; T27-R71 WeakPolarHBondContact CB-O 3.29Å
28	C	94.7	Very high	86.5	Confident	13 Å²	13	66.1 Å²	66.1	9%	0.088	40%	0.397	C	S	.	.			trans	-146.9	141.4	166.7	49.7	0	0	0	0	109.9	M32 C37 R71	C28-M32 HydrophobicContact CB-CE 4.39Å; C28-M32 HydrophobicContact CB-CG 4Å; C28-M32 HydrophobicContact CB-SD 3.66Å; C28-C37 HydrophobicContact CB-CB 3.86Å; C28-C37 WeakPolarHBondContact CB-SG 3.22Å; C28-C37 WeakPolarHBondContact SG-CB 3.08Å; C28-C37 CovalentContact SG-SG 2.03Å; C28-C37 PolarHBondContact SG-SG 2.8Å; C28-R71 PolarHBondContact N-O 3.42Å
29	E	88.6	Confident	88.2	Confident	199 Å²	199	67 Å²	67	93%	0.93	39%	0.39	S	S	*	.	S	Bend	trans	-76	-32.6	-178.2	-69.5	-174.5	154	0	0	112.8
30	Q	88.4	Confident	89.9	Confident	144 Å²	144	65.4 Å²	65.4	67%	0.673	37%	0.372	S	S	*	.	S	Bend	trans	-112.1	153.7	-179.4	-66.9	178.1	-18.2	0	0	109.8	M32	Q30-M32 WeakPolarHBondContact O-CG 3.46Å; Q30-M32 PolarHBondContact O-N 2.89Å
31	P	87.5	Confident	91.4	Very high	80 Å²	80	64 Å²	64	52%	0.519	35%	0.348	S	S	.	.			trans	-63.2	124.4	169.5	-19.4	31.9	0	0	0	110.2	V55 V68	P31-V55 HydrophobicContact CB-CG2 4.26Å; P31-V68 HydrophobicContact CB-CG1 3.56Å
32	M	89.1	Confident	92.5	Very high	59 Å²	59	62.5 Å²	62.5	29%	0.291	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.5	167.3	-179.5	14.3	-178.2	-56.6	0	0	110	C28 Q30 S34 S36 C37 V68 V69	C28-M32 HydrophobicContact CB-CE 4.39Å; C28-M32 HydrophobicContact CB-CG 4Å; C28-M32 HydrophobicContact CB-SD 3.66Å; Q30-M32 WeakPolarHBondContact O-CG 3.46Å; Q30-M32 PolarHBondContact O-N 2.89Å; M32-S34 PolarHBondContact O-N 2.03Å; M32-S36 WeakPolarHBondContact CE-O 3.33Å; M32-S36 WeakPolarHBondContact CE-OG 3.3Å; M32-C37 VanDerWaalsContact CE-CA 3.48Å; M32-C37 HydrophobicContact CE-CB 4.02Å; M32-C37 VanDerWaalsContact CE-N 3.31Å; M32-C37 HydrophobicContact CG-CB 4.31Å; M32-V68 WeakPolarHBondContact O-CA 3.43Å; M32-V69 PolarHBondContact N-O 2.92Å; M32-V69 VanDerWaalsContact N-O 3.16Å; M32-V69 PolarHBondContact O-N 3.33Å
33	V	88.6	Confident	93	Very high	64 Å²	64	61.3 Å²	61.3	39%	0.388	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.6	139.8	176.8	-64.5	0	0	0	0	111.1	A35 S36 C37	V33-A35 PolarHBondContact O-N 3.46Å; V33-S36 WeakPolarHBondContact CG2-OG 2.96Å; V33-S36 PolarHBondContact O-N 2.66Å; V33-S36 PolarHBondContact O-OG 2.8Å; V33-C37 PolarHBondContact O-N 2.91Å
34	S	87.6	Confident	92.9	Very high	18 Å²	18	66.3 Å²	66.3	13%	0.126	35%	0.351	C	S	.	.	T	Hydrogen-bonded Turn	trans	-52.6	-34	-175.8	64.9	0	0	0	0	114.1	M32 S36 P67 R71	M32-S34 PolarHBondContact O-N 2.03Å; S34-S36 VanDerWaalsContact C-N 3.34Å; S34-S36 PolarHBondContact O-N 2.88Å; S34-P67 PolarHBondContact N-O 3.02Å; S34-R71 PolarHBondContact O-NH1 3.47Å
35	A	87.9	Confident	92.6	Very high	69 Å²	69	69 Å²	69	57%	0.57	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.8	-33.4	178.1	0	0	0	0	0	113.4	V33	V33-A35 PolarHBondContact O-N 3.46Å
36	S	90.8	Very high	92.3	Very high	59 Å²	59	73.3 Å²	73.3	41%	0.413	40%	0.395	S	S	.	.	T	Hydrogen-bonded Turn	trans	-93.8	-21.8	-176.8	60.1	0	0	0	0	113.5	M32 V33 S34 K38	M32-S36 WeakPolarHBondContact CE-O 3.33Å; M32-S36 WeakPolarHBondContact CE-OG 3.3Å; V33-S36 WeakPolarHBondContact CG2-OG 2.96Å; V33-S36 PolarHBondContact O-N 2.66Å; V33-S36 PolarHBondContact O-OG 2.8Å; S34-S36 VanDerWaalsContact C-N 3.34Å; S34-S36 PolarHBondContact O-N 2.88Å; S36-K38 PolarHBondContact O-N 2.82Å
37	C	93.1	Very high	92.2	Very high	0 Å²	0	72.5 Å²	72.5	0%	0	39%	0.394	C	S	.	.			trans	-76.3	58.8	-178.9	178.2	0	0	0	0	111.8	C28 M32 V33 V69 R71	C28-C37 HydrophobicContact CB-CB 3.86Å; C28-C37 WeakPolarHBondContact CB-SG 3.22Å; C28-C37 WeakPolarHBondContact SG-CB 3.08Å; C28-C37 CovalentContact SG-SG 2.03Å; C28-C37 PolarHBondContact SG-SG 2.8Å; M32-C37 VanDerWaalsContact CE-CA 3.48Å; M32-C37 HydrophobicContact CE-CB 4.02Å; M32-C37 VanDerWaalsContact CE-N 3.31Å; M32-C37 HydrophobicContact CG-CB 4.31Å; V33-C37 PolarHBondContact O-N 2.91Å; C37-V69 HydrophobicContact CB-CG2 3.93Å; C37-R71 WeakPolarHBondContact O-CD 3.3Å; C37-R71 PolarHBondContact O-NH1 2.8Å
38	K	94.6	Very high	92.1	Very high	73 Å²	73	75.3 Å²	75.3	32%	0.317	41%	0.411	S	S	.	.			trans	-123.7	33.9	-174.6	-61.2	-167.2	-177.3	-165.2	0	113.2	Y26 S36 I40 S101 E102	Y26-K38 VanDerWaalsContact CD1-CA 3.47Å; Y26-K38 HydrophobicContact CD1-CB 3.84Å; Y26-K38 WeakPolarHBondContact CD1-O 3.04Å; Y26-K38 HydrophobicContact CE1-CB 3.97Å; Y26-K38 VanDerWaalsContact CE1-O 3.32Å; Y26-K38 WeakPolarHBondContact CE1-O 3.12Å; Y26-K38 HydrophobicContact CG-CB 4.5Å; S36-K38 PolarHBondContact O-N 2.82Å; K38-I40 PolarHBondContact O-N 2.87Å; K38-S101 WeakPolarHBondContact CE-O 3.4Å; K38-S101 PolarHBondContact NZ-O 3.49Å; K38-E102 IonicContact NZ-OE1 2.7Å; K38-E102 PolarHBondContact NZ-OE1 3.36Å; K38-E102 IonicContact NZ-OE2 2.94Å; K38-E102 PolarHBondContact NZ-OE2 2.97Å
39	T	96.3	Very high	92.1	Very high	83 Å²	83	74.7 Å²	74.7	51%	0.509	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.1	121	172.8	-52.3	0	0	0	0	110	Y26 T27 T41	Y26-T39 CarbonylContact C-O 3.47Å; Y26-T39 VanDerWaalsContact CA-O 3.27Å; Y26-T39 WeakPolarHBondContact CA-O 3.07Å; T27-T39 PolarHBondContact N-O 3.3Å; T27-T39 VanDerWaalsContact O-CB 3.27Å; T27-T39 WeakPolarHBondContact O-CB 3.04Å; T39-T41 PolarHBondContact O-N 2.8Å
40	I	96.8	Very high	92.5	Very high	95 Å²	95	65.2 Å²	65.2	49%	0.487	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.3	124.3	177.1	-62.7	173	0	0	0	109.2	Y26 K38 L98	Y26-I40 HydrophobicContact CD1-CG1 3.95Å; Y26-I40 HydrophobicContact CE1-CD1 4.24Å; Y26-I40 HydrophobicContact CE1-CG1 3.5Å; Y26-I40 VanDerWaalsContact CE1-CG1 3.5Å; K38-I40 PolarHBondContact O-N 2.87Å; I40-L98 HydrophobicContact CB-CD2 4.49Å; I40-L98 HydrophobicContact CD1-CD1 4.41Å; I40-L98 HydrophobicContact CG1-CD2 4.04Å; I40-L98 HydrophobicContact CG2-CD2 3.98Å
41	T	96.2	Very high	92.8	Very high	47 Å²	47	60.2 Å²	60.2	29%	0.288	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	135.8	178.4	-62.3	0	0	0	0	110.2	K24 C25 T27 T39 C43	K24-T41 WeakPolarHBondContact CA-O 3.4Å; C25-T41 PolarHBondContact N-O 3.09Å; C25-T41 PolarHBondContact O-N 3.34Å; T27-T41 HydrophobicContact CG2-CG2 4.39Å; T27-T41 WeakPolarHBondContact OG1-CB 3.41Å; T27-T41 PolarHBondContact OG1-OG1 3.03Å; T39-T41 PolarHBondContact O-N 2.8Å; T41-C43 PolarHBondContact O-N 2.78Å
42	H	95.8	Very high	93.1	Very high	123 Å²	123	56.6 Å²	56.6	57%	0.569	32%	0.316	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.8	114.7	166.9	-70.3	-104.1	0	0	0	108.3	K24	K24-H42 WeakPolarHBondContact CE-CE1 3.47Å
43	C	94.8	Very high	93.2	Very high	9 Å²	9	55 Å²	55	6%	0.061	31%	0.31	C	S	.	.			trans	-69.9	167.2	178.3	-57.2	0	0	0	0	111.3	L23 C25 T41 D47 C73	L23-C43 HydrophobicContact CB-CB 4.24Å; L23-C43 WeakPolarHBondContact O-CB 3.16Å; L23-C43 PolarHBondContact O-N 3.25Å; L23-C43 PolarHBondContact O-SG 2.75Å; L23-C43 VanDerWaalsContact O-SG 3.34Å; C25-C43 PolarHBondContact SG-SG 2.99Å; T41-C43 PolarHBondContact O-N 2.78Å; C43-D47 HydrophobicContact CB-CB 3.78Å; C43-C73 WeakPolarHBondContact CA-SG 3.4Å; C43-C73 HydrophobicContact CB-CB 3.55Å; C43-C73 WeakPolarHBondContact CB-SG 3.03Å; C43-C73 WeakPolarHBondContact SG-CB 3.48Å; C43-C73 CovalentContact SG-SG 2.03Å; C43-C73 PolarHBondContact SG-SG 3.01Å
44	K	93.6	Very high	93.1	Very high	129 Å²	129	53.3 Å²	53.3	56%	0.561	30%	0.298	S	S	*	.			trans	-71.8	155.7	175.9	-54.8	-175.7	-174.6	173.8	0	110.1	E46 D47	K44-E46 HydrophobicContact CB-CG 4.05Å; K44-E46 WeakPolarHBondContact CB-OE1 3.45Å; K44-E46 WeakPolarHBondContact CB-OE2 3.5Å; K44-E46 WeakPolarHBondContact CD-OE1 3.5Å; K44-E46 PolarHBondContact O-N 2.85Å; K44-E46 VanDerWaalsContact O-N 3.14Å; K44-D47 WeakPolarHBondContact CB-OD2 3.42Å; K44-D47 PolarHBondContact N-OD2 2.86Å; K44-D47 WeakPolarHBondContact O-CB 3.12Å; K44-D47 PolarHBondContact O-N 2.01Å
45	P	90.3	Very high	92.8	Very high	120 Å²	120	54.2 Å²	54.2	78%	0.779	30%	0.303	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.2	-27.3	178.1	-24	34.1	0	0	0	114	D47	P45-D47 VanDerWaalsContact C-N 3.35Å
46	E	91.1	Very high	91.9	Very high	89 Å²	89	54.2 Å²	54.2	42%	0.416	30%	0.296	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.2	-15.4	175.1	62.7	-91.7	-153.2	0	0	114.4	K44 R75	K44-E46 HydrophobicContact CB-CG 4.05Å; K44-E46 WeakPolarHBondContact CB-OE1 3.45Å; K44-E46 WeakPolarHBondContact CB-OE2 3.5Å; K44-E46 WeakPolarHBondContact CD-OE1 3.5Å; K44-E46 PolarHBondContact O-N 2.85Å; K44-E46 VanDerWaalsContact O-N 3.14Å; E46-R75 WeakPolarHBondContact O-CB 3.37Å; E46-R75 VanDerWaalsContact O-CG 3.24Å; E46-R75 WeakPolarHBondContact O-CG 3.18Å
47	D	94	Very high	90.4	Very high	27 Å²	27	55.1 Å²	55.1	14%	0.144	30%	0.299	C	S	.	.			trans	-80	130.9	178.8	-66.7	-38.2	0	0	0	110.2	C43 K44 P45 C73 S74 R75	C43-D47 HydrophobicContact CB-CB 3.78Å; K44-D47 WeakPolarHBondContact CB-OD2 3.42Å; K44-D47 PolarHBondContact N-OD2 2.86Å; K44-D47 WeakPolarHBondContact O-CB 3.12Å; K44-D47 PolarHBondContact O-N 2.01Å; P45-D47 VanDerWaalsContact C-N 3.35Å; D47-C73 HydrophobicContact CB-CB 4.09Å; D47-C73 WeakPolarHBondContact OD2-CB 3.04Å; D47-S74 VanDerWaalsContact OD1-C 3.32Å; D47-R75 PolarHBondContact OD1-N 3.24Å; D47-R75 VanDerWaalsContact OD1-N 3.07Å
48	T	93.9	Very high	88.6	Confident	81 Å²	81	62.5 Å²	62.5	50%	0.497	33%	0.333	S	S	.	.			trans	-117	-11.6	-176.6	65.5	0	0	0	0	113	S74 R75 F95	T48-S74 PolarHBondContact N-O 3.04Å; T48-R75 PolarHBondContact OG1-O 2.03Å; T48-F95 WeakPolarHBondContact O-CD1 3.46Å
49	A	95.9	Very high	86.7	Confident	0 Å²	0	63.9 Å²	63.9	0%	0	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	148.7	-175.5	0	0	0	0	0	112.6	S74 C77 C94 F95	A49-S74 PolarHBondContact N-O 3.1Å; A49-S74 PolarHBondContact O-N 2.82Å; A49-C77 HydrophobicContact CB-CB 3.64Å; A49-C94 CarbonylContact C-O 3.56Å; A49-C94 VanDerWaalsContact CA-O 3.31Å; A49-C94 WeakPolarHBondContact CA-O 3.39Å; A49-F95 HydrophobicContact CB-CD1 3.8Å; A49-F95 HydrophobicContact CB-CE1 3.61Å; A49-F95 HydrophobicContact CB-CG 4.46Å; A49-F95 HydrophobicContact CB-CZ 4.13Å
50	C	96.5	Very high	84.7	Confident	0 Å²	0	67.7 Å²	67.7	0%	0	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.9	129.4	159.4	-50.9	0	0	0	0	108.9	C25 C93 C94 C99 N100	C25-C50 HydrophobicContact CB-CB 3.79Å; C25-C50 WeakPolarHBondContact CB-SG 3.27Å; C25-C50 WeakPolarHBondContact SG-CA 3.41Å; C25-C50 WeakPolarHBondContact SG-CB 3.27Å; C25-C50 CovalentContact SG-SG 2.03Å; C25-C50 PolarHBondContact SG-SG 3.26Å; C50-C93 WeakPolarHBondContact O-CA 3.47Å; C50-C94 PolarHBondContact N-O 3.18Å; C50-C94 PolarHBondContact O-N 2.98Å; C50-C99 VanDerWaalsContact SG-SG 3.64Å; C50-N100 HydrophobicContact CB-CB 3.98Å
51	M	95.3	Very high	82.5	Confident	39 Å²	39	70.8 Å²	70.8	19%	0.192	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	133.9	178.5	-176.6	176.5	174.9	0	0	109.4	R71 S72 I91 Y92	M51-R71 WeakPolarHBondContact O-CA 3.48Å; M51-S72 PolarHBondContact N-O 3.25Å; M51-S72 PolarHBondContact O-N 2.77Å; M51-I91 HydrophobicContact CE-CB 4.37Å; M51-I91 HydrophobicContact CE-CD1 3.75Å; M51-I91 HydrophobicContact CE-CG1 3.84Å; M51-I91 HydrophobicContact CE-CG2 3.6Å; M51-I91 HydrophobicContact CG-CG2 3.96Å; M51-I91 HydrophobicContact SD-CG2 4.43Å; M51-Y92 WeakPolarHBondContact CA-O 3.37Å
52	T	93.4	Very high	80.6	Confident	5 Å²	5	74.7 Å²	74.7	3%	0.031	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	121.3	172.7	-55	0	0	0	0	108.7	V69 R71 I91 Y92 N100 L103	T52-V69 HydrophobicContact CG2-CB 4.27Å; T52-V69 HydrophobicContact CG2-CG1 4.49Å; T52-R71 HydrophobicContact CG2-CG 3.89Å; T52-I91 CarbonylContact O-C 3.58Å; T52-I91 WeakPolarHBondContact O-CA 3.18Å; T52-Y92 PolarHBondContact N-O 3.45Å; T52-Y92 PolarHBondContact O-N 3.22Å; T52-N100 WeakPolarHBondContact OG1-CB 3.37Å; T52-L103 HydrophobicContact CG2-CD1 4.19Å
53	T	90.5	Very high	78.7	Confident	26 Å²	26	74.9 Å²	74.9	16%	0.16	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	118	176.9	-55.2	0	0	0	0	108.1	V55 V69 T70 H89 L90	T53-V55 PolarHBondContact O-N 3.19Å; T53-V69 CarbonylContact O-C 3.59Å; T53-V69 VanDerWaalsContact O-CA 3.29Å; T53-V69 WeakPolarHBondContact O-CA 2.96Å; T53-T70 PolarHBondContact N-O 3.23Å; T53-T70 PolarHBondContact O-N 3.07Å; T53-H89 HydrophobicContact CG2-CB 3.56Å; T53-L90 WeakPolarHBondContact CA-O 3.48Å
54	L	87	Confident	77.1	Confident	28 Å²	28	82.9 Å²	82.9	15%	0.147	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	115.8	172.3	-167.6	168.6	0	0	0	107.7	T56 H89 L90 Y92 L103	L54-T56 HydrophobicContact CD2-CG2 3.76Å; L54-T56 PolarHBondContact O-N 3.16Å; L54-H89 WeakPolarHBondContact O-CA 3.31Å; L54-H89 WeakPolarHBondContact O-CB 3.46Å; L54-L90 HydrophobicContact CB-CB 4.06Å; L54-L90 HydrophobicContact CD1-CD1 4.3Å; L54-L90 PolarHBondContact N-O 3.42Å; L54-Y92 HydrophobicContact CB-CE2 4.4Å; L54-Y92 HydrophobicContact CD1-CE2 4.33Å; L54-L103 HydrophobicContact CB-CD2 4.42Å; L54-L103 HydrophobicContact CD1-CD2 3.66Å; L54-L103 HydrophobicContact CG-CD2 3.89Å
55	V	81.4	Confident	75.8	Confident	37 Å²	37	82.6 Å²	82.6	22%	0.224	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	98.1	173.8	-175.9	0	0	0	0	106.1	P31 T53 V57 V68	P31-V55 HydrophobicContact CB-CG2 4.26Å; T53-V55 PolarHBondContact O-N 3.19Å; V55-V57 PolarHBondContact O-N 3.12Å; V55-V68 HydrophobicContact CB-CB 4.32Å; V55-V68 HydrophobicContact CB-CG1 4.16Å; V55-V68 PolarHBondContact N-O 3.14Å
56	T	68.5	Low	75.1	Confident	69 Å²	69	80.1 Å²	80.1	42%	0.423	44%	0.435	S	S	.	.			trans	-58.3	121.9	176.9	40.6	0	0	0	0	108.6	L54 E58 A88	L54-T56 HydrophobicContact CD2-CG2 3.76Å; L54-T56 PolarHBondContact O-N 3.16Å; T56-E58 PolarHBondContact O-N 3.03Å; T56-A88 PolarHBondContact OG1-O 3.37Å
57	V	59.9	Low	74.6	Confident	78 Å²	78	78.5 Å²	78.5	47%	0.473	43%	0.432	S	S	.	.			trans	-73.8	118.4	154.7	-175.1	0	0	0	0	103.7	V55 A59 V68	V55-V57 PolarHBondContact O-N 3.12Å; V57-A59 PolarHBondContact O-N 3.05Å; V57-V68 HydrophobicContact CG2-CG2 4.19Å
58	E	55.7	Low	74.3	Confident	154 Å²	154	78.8 Å²	78.8	72%	0.72	44%	0.435	S	S	*	.			trans	-38.6	115.5	-177.5	-70.9	150.2	160.5	0	0	110.2	T56 E60	T56-E58 PolarHBondContact O-N 3.03Å; E58-E60 HydrophobicContact CB-CG 4.45Å; E58-E60 PolarHBondContact O-N 3.24Å
59	A	53.2	Low	74.2	Confident	102 Å²	102	75 Å²	75	84%	0.843	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.9	38.5	-167.9	0	0	0	0	0	112.6	V57 F61	V57-A59 PolarHBondContact O-N 3.05Å; A59-F61 VanDerWaalsContact C-N 3.32Å; A59-F61 PolarHBondContact O-N 2.95Å
60	E	54.7	Low	74	Confident	163 Å²	163	76.6 Å²	76.6	76%	0.762	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.5	-18.3	-173.9	-66.2	-170.2	151.7	0	0	112.6	E58	E58-E60 HydrophobicContact CB-CG 4.45Å; E58-E60 PolarHBondContact O-N 3.24Å
61	F	51.5	Low	73.9	Confident	160 Å²	160	76.6 Å²	76.6	70%	0.702	42%	0.421	S	S	*	.	S	Bend	trans	-154.6	151.8	175.8	-100.5	-95.2	0	0	0	110	A59 F63	A59-F61 VanDerWaalsContact C-N 3.32Å; A59-F61 PolarHBondContact O-N 2.95Å; F61-F63 VanDerWaalsContact C-N 3.32Å; F61-F63 HydrophobicContact CB-CD2 4.27Å; F61-F63 HydrophobicContact CB-CE2 3.77Å; F61-F63 HydrophobicContact CB-CZ 4.29Å; F61-F63 VanDerWaalsContact O-CD2 3.23Å; F61-F63 WeakPolarHBondContact O-CD2 3.01Å; F61-F63 PolarHBondContact O-N 2.85Å
62	P	54.8	Low	73.9	Confident	130 Å²	130	76.7 Å²	76.7	84%	0.844	43%	0.426	S	S	*	.			trans	-71.1	88.4	-178.8	29.4	-33.6	0	0	0	110.3
63	F	57.4	Low	74.1	Confident	126 Å²	126	77.9 Å²	77.9	55%	0.553	43%	0.434	S	S	*	.			trans	-84.8	118.3	167.7	-69.7	-74.8	0	0	0	107.7	F61 Q65	F61-F63 VanDerWaalsContact C-N 3.32Å; F61-F63 HydrophobicContact CB-CD2 4.27Å; F61-F63 HydrophobicContact CB-CE2 3.77Å; F61-F63 HydrophobicContact CB-CZ 4.29Å; F61-F63 VanDerWaalsContact O-CD2 3.23Å; F61-F63 WeakPolarHBondContact O-CD2 3.01Å; F61-F63 PolarHBondContact O-N 2.85Å; F63-Q65 HydrophobicContact CB-CB 4.38Å; F63-Q65 HydrophobicContact CB-CG 3.87Å; F63-Q65 PolarHBondContact O-N 3.01Å
64	N	59.6	Low	74.3	Confident	177 Å²	177	77.7 Å²	77.7	95%	0.947	43%	0.434	S	S	*	.			trans	-70.4	35.7	178.3	-147.6	48.3	0	0	0	112.3
65	Q	67.1	Low	74.6	Confident	123 Å²	123	84.7 Å²	84.7	58%	0.575	46%	0.458	S	S	*	.	P	Polyproline II helix	trans	-95.5	136.8	-172.1	-62.6	177.9	15.6	0	0	108.6	F63	F63-Q65 HydrophobicContact CB-CB 4.38Å; F63-Q65 HydrophobicContact CB-CG 3.87Å; F63-Q65 PolarHBondContact O-N 3.01Å
66	S	75.7	Confident	75.1	Confident	68 Å²	68	87.5 Å²	87.5	48%	0.476	48%	0.48	S	S	.	.	P	Polyproline II helix	trans	-59.1	141.7	175.1	-57.8	0	0	0	0	110.5	V68	S66-V68 PolarHBondContact O-N 3.14Å
67	P	81.2	Confident	76.2	Confident	55 Å²	55	85.4 Å²	85.4	36%	0.357	47%	0.467	S	S	.	.	P	Polyproline II helix	trans	-61.6	139	-178.9	25.7	-33.7	0	0	0	110.5	S34 L103	S34-P67 PolarHBondContact N-O 3.02Å; P67-L103 HydrophobicContact CB-CD2 3.95Å; P67-L103 HydrophobicContact CG-CD2 3.91Å
68	V	86.9	Confident	77.6	Confident	34 Å²	34	89.5 Å²	89.5	21%	0.206	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	129.9	172.9	-178.3	0	0	0	0	108	P31 M32 V55 V57 S66	P31-V68 HydrophobicContact CB-CG1 3.56Å; M32-V68 WeakPolarHBondContact O-CA 3.43Å; V55-V68 HydrophobicContact CB-CB 4.32Å; V55-V68 HydrophobicContact CB-CG1 4.16Å; V55-V68 PolarHBondContact N-O 3.14Å; V57-V68 HydrophobicContact CG2-CG2 4.19Å; S66-V68 PolarHBondContact O-N 3.14Å
69	V	90.9	Very high	79.1	Confident	0 Å²	0	85 Å²	85	0%	0	47%	0.472	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	155.7	-178.4	-53.7	0	0	0	0	110.7	M32 C37 T52 T53 R71 L103	M32-V69 PolarHBondContact N-O 2.92Å; M32-V69 VanDerWaalsContact N-O 3.16Å; M32-V69 PolarHBondContact O-N 3.33Å; C37-V69 HydrophobicContact CB-CG2 3.93Å; T52-V69 HydrophobicContact CG2-CB 4.27Å; T52-V69 HydrophobicContact CG2-CG1 4.49Å; T53-V69 CarbonylContact O-C 3.59Å; T53-V69 VanDerWaalsContact O-CA 3.29Å; T53-V69 WeakPolarHBondContact O-CA 2.96Å; V69-R71 HydrophobicContact CG2-CG 4.39Å; V69-L103 HydrophobicContact CG1-CB 4.45Å; V69-L103 HydrophobicContact CG1-CD2 3.41Å; V69-L103 VanDerWaalsContact CG1-CD2 3.41Å; V69-L103 HydrophobicContact CG1-CG 4.4Å
70	T	92.9	Very high	80.5	Confident	34 Å²	34	81.7 Å²	81.7	21%	0.209	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	128.2	164.9	-52.9	0	0	0	0	107.6	T53	T53-T70 PolarHBondContact N-O 3.23Å; T53-T70 PolarHBondContact O-N 3.07Å
71	R	94.8	Very high	81.6	Confident	1 Å²	1	78.5 Å²	78.5	0%	0.004	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	138	177.2	-63.7	177.6	172	123.3	-6.2	110.6	Y26 T27 C28 S34 C37 M51 T52 V69 N100 S101	Y26-R71 WeakPolarHBondContact O-CB 3.49Å; T27-R71 CarbonylContact C-O 3.5Å; T27-R71 WeakPolarHBondContact CA-O 3.08Å; T27-R71 WeakPolarHBondContact CB-O 3.29Å; C28-R71 PolarHBondContact N-O 3.42Å; S34-R71 PolarHBondContact O-NH1 3.47Å; C37-R71 WeakPolarHBondContact O-CD 3.3Å; C37-R71 PolarHBondContact O-NH1 2.8Å; M51-R71 WeakPolarHBondContact O-CA 3.48Å; T52-R71 HydrophobicContact CG2-CG 3.89Å; V69-R71 HydrophobicContact CG2-CG 4.39Å; R71-N100 WeakPolarHBondContact CD-O 3.38Å; R71-N100 VanDerWaalsContact CZ-O 3.27Å; R71-N100 PolarHBondContact NE-O 3.38Å; R71-N100 PolarHBondContact NH2-O 3.18Å; R71-S101 PolarHBondContact NH2-O 3.46Å
72	S	95.4	Very high	82.5	Confident	41 Å²	41	76.1 Å²	76.1	29%	0.287	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.6	162.9	-178.1	58.6	0	0	0	0	112.1	M51	M51-S72 PolarHBondContact N-O 3.25Å; M51-S72 PolarHBondContact O-N 2.77Å
73	C	96.3	Very high	83.2	Confident	29 Å²	29	76.5 Å²	76.5	20%	0.196	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	146.6	165	-55.9	0	0	0	0	109.5	C43 D47	C43-C73 WeakPolarHBondContact CA-SG 3.4Å; C43-C73 HydrophobicContact CB-CB 3.55Å; C43-C73 WeakPolarHBondContact CB-SG 3.03Å; C43-C73 WeakPolarHBondContact SG-CB 3.48Å; C43-C73 CovalentContact SG-SG 2.03Å; C43-C73 PolarHBondContact SG-SG 3.01Å; D47-C73 HydrophobicContact CB-CB 4.09Å; D47-C73 WeakPolarHBondContact OD2-CB 3.04Å
74	S	95.3	Very high	83.8	Confident	23 Å²	23	73.6 Å²	73.6	16%	0.161	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.9	141.4	174.2	-174.5	0	0	0	0	112.6	D47 T48 A49 S76	D47-S74 VanDerWaalsContact OD1-C 3.32Å; T48-S74 PolarHBondContact N-O 3.04Å; A49-S74 PolarHBondContact N-O 3.1Å; A49-S74 PolarHBondContact O-N 2.82Å; S74-S76 VanDerWaalsContact C-N 3.34Å; S74-S76 PolarHBondContact OG-N 3.31Å; S74-S76 PolarHBondContact OG-O 3.16Å
75	R	93.8	Very high	84	Confident	174 Å²	174	73.5 Å²	73.5	66%	0.657	42%	0.418	S	S	*	.	S	Bend	trans	-64.6	-36.3	169	178	167	-172.8	-170.8	1.9	113.2	E46 D47 T48	E46-R75 WeakPolarHBondContact O-CB 3.37Å; E46-R75 VanDerWaalsContact O-CG 3.24Å; E46-R75 WeakPolarHBondContact O-CG 3.18Å; D47-R75 PolarHBondContact OD1-N 3.24Å; D47-R75 VanDerWaalsContact OD1-N 3.07Å; T48-R75 PolarHBondContact OG1-O 2.03Å
76	S	90.6	Very high	83.6	Confident	97 Å²	97	71.3 Å²	71.3	68%	0.678	43%	0.429	S	S	*	.	S	Bend	trans	-140.5	122.5	179.2	58.5	0	0	0	0	109.1	S74	S74-S76 VanDerWaalsContact C-N 3.34Å; S74-S76 PolarHBondContact OG-N 3.31Å; S74-S76 PolarHBondContact OG-O 3.16Å
77	C	91.6	Very high	82.8	Confident	24 Å²	24	70.5 Å²	70.5	16%	0.162	43%	0.426	C	S	.	.			trans	-119.1	122.4	179.8	-165.4	0	0	0	0	109.3	A49 C93	A49-C77 HydrophobicContact CB-CB 3.64Å; C77-C93 HydrophobicContact CB-CB 3.59Å; C77-C93 WeakPolarHBondContact CB-SG 3.03Å; C77-C93 VanDerWaalsContact SG-CA 3.51Å; C77-C93 WeakPolarHBondContact SG-CB 3.45Å; C77-C93 CovalentContact SG-SG 2.01Å; C77-C93 PolarHBondContact SG-SG 3.42Å
78	M	89.9	Confident	81.7	Confident	165 Å²	165	70.9 Å²	70.9	81%	0.813	43%	0.434	S	S	*	.			trans	-114.1	114.4	174.8	-166	175.2	96.1	0	0	107.7	I91	M78-I91 WeakPolarHBondContact O-CG2 3.43Å
79	A	86.7	Confident	81	Confident	58 Å²	58	73.3 Å²	73.3	48%	0.479	44%	0.443	S	S	.	.	P	Polyproline II helix	trans	-65.2	143.6	177.1	0	0	0	0	0	109.8	I91	A79-I91 VanDerWaalsContact CA-O 3.3Å; A79-I91 WeakPolarHBondContact CA-O 3.4Å; A79-I91 WeakPolarHBondContact CB-O 3.19Å
80	T	84.3	Confident	80.7	Confident	33 Å²	33	76.1 Å²	76.1	20%	0.202	46%	0.458	C	S	.	.	P	Polyproline II helix	trans	-68.2	135.4	175.1	-50.9	0	0	0	0	109	A87 H89 I91	T80-A87 HydrophobicContact CG2-CB 3.69Å; T80-H89 PolarHBondContact OG1-O 3.46Å; T80-I91 PolarHBondContact N-O 3.04Å; T80-I91 WeakPolarHBondContact OG1-CB 3.5Å; T80-I91 WeakPolarHBondContact OG1-CG1 3.24Å; T80-I91 PolarHBondContact OG1-N 2.68Å
81	D	77.1	Confident	80.6	Confident	96 Å²	96	76.5 Å²	76.5	51%	0.513	46%	0.458	S	S	.	.	P	Polyproline II helix	trans	-67.9	122.1	170.3	-175.4	-11.7	0	0	0	109.1	D83 S84	D81-D83 PolarHBondContact O-N 3.49Å; D81-D83 VanDerWaalsContact O-N 3.14Å; D81-D83 PolarHBondContact OD1-N 3.08Å; D81-S84 WeakPolarHBondContact O-CB 3.35Å; D81-S84 PolarHBondContact O-N 3.36Å
82	P	69.3	Low	80.4	Confident	110 Å²	110	81.7 Å²	81.7	71%	0.714	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.6	-22.9	178.9	25	-35.9	0	0	0	113.5	S84	P82-S84 VanDerWaalsContact C-N 3.3Å
83	D	70.9	Confident	80.3	Confident	138 Å²	138	81.5 Å²	81.5	74%	0.738	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.7	0.6	179.4	-63	-33.9	0	0	0	112.8	D81 I85	D81-D83 PolarHBondContact O-N 3.49Å; D81-D83 VanDerWaalsContact O-N 3.14Å; D81-D83 PolarHBondContact OD1-N 3.08Å; D83-I85 PolarHBondContact O-N 3.21Å; D83-I85 VanDerWaalsContact O-N 3.1Å
84	S	68.4	Low	80.3	Confident	66 Å²	66	81.6 Å²	81.6	46%	0.462	48%	0.477	S	S	.	.			trans	-73.5	102.5	179.7	-164	0	0	0	0	111.6	D81 P82 G86	D81-S84 WeakPolarHBondContact O-CB 3.35Å; D81-S84 PolarHBondContact O-N 3.36Å; P82-S84 VanDerWaalsContact C-N 3.3Å; S84-G86 PolarHBondContact O-N 3.44Å
85	I	64.3	Low	80.2	Confident	175 Å²	175	86.5 Å²	86.5	90%	0.897	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	122.1	175.1	-58.3	179.2	0	0	0	109.6	D83	D83-I85 PolarHBondContact O-N 3.21Å; D83-I85 VanDerWaalsContact O-N 3.1Å
86	G	58.9	Low	80.2	Confident	77 Å²	77	87.7 Å²	87.7	79%	0.794	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	93.4	6.2	174.1	0	0	0	0	0	115.8	S84 A88	S84-G86 PolarHBondContact O-N 3.44Å; G86-A88 PolarHBondContact O-N 3.38Å; G86-A88 VanDerWaalsContact O-N 3.16Å
87	A	58.4	Low	80.5	Confident	50 Å²	50	87.3 Å²	87.3	41%	0.413	49%	0.49	S	S	.	.			trans	-69.6	110.4	171.4	0	0	0	0	0	110.3	T80 H89	T80-A87 HydrophobicContact CG2-CB 3.69Å; A87-H89 PolarHBondContact O-N 3.35Å
88	A	59.6	Low	80.7	Confident	63 Å²	63	88.6 Å²	88.6	52%	0.521	50%	0.496	S	S	.	.	S	Bend	trans	-64.4	-21.6	-178.6	0	0	0	0	0	113.5	T56 G86	T56-A88 PolarHBondContact OG1-O 3.37Å; G86-A88 PolarHBondContact O-N 3.38Å; G86-A88 VanDerWaalsContact O-N 3.16Å
89	H	71.4	Confident	81	Confident	85 Å²	85	82.9 Å²	82.9	39%	0.394	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	130.1	-176	-56.6	-55.6	0	0	0	112.4	T53 L54 T80 A87	T53-H89 HydrophobicContact CG2-CB 3.56Å; L54-H89 WeakPolarHBondContact O-CA 3.31Å; L54-H89 WeakPolarHBondContact O-CB 3.46Å; T80-H89 PolarHBondContact OG1-O 3.46Å; A87-H89 PolarHBondContact O-N 3.35Å
90	L	84.6	Confident	81.4	Confident	60 Å²	60	80.3 Å²	80.3	31%	0.314	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	125	173	-78.1	144	0	0	0	109.5	T53 L54 Y92	T53-L90 WeakPolarHBondContact CA-O 3.48Å; L54-L90 HydrophobicContact CB-CB 4.06Å; L54-L90 HydrophobicContact CD1-CD1 4.3Å; L54-L90 PolarHBondContact N-O 3.42Å; L90-Y92 HydrophobicContact CB-CE2 4Å
91	I	90.4	Very high	81.7	Confident	42 Å²	42	80.5 Å²	80.5	22%	0.215	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	126.8	179	-61.9	165	0	0	0	109.5	M51 T52 M78 A79 T80	M51-I91 HydrophobicContact CE-CB 4.37Å; M51-I91 HydrophobicContact CE-CD1 3.75Å; M51-I91 HydrophobicContact CE-CG1 3.84Å; M51-I91 HydrophobicContact CE-CG2 3.6Å; M51-I91 HydrophobicContact CG-CG2 3.96Å; M51-I91 HydrophobicContact SD-CG2 4.43Å; T52-I91 CarbonylContact O-C 3.58Å; T52-I91 WeakPolarHBondContact O-CA 3.18Å; M78-I91 WeakPolarHBondContact O-CG2 3.43Å; A79-I91 VanDerWaalsContact CA-O 3.3Å; A79-I91 WeakPolarHBondContact CA-O 3.4Å; A79-I91 WeakPolarHBondContact CB-O 3.19Å; T80-I91 PolarHBondContact N-O 3.04Å; T80-I91 WeakPolarHBondContact OG1-CB 3.5Å; T80-I91 WeakPolarHBondContact OG1-CG1 3.24Å; T80-I91 PolarHBondContact OG1-N 2.68Å
92	Y	90.9	Very high	81.9	Confident	110 Å²	110	81.8 Å²	81.8	43%	0.431	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	140.3	172.3	-60.5	-88.2	0	0	0	110.7	M51 T52 L54 L90 L103	M51-Y92 WeakPolarHBondContact CA-O 3.37Å; T52-Y92 PolarHBondContact N-O 3.45Å; T52-Y92 PolarHBondContact O-N 3.22Å; L54-Y92 HydrophobicContact CB-CE2 4.4Å; L54-Y92 HydrophobicContact CD1-CE2 4.33Å; L90-Y92 HydrophobicContact CB-CE2 4Å; Y92-L103 HydrophobicContact CD2-CD1 3.71Å; Y92-L103 HydrophobicContact CE2-CD1 3.7Å; Y92-L103 HydrophobicContact CG-CD1 4.46Å
93	C	94.1	Very high	82	Confident	36 Å²	36	81.3 Å²	81.3	24%	0.243	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	136.3	-174	-59.2	0	0	0	0	111.1	C50 C77	C50-C93 WeakPolarHBondContact O-CA 3.47Å; C77-C93 HydrophobicContact CB-CB 3.59Å; C77-C93 WeakPolarHBondContact CB-SG 3.03Å; C77-C93 VanDerWaalsContact SG-CA 3.51Å; C77-C93 WeakPolarHBondContact SG-CB 3.45Å; C77-C93 CovalentContact SG-SG 2.01Å; C77-C93 PolarHBondContact SG-SG 3.42Å
94	C	95	Very high	82.6	Confident	31 Å²	31	78.5 Å²	78.5	21%	0.209	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.6	156.9	172.2	63.1	0	0	0	0	111.5	A49 C50 C99	A49-C94 CarbonylContact C-O 3.56Å; A49-C94 VanDerWaalsContact CA-O 3.31Å; A49-C94 WeakPolarHBondContact CA-O 3.39Å; C50-C94 PolarHBondContact N-O 3.18Å; C50-C94 PolarHBondContact O-N 2.98Å; C94-C99 HydrophobicContact CB-CB 3.76Å; C94-C99 WeakPolarHBondContact CB-SG 3.44Å; C94-C99 WeakPolarHBondContact SG-CB 3.42Å; C94-C99 CovalentContact SG-SG 2.02Å; C94-C99 PolarHBondContact SG-SG 3.3Å
95	F	94.6	Very high	83.3	Confident	126 Å²	126	79.1 Å²	79.1	55%	0.553	43%	0.429	S	S	*	.			trans	-124.8	34.3	-164.4	-58.9	-97.6	0	0	0	112.9	T48 A49	T48-F95 WeakPolarHBondContact O-CD1 3.46Å; A49-F95 HydrophobicContact CB-CD1 3.8Å; A49-F95 HydrophobicContact CB-CE1 3.61Å; A49-F95 HydrophobicContact CB-CG 4.46Å; A49-F95 HydrophobicContact CB-CZ 4.13Å
96	R	94.1	Very high	84.4	Confident	199 Å²	199	73.8 Å²	73.8	75%	0.751	40%	0.403	S	S	*	.	S	Bend	trans	-135.7	155.9	-179.5	-68.4	-179.4	-177.8	-97	0.1	110.2	L98 C99	R96-L98 PolarHBondContact O-N 3.15Å; R96-C99 HydrophobicContact CB-CB 4.04Å; R96-C99 WeakPolarHBondContact O-CB 3.2Å; R96-C99 PolarHBondContact O-N 3.07Å; R96-C99 PolarHBondContact O-SG 3.5Å
97	D	95.9	Very high	85.9	Confident	89 Å²	89	73.6 Å²	73.6	48%	0.476	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.9	128.3	176.1	-67.8	-40.7	0	0	0	111.3	L23 K24 C99	L23-D97 WeakPolarHBondContact CA-OD1 3.19Å; K24-D97 HydrophobicContact CB-CB 4.29Å; K24-D97 PolarHBondContact N-OD1 3.12Å; K24-D97 CarbonylContact O-C 3.52Å; K24-D97 VanDerWaalsContact O-CA 3.3Å; K24-D97 WeakPolarHBondContact O-CA 3.41Å; D97-C99 PolarHBondContact O-N 3.36Å; D97-C99 VanDerWaalsContact O-N 3.09Å
98	L	95.8	Very high	87.6	Confident	52 Å²	52	75.1 Å²	75.1	27%	0.272	38%	0.378	S	S	.	.	T	Hydrogen-bonded Turn	trans	57	24.5	174.8	-52.7	179	0	0	0	113.7	K24 Y26 I40 R96 N100	K24-L98 HydrophobicContact CB-CD2 3.95Å; K24-L98 HydrophobicContact CB-CG 4.26Å; K24-L98 PolarHBondContact O-N 3.38Å; Y26-L98 HydrophobicContact CD2-CB 4.34Å; Y26-L98 HydrophobicContact CD2-CD2 4.36Å; Y26-L98 HydrophobicContact CE1-CD2 4.44Å; Y26-L98 HydrophobicContact CE2-CB 3.76Å; Y26-L98 HydrophobicContact CE2-CD2 4.12Å; Y26-L98 HydrophobicContact CE2-CG 4.42Å; I40-L98 HydrophobicContact CB-CD2 4.49Å; I40-L98 HydrophobicContact CD1-CD1 4.41Å; I40-L98 HydrophobicContact CG1-CD2 4.04Å; I40-L98 HydrophobicContact CG2-CD2 3.98Å; R96-L98 PolarHBondContact O-N 3.15Å; L98-N100 PolarHBondContact O-N 3.42Å
99	C	95.6	Very high	89.4	Confident	45 Å²	45	75.9 Å²	75.9	30%	0.304	37%	0.369	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.4	-18.6	-176.9	61.5	0	0	0	0	114.2	C50 C94 R96 D97 S101	C50-C99 VanDerWaalsContact SG-SG 3.64Å; C94-C99 HydrophobicContact CB-CB 3.76Å; C94-C99 WeakPolarHBondContact CB-SG 3.44Å; C94-C99 WeakPolarHBondContact SG-CB 3.42Å; C94-C99 CovalentContact SG-SG 2.02Å; C94-C99 PolarHBondContact SG-SG 3.3Å; R96-C99 HydrophobicContact CB-CB 4.04Å; R96-C99 WeakPolarHBondContact O-CB 3.2Å; R96-C99 PolarHBondContact O-N 3.07Å; R96-C99 PolarHBondContact O-SG 3.5Å; D97-C99 PolarHBondContact O-N 3.36Å; D97-C99 VanDerWaalsContact O-N 3.09Å; C99-S101 VanDerWaalsContact C-N 3.29Å; C99-S101 PolarHBondContact O-N 3.47Å
100	N	95.1	Very high	90.7	Very high	4 Å²	4	75.2 Å²	75.2	2%	0.021	37%	0.367	C	S	.	.	T	Hydrogen-bonded Turn	trans	-94.5	35	179.6	66.8	-26.8	0	0	0	112.5	Y26 C50 T52 R71 L98	Y26-N100 PolarHBondContact N-OD1 2.02Å; Y26-N100 PolarHBondContact O-ND2 3.41Å; C50-N100 HydrophobicContact CB-CB 3.98Å; T52-N100 WeakPolarHBondContact OG1-CB 3.37Å; R71-N100 WeakPolarHBondContact CD-O 3.38Å; R71-N100 VanDerWaalsContact CZ-O 3.27Å; R71-N100 PolarHBondContact NE-O 3.38Å; R71-N100 PolarHBondContact NH2-O 3.18Å; L98-N100 PolarHBondContact O-N 3.42Å
101	S	90.9	Very high	91.2	Very high	36 Å²	36	76.4 Å²	76.4	25%	0.252	37%	0.371	S	S	.	.	S	Bend	trans	-65.8	-39.7	179.9	47.4	0	0	0	0	113.1	Y26 K38 R71 C99	Y26-S101 VanDerWaalsContact CD2-CA 3.48Å; K38-S101 WeakPolarHBondContact CE-O 3.4Å; K38-S101 PolarHBondContact NZ-O 3.49Å; R71-S101 PolarHBondContact NH2-O 3.46Å; C99-S101 VanDerWaalsContact C-N 3.29Å; C99-S101 PolarHBondContact O-N 3.47Å
102	E	81.6	Confident	91.3	Very high	124 Å²	124	79.3 Å²	79.3	58%	0.579	38%	0.384	S	S	*	.			trans	-119.9	157.3	-175.7	-52.2	-48.4	144.2	0	0	111.1	K38	K38-E102 IonicContact NZ-OE1 2.7Å; K38-E102 PolarHBondContact NZ-OE1 3.36Å; K38-E102 IonicContact NZ-OE2 2.94Å; K38-E102 PolarHBondContact NZ-OE2 2.97Å
103	L	71.8	Confident	91.3	Very high	99 Å²	99	76.5 Å²	76.5	52%	0.518	38%	0.38	S	S	.	.			trans	-125.4	0	163.9	-174.7	81	0	0	0	106.6	T52 L54 P67 V69 Y92	T52-L103 HydrophobicContact CG2-CD1 4.19Å; L54-L103 HydrophobicContact CB-CD2 4.42Å; L54-L103 HydrophobicContact CD1-CD2 3.66Å; L54-L103 HydrophobicContact CG-CD2 3.89Å; P67-L103 HydrophobicContact CB-CD2 3.95Å; P67-L103 HydrophobicContact CG-CD2 3.91Å; V69-L103 HydrophobicContact CG1-CB 4.45Å; V69-L103 HydrophobicContact CG1-CD2 3.41Å; V69-L103 VanDerWaalsContact CG1-CD2 3.41Å; V69-L103 HydrophobicContact CG1-CG 4.4Å; Y92-L103 HydrophobicContact CD2-CD1 3.71Å; Y92-L103 HydrophobicContact CE2-CD1 3.7Å; Y92-L103 HydrophobicContact CG-CD1 4.46Å

Retrieved 103 of 103 residues in 263.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).