A0A096NHK7_PAPAN Loading...

Promotilin

Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.

AlphaFold DB , UniProt , Accession A0A096NHK7, Species PAPAN (Papio anubis, Olive baboon), Gene MLN, Length 115 aa.

						>A0A096NHK7_PAPAN|A0A096NHK7|MLN
MVSRKAVAALLVVHAAAMLASQTEAFVPIFTYGELQRMQEKERSKGQKKSLSVWQRSEEEGPVDLAEPIEEEGNEMIKLTAPLEIGMRMNSRQLEKYRAAVEGLLSEMLPQHAAK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	77.9	Confident	91	Very high	241 Å²	241	115.4 Å²	115.4	100%	1.187	62%	0.615	S	S	*	*				0	128.6	0	-65.6	172.4	73.4	0	0	108
2	V	76.5	Confident	91.4	Very high	110 Å²	110	114.4 Å²	114.4	67%	0.667	62%	0.617	S	S	*	*			trans	-70.8	134.1	179.8	-161.6	0	0	0	0	108.5	A6 V7	V2-A6 HydrophobicContact CG1-CB 3.98Å; V2-V7 HydrophobicContact CB-CG2 4.29Å; V2-V7 HydrophobicContact CG1-CG2 4.16Å
3	S	91.4	Very high	91.8	Very high	66 Å²	66	113.2 Å²	113.2	46%	0.462	62%	0.615	S	S	.	*			trans	-66.3	143.4	-178	81.8	0	0	0	0	110.4	K5 A6 V7	S3-K5 PolarHBondContact O-N 3.19Å; S3-K5 VanDerWaalsContact O-N 3.15Å; S3-A6 WeakPolarHBondContact O-CB 3.43Å; S3-A6 PolarHBondContact O-N 3.17Å; S3-A6 WeakPolarHBondContact OG-CB 3.44Å; S3-A6 PolarHBondContact OG-N 3.48Å; S3-A6 VanDerWaalsContact OG-N 3.09Å; S3-V7 PolarHBondContact O-N 2.97Å; S3-V7 VanDerWaalsContact O-N 3.07Å
4	R	92.4	Very high	91.8	Very high	233 Å²	233	113.6 Å²	113.6	88%	0.879	61%	0.611	S	S	*	*	H	α-helix	trans	-55.4	-33.3	176.5	-70	-177.9	-178.9	170.3	-0.4	112.2	V7 A8	R4-V7 PolarHBondContact O-N 3.43Å; R4-A8 WeakPolarHBondContact O-CB 3.4Å; R4-A8 PolarHBondContact O-N 2.68Å
5	K	91.9	Very high	91.8	Very high	181 Å²	181	109.3 Å²	109.3	79%	0.787	60%	0.596	S	S	*	*	H	α-helix	trans	-65.1	-41.7	175.6	-65.8	-174.9	178.2	-177.9	0	112.2	S3 A8 A9	S3-K5 PolarHBondContact O-N 3.19Å; S3-K5 VanDerWaalsContact O-N 3.15Å; K5-A8 PolarHBondContact O-N 3.37Å; K5-A9 WeakPolarHBondContact O-CB 3.31Å; K5-A9 PolarHBondContact O-N 3.29Å
6	A	95.1	Very high	91.7	Very high	38 Å²	38	106.1 Å²	106.1	31%	0.314	59%	0.59	S	S	.	*	H	α-helix	trans	-66.6	-39.6	176.6	0	0	0	0	0	111.6	V2 S3 A9 L10	V2-A6 HydrophobicContact CG1-CB 3.98Å; S3-A6 WeakPolarHBondContact O-CB 3.43Å; S3-A6 PolarHBondContact O-N 3.17Å; S3-A6 WeakPolarHBondContact OG-CB 3.44Å; S3-A6 PolarHBondContact OG-N 3.48Å; S3-A6 VanDerWaalsContact OG-N 3.09Å; A6-A9 PolarHBondContact O-N 2.64Å; A6-L10 WeakPolarHBondContact O-CB 3.43Å; A6-L10 WeakPolarHBondContact O-CG 3.25Å; A6-L10 PolarHBondContact O-N 3.13Å
7	V	94.4	Very high	91.5	Very high	67 Å²	67	103.3 Å²	103.3	41%	0.406	58%	0.583	S	S	.	*	H	α-helix	trans	-63.1	-44.8	174.4	178.2	0	0	0	0	111.1	V2 S3 R4 A9 L10 L11	V2-V7 HydrophobicContact CB-CG2 4.29Å; V2-V7 HydrophobicContact CG1-CG2 4.16Å; S3-V7 PolarHBondContact O-N 2.97Å; S3-V7 VanDerWaalsContact O-N 3.07Å; R4-V7 PolarHBondContact O-N 3.43Å; V7-A9 PolarHBondContact O-N 2.9Å; V7-L10 PolarHBondContact O-N 2.72Å; V7-L11 HydrophobicContact CG1-CD1 4.17Å; V7-L11 WeakPolarHBondContact O-CG 3.45Å; V7-L11 PolarHBondContact O-N 3.23Å
8	A	95.1	Very high	91.3	Very high	51 Å²	51	102.1 Å²	102.1	42%	0.421	57%	0.573	S	S	.	*	H	α-helix	trans	-61.6	-43.8	176.5	0	0	0	0	0	112.2	R4 K5 L10 L11 V12	R4-A8 WeakPolarHBondContact O-CB 3.4Å; R4-A8 PolarHBondContact O-N 2.68Å; K5-A8 PolarHBondContact O-N 3.37Å; A8-L10 PolarHBondContact O-N 2.89Å; A8-L11 PolarHBondContact O-N 3.11Å; A8-V12 WeakPolarHBondContact O-CG2 3.46Å; A8-V12 PolarHBondContact O-N 3.3Å
9	A	95.9	Very high	90.9	Very high	56 Å²	56	103.2 Å²	103.2	46%	0.463	58%	0.577	S	S	.	*	H	α-helix	trans	-61.2	-43.9	176.2	0	0	0	0	0	111.8	K5 A6 V7 L11 V12 V13	K5-A9 WeakPolarHBondContact O-CB 3.31Å; K5-A9 PolarHBondContact O-N 3.29Å; A6-A9 PolarHBondContact O-N 2.64Å; V7-A9 PolarHBondContact O-N 2.9Å; A9-L11 VanDerWaalsContact C-N 3.35Å; A9-L11 PolarHBondContact O-N 2.96Å; A9-V12 PolarHBondContact O-N 3.22Å; A9-V13 WeakPolarHBondContact O-CG2 3.47Å; A9-V13 PolarHBondContact O-N 3.48Å
10	L	95.1	Very high	90.3	Very high	115 Å²	115	100.8 Å²	100.8	60%	0.602	57%	0.571	S	S	*	*	H	α-helix	trans	-61.5	-41.1	176	-84.3	159.8	0	0	0	112.3	A6 V7 A8 V13 H14	A6-L10 WeakPolarHBondContact O-CB 3.43Å; A6-L10 WeakPolarHBondContact O-CG 3.25Å; A6-L10 PolarHBondContact O-N 3.13Å; V7-L10 PolarHBondContact O-N 2.72Å; A8-L10 PolarHBondContact O-N 2.89Å; L10-V13 PolarHBondContact O-N 3.03Å; L10-H14 VanDerWaalsContact O-CB 3.3Å; L10-H14 WeakPolarHBondContact O-CB 3.47Å; L10-H14 PolarHBondContact O-N 3.11Å
11	L	95.3	Very high	89.6	Confident	111 Å²	111	99 Å²	99	58%	0.581	56%	0.564	S	S	*	*	H	α-helix	trans	-64.4	-41.4	176.7	-72.9	170.3	0	0	0	112.2	V7 A8 A9 H14 A15	V7-L11 HydrophobicContact CG1-CD1 4.17Å; V7-L11 WeakPolarHBondContact O-CG 3.45Å; V7-L11 PolarHBondContact O-N 3.23Å; A8-L11 PolarHBondContact O-N 3.11Å; A9-L11 VanDerWaalsContact C-N 3.35Å; A9-L11 PolarHBondContact O-N 2.96Å; L11-H14 PolarHBondContact O-N 3.46Å; L11-A15 WeakPolarHBondContact O-CB 3.49Å; L11-A15 PolarHBondContact O-N 3.47Å
12	V	95.8	Very high	89.1	Confident	104 Å²	104	93.8 Å²	93.8	63%	0.63	54%	0.537	S	S	*	.	H	α-helix	trans	-63.2	-46.5	176.1	171.6	0	0	0	0	111	A8 A9 H14 A15 A16	A8-V12 WeakPolarHBondContact O-CG2 3.46Å; A8-V12 PolarHBondContact O-N 3.3Å; A9-V12 PolarHBondContact O-N 3.22Å; V12-H14 VanDerWaalsContact C-N 3.31Å; V12-H14 PolarHBondContact O-N 3.03Å; V12-A15 PolarHBondContact O-N 3.38Å; V12-A16 WeakPolarHBondContact O-CB 3.35Å; V12-A16 PolarHBondContact O-N 2.91Å
13	V	96	Very high	88.5	Confident	99 Å²	99	92.3 Å²	92.3	60%	0.6	53%	0.529	S	S	*	.	H	α-helix	trans	-61.5	-41.8	177.1	171.6	0	0	0	0	110.9	A9 L10 A16 A17	A9-V13 WeakPolarHBondContact O-CG2 3.47Å; A9-V13 PolarHBondContact O-N 3.48Å; L10-V13 PolarHBondContact O-N 3.03Å; V13-A16 PolarHBondContact O-N 3.39Å; V13-A17 WeakPolarHBondContact O-CB 3.39Å; V13-A17 PolarHBondContact O-N 3.31Å
14	H	91.9	Very high	86.7	Confident	119 Å²	119	97.5 Å²	97.5	55%	0.551	55%	0.546	S	S	*	.	H	α-helix	trans	-64.5	-44.4	177.9	-177.5	60.8	0	0	0	112.4	L10 L11 V12 A17 M18	L10-H14 VanDerWaalsContact O-CB 3.3Å; L10-H14 WeakPolarHBondContact O-CB 3.47Å; L10-H14 PolarHBondContact O-N 3.11Å; L11-H14 PolarHBondContact O-N 3.46Å; V12-H14 VanDerWaalsContact C-N 3.31Å; V12-H14 PolarHBondContact O-N 3.03Å; H14-A17 PolarHBondContact O-N 2.99Å; H14-M18 WeakPolarHBondContact O-CB 3.28Å; H14-M18 WeakPolarHBondContact O-CG 3.45Å; H14-M18 PolarHBondContact O-N 3.48Å
15	A	91.8	Very high	85	Confident	48 Å²	48	90.6 Å²	90.6	40%	0.397	54%	0.538	S	S	.	.	H	α-helix	trans	-61.1	-45.4	175.4	0	0	0	0	0	111.4	L11 V12 A17 M18 L19	L11-A15 WeakPolarHBondContact O-CB 3.49Å; L11-A15 PolarHBondContact O-N 3.47Å; V12-A15 PolarHBondContact O-N 3.38Å; A15-A17 VanDerWaalsContact C-N 3.35Å; A15-A17 PolarHBondContact O-N 3.02Å; A15-M18 PolarHBondContact O-N 3.34Å; A15-L19 WeakPolarHBondContact O-CD1 3.13Å; A15-L19 PolarHBondContact O-N 3.48Å
16	A	90.8	Very high	83.3	Confident	59 Å²	59	90 Å²	90	49%	0.488	54%	0.536	S	S	.	.	H	α-helix	trans	-61.2	-42.1	177.1	0	0	0	0	0	112.3	V12 V13 L19 A20	V12-A16 WeakPolarHBondContact O-CB 3.35Å; V12-A16 PolarHBondContact O-N 2.91Å; V13-A16 PolarHBondContact O-N 3.39Å; A16-L19 PolarHBondContact O-N 3.07Å; A16-A20 WeakPolarHBondContact O-CB 3.43Å; A16-A20 PolarHBondContact O-N 3.29Å
17	A	87.6	Confident	81.6	Confident	58 Å²	58	93.4 Å²	93.4	48%	0.479	55%	0.553	S	S	.	*	H	α-helix	trans	-65	-41.8	176.1	0	0	0	0	0	112.2	V13 H14 A15 A20 S21	V13-A17 WeakPolarHBondContact O-CB 3.39Å; V13-A17 PolarHBondContact O-N 3.31Å; H14-A17 PolarHBondContact O-N 2.99Å; A15-A17 VanDerWaalsContact C-N 3.35Å; A15-A17 PolarHBondContact O-N 3.02Å; A17-A20 PolarHBondContact O-N 3.35Å; A17-S21 WeakPolarHBondContact O-CB 3.42Å; A17-S21 PolarHBondContact O-N 3.48Å; A17-S21 PolarHBondContact O-OG 3.31Å
18	M	88.4	Confident	80.1	Confident	82 Å²	82	94.2 Å²	94.2	40%	0.404	56%	0.56	S	S	.	*	H	α-helix	trans	-61.3	-45.5	174.5	-77.8	-68.7	-63.8	0	0	111.4	H14 A15 S21 Q22	H14-M18 WeakPolarHBondContact O-CB 3.28Å; H14-M18 WeakPolarHBondContact O-CG 3.45Å; H14-M18 PolarHBondContact O-N 3.48Å; A15-M18 PolarHBondContact O-N 3.34Å; M18-S21 PolarHBondContact O-N 3.04Å; M18-S21 PolarHBondContact O-OG 3.16Å; M18-Q22 WeakPolarHBondContact O-CG 3.47Å; M18-Q22 PolarHBondContact O-N 3.37Å
19	L	83.8	Confident	78.6	Confident	122 Å²	122	98.8 Å²	98.8	64%	0.639	58%	0.576	S	S	*	*	H	α-helix	trans	-60.3	-48.7	175.1	-92	78.5	0	0	0	111	A15 A16 S21 Q22 T23	A15-L19 WeakPolarHBondContact O-CD1 3.13Å; A15-L19 PolarHBondContact O-N 3.48Å; A16-L19 PolarHBondContact O-N 3.07Å; L19-S21 VanDerWaalsContact C-N 3.33Å; L19-S21 PolarHBondContact O-N 3.42Å; L19-Q22 PolarHBondContact O-N 3.08Å; L19-Q22 VanDerWaalsContact O-N 3.13Å; L19-T23 WeakPolarHBondContact O-CG2 3.24Å; L19-T23 PolarHBondContact O-N 2.99Å
20	A	79.4	Confident	76.9	Confident	56 Å²	56	101.1 Å²	101.1	46%	0.463	58%	0.575	S	S	.	*	H	α-helix	trans	-59.7	-42.2	178.3	0	0	0	0	0	112.1	A16 A17 Q22 T23	A16-A20 WeakPolarHBondContact O-CB 3.43Å; A16-A20 PolarHBondContact O-N 3.29Å; A17-A20 PolarHBondContact O-N 3.35Å; A20-Q22 VanDerWaalsContact C-N 3.31Å; A20-Q22 PolarHBondContact O-N 3.36Å; A20-T23 WeakPolarHBondContact CA-OG1 3.47Å; A20-T23 PolarHBondContact O-N 2.89Å; A20-T23 VanDerWaalsContact O-N 3.13Å; A20-T23 PolarHBondContact O-OG1 2.93Å
21	S	74.6	Confident	76.2	Confident	62 Å²	62	99.7 Å²	99.7	43%	0.434	57%	0.571	S	S	.	*	H	α-helix	trans	-64.7	-33.2	176.1	71	0	0	0	0	113.1	A17 M18 L19 T23	A17-S21 WeakPolarHBondContact O-CB 3.42Å; A17-S21 PolarHBondContact O-N 3.48Å; A17-S21 PolarHBondContact O-OG 3.31Å; M18-S21 PolarHBondContact O-N 3.04Å; M18-S21 PolarHBondContact O-OG 3.16Å; L19-S21 VanDerWaalsContact C-N 3.33Å; L19-S21 PolarHBondContact O-N 3.42Å; S21-T23 VanDerWaalsContact C-N 3.32Å
22	Q	68.8	Low	75.1	Confident	133 Å²	133	103.6 Å²	103.6	62%	0.621	58%	0.58	S	S	*	*	H	α-helix	trans	-78.7	-15.7	175.5	-70.5	-170.4	38.3	0	0	113.1	M18 L19 A20 E24	M18-Q22 WeakPolarHBondContact O-CG 3.47Å; M18-Q22 PolarHBondContact O-N 3.37Å; L19-Q22 PolarHBondContact O-N 3.08Å; L19-Q22 VanDerWaalsContact O-N 3.13Å; A20-Q22 VanDerWaalsContact C-N 3.31Å; A20-Q22 PolarHBondContact O-N 3.36Å; Q22-E24 VanDerWaalsContact C-N 3.26Å; Q22-E24 PolarHBondContact O-N 2.93Å
23	T	63.6	Low	74.1	Confident	79 Å²	79	100.1 Å²	100.1	49%	0.485	57%	0.565	S	S	.	*	G	3₁₀ helix	trans	-76.6	-5.6	174.4	58.6	0	0	0	0	114.3	L19 A20 S21 A25 F26	L19-T23 WeakPolarHBondContact O-CG2 3.24Å; L19-T23 PolarHBondContact O-N 2.99Å; A20-T23 WeakPolarHBondContact CA-OG1 3.47Å; A20-T23 PolarHBondContact O-N 2.89Å; A20-T23 VanDerWaalsContact O-N 3.13Å; A20-T23 PolarHBondContact O-OG1 2.93Å; S21-T23 VanDerWaalsContact C-N 3.32Å; T23-A25 PolarHBondContact O-N 2.95Å; T23-A25 VanDerWaalsContact O-N 3.13Å; T23-F26 PolarHBondContact O-N 2.98Å
24	E	54	Low	73.2	Confident	174 Å²	174	98.6 Å²	98.6	81%	0.813	55%	0.551	S	S	*	*	G	3₁₀ helix	trans	-59.8	-21	169.5	-70.9	-174	176.6	0	0	112.8	Q22	Q22-E24 VanDerWaalsContact C-N 3.26Å; Q22-E24 PolarHBondContact O-N 2.93Å
25	A	55.8	Low	72.5	Confident	88 Å²	88	97.8 Å²	97.8	73%	0.727	55%	0.55	S	S	*	*	G	3₁₀ helix	trans	-94.3	-7.2	173.4	0	0	0	0	0	114	T23 V27	T23-A25 PolarHBondContact O-N 2.95Å; T23-A25 VanDerWaalsContact O-N 3.13Å; A25-V27 PolarHBondContact O-N 3.4Å; A25-V27 VanDerWaalsContact O-N 3.12Å
26	F	55.3	Low	72	Confident	168 Å²	168	100.7 Å²	100.7	74%	0.737	56%	0.556	S	S	*	*			trans	-86.4	69.8	170.9	-105.2	-89.4	0	0	0	108.8	T23 P28	T23-F26 PolarHBondContact O-N 2.98Å; F26-P28 VanDerWaalsContact O-CD 3.27Å; F26-P28 WeakPolarHBondContact O-CD 3.36Å
27	V	60.8	Low	71.4	Confident	110 Å²	110	104.6 Å²	104.6	67%	0.667	56%	0.558	S	S	*	*			trans	-62.7	117.7	156.7	-179.4	0	0	0	0	105.3	A25 I29	A25-V27 PolarHBondContact O-N 3.4Å; A25-V27 VanDerWaalsContact O-N 3.12Å; V27-I29 PolarHBondContact O-N 3.36Å
28	P	61.8	Low	71.1	Confident	85 Å²	85	106.8 Å²	106.8	55%	0.552	56%	0.559	S	S	*	*			trans	-56.8	119.7	172.4	23.9	-30.9	0	0	0	106.4	F26 F30	F26-P28 VanDerWaalsContact O-CD 3.27Å; F26-P28 WeakPolarHBondContact O-CD 3.36Å; P28-F30 CarbonylContact O-C 3.49Å; P28-F30 PolarHBondContact O-N 3.42Å
29	I	64.4	Low	70.7	Confident	147 Å²	147	107.5 Å²	107.5	75%	0.754	56%	0.561	S	S	*	*	S	Bend	trans	-50.4	-26	-178.2	-63	170.8	0	0	0	110.6	V27	V27-I29 PolarHBondContact O-N 3.36Å
30	F	59.7	Low	70.4	Confident	105 Å²	105	107.8 Å²	107.8	46%	0.461	56%	0.56	S	S	.	*	S	Bend	trans	-122	122.4	170.2	-57.2	-72	0	0	0	111.4	P28 E34 L35 M38	P28-F30 CarbonylContact O-C 3.49Å; P28-F30 PolarHBondContact O-N 3.42Å; F30-E34 VanDerWaalsContact CA-OE2 3.29Å; F30-E34 WeakPolarHBondContact CA-OE2 3.3Å; F30-E34 HydrophobicContact CB-CB 4.29Å; F30-E34 HydrophobicContact CD1-CB 4.3Å; F30-L35 HydrophobicContact CB-CD1 3.61Å; F30-M38 HydrophobicContact CD1-SD 4.1Å; F30-M38 HydrophobicContact CE1-SD 4.09Å
31	T	80.7	Confident	70.4	Confident	84 Å²	84	111.8 Å²	111.8	52%	0.515	57%	0.567	S	S	.	*			trans	-67.6	152.6	166.4	-56.5	0	0	0	0	109.4	G33 E34 L35	T31-G33 PolarHBondContact O-N 3.07Å; T31-G33 VanDerWaalsContact O-N 3.12Å; T31-E34 PolarHBondContact N-OE2 3.43Å; T31-E34 WeakPolarHBondContact O-CA 3.49Å; T31-E34 VanDerWaalsContact O-CB 3.3Å; T31-E34 WeakPolarHBondContact O-CB 3.45Å; T31-E34 PolarHBondContact O-N 3.15Å; T31-L35 PolarHBondContact O-N 3.31Å
32	Y	71.4	Confident	70.2	Confident	194 Å²	194	115.7 Å²	115.7	76%	0.761	58%	0.578	S	S	*	*	H	α-helix	trans	-50.5	-39.9	179.3	-178.6	-98.6	0	0	0	113.7	E34 L35 Q36	Y32-E34 VanDerWaalsContact C-N 3.26Å; Y32-E34 PolarHBondContact O-N 3.35Å; Y32-L35 PolarHBondContact O-N 3.02Å; Y32-Q36 PolarHBondContact O-N 2.96Å
33	G	74.6	Confident	70.4	Confident	30 Å²	30	117.6 Å²	117.6	31%	0.309	58%	0.579	S	S	.	*	H	α-helix	trans	-68.3	-19.7	175.1	0	0	0	0	0	114.6	T31 R37	T31-G33 PolarHBondContact O-N 3.07Å; T31-G33 VanDerWaalsContact O-N 3.12Å; G33-R37 WeakPolarHBondContact O-CB 3.48Å; G33-R37 VanDerWaalsContact O-CG 3.26Å; G33-R37 WeakPolarHBondContact O-CG 3.44Å; G33-R37 PolarHBondContact O-N 2.98Å; G33-R37 PolarHBondContact O-NE 2.95Å
34	E	78	Confident	70.3	Confident	67 Å²	67	115.9 Å²	115.9	31%	0.313	57%	0.571	S	S	.	*	H	α-helix	trans	-79.3	-40	172.5	-69.3	167.4	158.9	0	0	111.3	F30 T31 Y32 R37 M38	F30-E34 VanDerWaalsContact CA-OE2 3.29Å; F30-E34 WeakPolarHBondContact CA-OE2 3.3Å; F30-E34 HydrophobicContact CB-CB 4.29Å; F30-E34 HydrophobicContact CD1-CB 4.3Å; T31-E34 PolarHBondContact N-OE2 3.43Å; T31-E34 WeakPolarHBondContact O-CA 3.49Å; T31-E34 VanDerWaalsContact O-CB 3.3Å; T31-E34 WeakPolarHBondContact O-CB 3.45Å; T31-E34 PolarHBondContact O-N 3.15Å; Y32-E34 VanDerWaalsContact C-N 3.26Å; Y32-E34 PolarHBondContact O-N 3.35Å; E34-R37 VanDerWaalsContact CG-NH2 3.28Å; E34-R37 PolarHBondContact O-N 2.91Å; E34-R37 IonicContact OE1-NH2 3.37Å; E34-M38 WeakPolarHBondContact O-CG 3.35Å; E34-M38 PolarHBondContact O-N 2.89Å
35	L	77.8	Confident	70.8	Confident	103 Å²	103	114.3 Å²	114.3	54%	0.539	56%	0.561	S	S	.	*	H	α-helix	trans	-59.5	-46	170.5	-101.6	96.6	0	0	0	111.5	F30 T31 Y32 R37 M38 Q39	F30-L35 HydrophobicContact CB-CD1 3.61Å; T31-L35 PolarHBondContact O-N 3.31Å; Y32-L35 PolarHBondContact O-N 3.02Å; L35-R37 VanDerWaalsContact C-N 3.31Å; L35-R37 PolarHBondContact O-N 3.29Å; L35-M38 PolarHBondContact O-N 3.47Å; L35-Q39 WeakPolarHBondContact O-CB 3.43Å; L35-Q39 PolarHBondContact O-N 2.95Å
36	Q	79.8	Confident	70.9	Confident	109 Å²	109	112.1 Å²	112.1	51%	0.509	55%	0.547	S	S	.	.	H	α-helix	trans	-60	-42.3	178.1	-173.8	176.4	-4.8	0	0	111.6	Y32 Q39 E40	Y32-Q36 PolarHBondContact O-N 2.96Å; Q36-Q39 PolarHBondContact O-N 3.48Å; Q36-E40 WeakPolarHBondContact O-CB 3.38Å; Q36-E40 PolarHBondContact O-N 3.41Å
37	R	78.2	Confident	70.9	Confident	141 Å²	141	111.5 Å²	111.5	53%	0.532	55%	0.546	S	S	.	.	H	α-helix	trans	-67.5	-34.5	175.9	-76.2	-174.8	-65.9	175.7	1.2	113	G33 E34 L35 K41	G33-R37 WeakPolarHBondContact O-CB 3.48Å; G33-R37 VanDerWaalsContact O-CG 3.26Å; G33-R37 WeakPolarHBondContact O-CG 3.44Å; G33-R37 PolarHBondContact O-N 2.98Å; G33-R37 PolarHBondContact O-NE 2.95Å; E34-R37 VanDerWaalsContact CG-NH2 3.28Å; E34-R37 PolarHBondContact O-N 2.91Å; E34-R37 IonicContact OE1-NH2 3.37Å; L35-R37 VanDerWaalsContact C-N 3.31Å; L35-R37 PolarHBondContact O-N 3.29Å; R37-K41 WeakPolarHBondContact O-CB 3.46Å; R37-K41 VanDerWaalsContact O-CG 3.22Å; R37-K41 WeakPolarHBondContact O-CG 3.44Å; R37-K41 PolarHBondContact O-N 3.41Å
38	M	82.6	Confident	70.7	Confident	103 Å²	103	113.8 Å²	113.8	51%	0.507	55%	0.547	S	S	.	.	H	α-helix	trans	-67	-44	174.6	-74.5	173	66.1	0	0	111.2	F30 E34 L35 K41 E42	F30-M38 HydrophobicContact CD1-SD 4.1Å; F30-M38 HydrophobicContact CE1-SD 4.09Å; E34-M38 WeakPolarHBondContact O-CG 3.35Å; E34-M38 PolarHBondContact O-N 2.89Å; L35-M38 PolarHBondContact O-N 3.47Å; M38-K41 PolarHBondContact O-N 3.48Å; M38-E42 PolarHBondContact O-N 3.3Å
39	Q	80.1	Confident	70.3	Confident	97 Å²	97	116.5 Å²	116.5	45%	0.453	55%	0.551	S	S	.	*	H	α-helix	trans	-64.1	-42.1	176.9	-172.6	-175.5	12	0	0	112.3	L35 Q36 E42 R43	L35-Q39 WeakPolarHBondContact O-CB 3.43Å; L35-Q39 PolarHBondContact O-N 2.95Å; Q36-Q39 PolarHBondContact O-N 3.48Å; Q39-E42 PolarHBondContact O-N 2.88Å; Q39-R43 WeakPolarHBondContact O-CG 3.44Å; Q39-R43 PolarHBondContact O-N 2.75Å
40	E	77.6	Confident	69.8	Low	129 Å²	129	113.3 Å²	113.3	60%	0.603	54%	0.541	S	S	*	.	H	α-helix	trans	-64.3	-41.9	176.1	-172.7	179.4	-175.9	0	0	111.7	Q36 E42 R43 S44	Q36-E40 WeakPolarHBondContact O-CB 3.38Å; Q36-E40 PolarHBondContact O-N 3.41Å; E40-E42 VanDerWaalsContact C-N 3.33Å; E40-E42 PolarHBondContact O-N 2.87Å; E40-R43 PolarHBondContact O-N 3.02Å; E40-S44 WeakPolarHBondContact O-CB 3.37Å; E40-S44 PolarHBondContact O-N 2.96Å
41	K	78.1	Confident	69.3	Low	140 Å²	140	115.1 Å²	115.1	61%	0.609	56%	0.555	S	S	*	*	H	α-helix	trans	-61.8	-40.4	174.5	-77.7	173.9	-179.2	-178.3	0	112	R37 M38 S44 K45	R37-K41 WeakPolarHBondContact O-CB 3.46Å; R37-K41 VanDerWaalsContact O-CG 3.22Å; R37-K41 WeakPolarHBondContact O-CG 3.44Å; R37-K41 PolarHBondContact O-N 3.41Å; M38-K41 PolarHBondContact O-N 3.48Å; K41-S44 PolarHBondContact O-N 3.09Å; K41-S44 PolarHBondContact O-OG 2.76Å; K41-K45 WeakPolarHBondContact O-CG 3.4Å; K41-K45 PolarHBondContact O-N 3.4Å; K41-K45 VanDerWaalsContact O-N 3.13Å
42	E	71.7	Confident	67.9	Low	143 Å²	143	114.1 Å²	114.1	67%	0.668	55%	0.552	S	S	*	*	H	α-helix	trans	-64.3	-46.6	175.4	-164.7	-149.1	108.8	0	0	111.8	M38 Q39 E40 S44 K45	M38-E42 PolarHBondContact O-N 3.3Å; Q39-E42 PolarHBondContact O-N 2.88Å; E40-E42 VanDerWaalsContact C-N 3.33Å; E40-E42 PolarHBondContact O-N 2.87Å; E42-S44 VanDerWaalsContact C-N 3.32Å; E42-S44 PolarHBondContact O-N 3.37Å; E42-K45 WeakPolarHBondContact O-CB 3.45Å; E42-K45 PolarHBondContact O-N 2.91Å; E42-K45 VanDerWaalsContact O-N 3.12Å
43	R	71.6	Confident	66.7	Low	173 Å²	173	110 Å²	110	65%	0.653	55%	0.546	S	S	*	.	H	α-helix	trans	-59.4	-41	174.6	-73.3	178.2	173	174.4	-2.2	112.6	Q39 E40 K45 G46	Q39-R43 WeakPolarHBondContact O-CG 3.44Å; Q39-R43 PolarHBondContact O-N 2.75Å; E40-R43 PolarHBondContact O-N 3.02Å; R43-K45 VanDerWaalsContact C-N 3.29Å; R43-K45 PolarHBondContact O-N 3.28Å; R43-G46 PolarHBondContact O-N 2.9Å; R43-G46 VanDerWaalsContact O-N 3.14Å
44	S	63.1	Low	65	Low	43 Å²	43	119.3 Å²	119.3	30%	0.301	57%	0.572	S	S	.	*	H	α-helix	trans	-67.6	-26.6	177.8	78.7	0	0	0	0	113.6	E40 K41 E42 G46 Q47 K48	E40-S44 WeakPolarHBondContact O-CB 3.37Å; E40-S44 PolarHBondContact O-N 2.96Å; K41-S44 PolarHBondContact O-N 3.09Å; K41-S44 PolarHBondContact O-OG 2.76Å; E42-S44 VanDerWaalsContact C-N 3.32Å; E42-S44 PolarHBondContact O-N 3.37Å; S44-G46 VanDerWaalsContact C-N 3.25Å; S44-G46 PolarHBondContact O-N 3.4Å; S44-Q47 PolarHBondContact O-N 3.13Å; S44-K48 PolarHBondContact O-N 3.36Å; S44-K48 VanDerWaalsContact O-N 3.1Å
45	K	62.9	Low	63.3	Low	142 Å²	142	124.5 Å²	124.5	62%	0.617	60%	0.597	S	S	*	*	H	α-helix	trans	-68.4	-25	173.6	-77.9	177.6	176.5	-177	0	112.1	K41 E42 R43 K49	K41-K45 WeakPolarHBondContact O-CG 3.4Å; K41-K45 PolarHBondContact O-N 3.4Å; K41-K45 VanDerWaalsContact O-N 3.13Å; E42-K45 WeakPolarHBondContact O-CB 3.45Å; E42-K45 PolarHBondContact O-N 2.91Å; E42-K45 VanDerWaalsContact O-N 3.12Å; R43-K45 VanDerWaalsContact C-N 3.29Å; R43-K45 PolarHBondContact O-N 3.28Å; K45-K49 WeakPolarHBondContact O-CD 3.46Å; K45-K49 WeakPolarHBondContact O-CG 3.39Å
46	G	59	Low	61.6	Low	42 Å²	42	129.2 Å²	129.2	43%	0.433	61%	0.607	S	S	.	*	H	α-helix	trans	-66.7	-43.7	169.8	0	0	0	0	0	112.4	R43 S44 S50	R43-G46 PolarHBondContact O-N 2.9Å; R43-G46 VanDerWaalsContact O-N 3.14Å; S44-G46 VanDerWaalsContact C-N 3.25Å; S44-G46 PolarHBondContact O-N 3.4Å; G46-S50 PolarHBondContact O-OG 3.33Å
47	Q	55.2	Low	60	Low	154 Å²	154	128.4 Å²	128.4	72%	0.72	61%	0.614	S	S	*	*	H	α-helix	trans	-72.8	-32.5	-179.9	-91	-175	-62.8	0	0	114.6	S44 K49 S50	S44-Q47 PolarHBondContact O-N 3.13Å; Q47-K49 VanDerWaalsContact C-N 3.26Å; Q47-K49 PolarHBondContact O-N 2.86Å; Q47-S50 PolarHBondContact O-N 3.44Å; Q47-S50 PolarHBondContact O-OG 2.93Å
48	K	56	Low	58.3	Low	158 Å²	158	130.9 Å²	130.9	69%	0.687	63%	0.631	S	S	*	*	H	α-helix	trans	-69.2	-24.3	178.4	-70.5	-171.7	-179.8	-170.6	0	113.3	S44	S44-K48 PolarHBondContact O-N 3.36Å; S44-K48 VanDerWaalsContact O-N 3.1Å
49	K	54	Low	56.4	Low	142 Å²	142	134.8 Å²	134.8	62%	0.617	65%	0.648	S	S	*	*	H	α-helix	trans	-70.5	-32.9	176	-66.6	170.4	-176.6	-172.1	0	111.9	K45 Q47 L51 S52 V53	K45-K49 WeakPolarHBondContact O-CD 3.46Å; K45-K49 WeakPolarHBondContact O-CG 3.39Å; Q47-K49 VanDerWaalsContact C-N 3.26Å; Q47-K49 PolarHBondContact O-N 2.86Å; K49-L51 VanDerWaalsContact C-N 3.27Å; K49-L51 PolarHBondContact O-N 3.36Å; K49-S52 PolarHBondContact O-N 3.36Å; K49-S52 PolarHBondContact O-OG 3.4Å; K49-V53 WeakPolarHBondContact O-CG2 3.07Å; K49-V53 PolarHBondContact O-N 2.92Å
50	S	52.8	Low	54.4	Low	80 Å²	80	138.7 Å²	138.7	56%	0.559	67%	0.666	S	S	*	*	H	α-helix	trans	-65.8	-30.4	179.8	-34.3	0	0	0	0	112.8	G46 Q47	G46-S50 PolarHBondContact O-OG 3.33Å; Q47-S50 PolarHBondContact O-N 3.44Å; Q47-S50 PolarHBondContact O-OG 2.93Å
51	L	50.1	Low	52.2	Low	143 Å²	143	135.5 Å²	135.5	75%	0.749	67%	0.668	S	S	*	*	H	α-helix	trans	-81.1	-34.2	-179.9	-142.8	162.2	0	0	0	111.4	K49 V53	K49-L51 VanDerWaalsContact C-N 3.27Å; K49-L51 PolarHBondContact O-N 3.36Å; L51-V53 VanDerWaalsContact C-N 3.32Å; L51-V53 PolarHBondContact O-N 3.44Å
52	S	50.3	Low	50.9	Low	64 Å²	64	134.8 Å²	134.8	45%	0.448	68%	0.678	S	S	.	*	H	α-helix	trans	-74.4	-15.8	177.6	54.4	0	0	0	0	114.8	K49	K49-S52 PolarHBondContact O-N 3.36Å; K49-S52 PolarHBondContact O-OG 3.4Å
53	V	46.5	Very low	49.1	Very low	107 Å²	107	134.8 Å²	134.8	65%	0.648	69%	0.688	S	S	*	*	H	α-helix	trans	-78	-27.6	178.7	168	0	0	0	0	112.1	K49 L51 Q55	K49-V53 WeakPolarHBondContact O-CG2 3.07Å; K49-V53 PolarHBondContact O-N 2.92Å; L51-V53 VanDerWaalsContact C-N 3.32Å; L51-V53 PolarHBondContact O-N 3.44Å; V53-Q55 VanDerWaalsContact C-N 3.33Å; V53-Q55 PolarHBondContact O-N 2.95Å
54	W	39.5	Very low	47.5	Very low	225 Å²	225	133 Å²	133	85%	0.852	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-20.9	179.5	-116.4	76.9	0	0	0	114.1
55	Q	43.3	Very low	46.1	Very low	177 Å²	177	138.8 Å²	138.8	83%	0.827	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94	-2.3	-173.4	-144.1	173.9	28	0	0	113.6	V53	V53-Q55 VanDerWaalsContact C-N 3.33Å; V53-Q55 PolarHBondContact O-N 2.95Å
56	R	40.9	Very low	44.8	Very low	202 Å²	202	136 Å²	136	76%	0.762	72%	0.721	S	S	*	*	S	Bend	trans	-106.8	-9.9	-177	-166.7	176.5	-70.4	161.2	-2.3	113.7	E58	R56-E58 VanDerWaalsContact C-N 3.29Å; R56-E58 PolarHBondContact O-N 2.99Å
57	S	45.7	Very low	43.9	Very low	92 Å²	92	142.5 Å²	142.5	64%	0.643	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	7.2	-175.7	71.4	0	0	0	0	115.3
58	E	43.8	Very low	43.3	Very low	192 Å²	192	140.1 Å²	140.1	90%	0.897	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.9	-7.4	178.7	-164	164.9	96.9	0	0	113.3	R56	R56-E58 VanDerWaalsContact C-N 3.29Å; R56-E58 PolarHBondContact O-N 2.99Å
59	E	41.2	Very low	42.5	Very low	186 Å²	186	138.9 Å²	138.9	87%	0.869	74%	0.737	S	S	*	*			trans	-132.5	71.4	-177.6	-157.8	157.8	161.7	0	0	111.2
60	E	38.3	Very low	42.1	Very low	178 Å²	178	140.2 Å²	140.2	83%	0.832	75%	0.746	S	S	*	*			trans	-97.4	108	174.9	-150.9	86.6	-142.5	0	0	110
61	G	30.9	Very low	41.6	Very low	62 Å²	62	145.1 Å²	145.1	64%	0.639	76%	0.76	S	S	*	*			trans	-133.2	141.9	160.8	0	0	0	0	0	108.6
62	P	51.4	Low	41.5	Very low	126 Å²	126	147.9 Å²	147.9	82%	0.818	77%	0.769	S	S	*	*			trans	-93.2	128.3	-139.5	34	-31.8	0	0	0	112.5
63	V	34.9	Very low	40.9	Very low	143 Å²	143	146.3 Å²	146.3	87%	0.867	76%	0.763	S	S	*	*			trans	-136.4	105.9	150.4	-175.5	0	0	0	0	108.8
64	D	36.8	Very low	41	Very low	135 Å²	135	148.6 Å²	148.6	72%	0.722	77%	0.771	S	S	*	*			trans	-41.6	124.3	162.6	-179.2	25.2	0	0	0	113.1
65	L	35.3	Very low	41.4	Very low	165 Å²	165	147 Å²	147	86%	0.864	77%	0.773	S	S	*	*			trans	-158.2	94.1	136.3	-114.3	153.2	0	0	0	107.6	E67	L65-E67 PolarHBondContact O-N 2.98Å; L65-E67 VanDerWaalsContact O-N 3.07Å
66	A	34.4	Very low	41.5	Very low	82 Å²	82	146.6 Å²	146.6	68%	0.678	77%	0.773	S	S	*	*			trans	-40.6	109.7	170.2	0	0	0	0	0	112.3
67	E	40.1	Very low	42.4	Very low	180 Å²	180	144 Å²	144	84%	0.841	77%	0.773	S	S	*	*			trans	-74.7	148	138.7	-71.4	-173.1	176.8	0	0	107.1	L65	L65-E67 PolarHBondContact O-N 2.98Å; L65-E67 VanDerWaalsContact O-N 3.07Å
68	P	43.8	Very low	42.9	Very low	103 Å²	103	148.4 Å²	148.4	67%	0.669	78%	0.781	S	S	*	*				-145.2	142.9	102.6	20.8	2.2	0	0	0	115.1
69	I	37.7	Very low	43.6	Very low	132 Å²	132	144.5 Å²	144.5	68%	0.677	77%	0.766	S	S	*	*				89.5	107.4	123.2	-68.1	172.1	0	0	0	117.2
70	E	45.5	Very low	44.5	Very low	170 Å²	170	142.3 Å²	142.3	79%	0.794	77%	0.765	S	S	*	*			trans	76.2	97.6	135.2	-57.1	-170.5	-106.2	0	0	118.5
71	E	43.9	Very low	45.7	Very low	183 Å²	183	137 Å²	137	86%	0.855	75%	0.751	S	S	*	*			trans	-139.1	88.8	136.3	-149.2	-178.7	179.7	0	0	109.6	G73	E71-G73 PolarHBondContact O-N 3.23Å
72	E	47.9	Very low	46.9	Very low	202 Å²	202	139 Å²	139	94%	0.944	75%	0.753	S	S	*	*			trans	-61.6	81.3	152.8	-178.7	167.3	-156.7	0	0	107.4
73	G	37.6	Very low	47.3	Very low	31 Å²	31	138.9 Å²	138.9	32%	0.32	75%	0.745	S	S	.	*			trans	-146.5	79.8	-170.9	0	0	0	0	0	109.9	E71 E75	E71-G73 PolarHBondContact O-N 3.23Å; G73-E75 PolarHBondContact O-N 3.13Å
74	N	48.7	Very low	48.5	Very low	154 Å²	154	139.5 Å²	139.5	82%	0.824	74%	0.739	S	S	*	*			trans	34.6	65.1	152	-56.2	-57.5	0	0	0	113.6	M76	N74-M76 PolarHBondContact O-N 3.42Å
75	E	47.3	Very low	49.7	Very low	192 Å²	192	141.1 Å²	141.1	90%	0.897	75%	0.745	S	S	*	*			trans	-65.2	88.8	163.7	-90	-168.5	151.2	0	0	106.1	G73 I77	G73-E75 PolarHBondContact O-N 3.13Å; E75-I77 PolarHBondContact O-N 3.12Å
76	M	46.3	Very low	51.4	Low	168 Å²	168	136 Å²	136	83%	0.828	73%	0.732	S	S	*	*			trans	-43.2	112.4	162.1	-75.6	-179.1	-168.1	0	0	104.8	N74 K78	N74-M76 PolarHBondContact O-N 3.42Å; M76-K78 VanDerWaalsContact C-N 3.25Å; M76-K78 PolarHBondContact O-N 2.92Å
77	I	58	Low	53.4	Low	148 Å²	148	139.7 Å²	139.7	76%	0.759	74%	0.737	S	S	*	*			trans	-50.4	102	172.4	-63.3	169.2	0	0	0	104.9	E75 L79	E75-I77 PolarHBondContact O-N 3.12Å; I77-L79 HydrophobicContact CG2-CD2 4.26Å; I77-L79 PolarHBondContact O-N 2.64Å
78	K	57	Low	55.4	Low	184 Å²	184	142.4 Å²	142.4	80%	0.8	74%	0.74	S	S	*	*			trans	-66.3	94.3	173.4	-90.4	177.4	176.7	169	0	103.9	M76 T80	M76-K78 VanDerWaalsContact C-N 3.25Å; M76-K78 PolarHBondContact O-N 2.92Å; K78-T80 PolarHBondContact O-N 3.13Å; K78-T80 PolarHBondContact O-OG1 3.02Å
79	L	59.5	Low	57.4	Low	111 Å²	111	141.4 Å²	141.4	58%	0.581	73%	0.727	S	S	*	*			trans	-56.9	91	168.1	-67.7	170.6	0	0	0	105.6	I77 A81 L83	I77-L79 HydrophobicContact CG2-CD2 4.26Å; I77-L79 PolarHBondContact O-N 2.64Å; L79-A81 PolarHBondContact O-N 3.4Å; L79-L83 HydrophobicContact CD1-CB 4.42Å; L79-L83 HydrophobicContact CD1-CD1 4.09Å; L79-L83 HydrophobicContact CD1-CD2 4.16Å; L79-L83 HydrophobicContact CD1-CG 4.46Å; L79-L83 HydrophobicContact CD2-CD1 4.39Å
80	T	60.2	Low	60	Low	139 Å²	139	139.1 Å²	139.1	85%	0.853	72%	0.716	S	S	*	*			trans	-73.9	-9.9	-171.4	-50.7	0	0	0	0	110.2	K78	K78-T80 PolarHBondContact O-N 3.13Å; K78-T80 PolarHBondContact O-OG1 3.02Å
81	A	63.5	Low	62.2	Low	66 Å²	66	135.7 Å²	135.7	55%	0.545	71%	0.711	S	S	.	*	S	Bend	trans	-103.7	135.9	168.5	0	0	0	0	0	108.9	L79 L83	L79-A81 PolarHBondContact O-N 3.4Å; A81-L83 PolarHBondContact O-N 2.82Å
82	P	55.8	Low	64.6	Low	104 Å²	104	135.9 Å²	135.9	68%	0.675	70%	0.704	S	S	*	*			trans	-51.6	116.4	168.3	-21.1	30.5	0	0	0	108.4	E84	P82-E84 HydrophobicContact CB-CB 4.4Å; P82-E84 HydrophobicContact CB-CG 4.03Å; P82-E84 PolarHBondContact O-N 2.7Å
83	L	58.9	Low	66.8	Low	125 Å²	125	130.5 Å²	130.5	65%	0.654	68%	0.679	S	S	*	*			trans	-74	40	169.5	-149.1	84.9	0	0	0	109.4	L79 A81 I85	L79-L83 HydrophobicContact CD1-CB 4.42Å; L79-L83 HydrophobicContact CD1-CD1 4.09Å; L79-L83 HydrophobicContact CD1-CD2 4.16Å; L79-L83 HydrophobicContact CD1-CG 4.46Å; L79-L83 HydrophobicContact CD2-CD1 4.39Å; A81-L83 PolarHBondContact O-N 2.82Å; L83-I85 PolarHBondContact O-N 2.69Å
84	E	59.5	Low	69.4	Low	156 Å²	156	133.9 Å²	133.9	73%	0.729	69%	0.689	S	S	*	*			trans	-73.1	85.6	172.5	-74.9	-178	175	0	0	106.4	P82 G86	P82-E84 HydrophobicContact CB-CB 4.4Å; P82-E84 HydrophobicContact CB-CG 4.03Å; P82-E84 PolarHBondContact O-N 2.7Å; E84-G86 PolarHBondContact O-N 2.78Å
85	I	63.6	Low	71.5	Confident	169 Å²	169	133 Å²	133	87%	0.867	68%	0.68	S	S	*	*			trans	-67.4	73.5	158.7	-57.1	168.8	0	0	0	105.3	L83	L83-I85 PolarHBondContact O-N 2.69Å
86	G	69.4	Low	73.8	Confident	57 Å²	57	131.3 Å²	131.3	59%	0.588	67%	0.67	S	S	*	*			trans	-146.9	146.6	-168.5	0	0	0	0	0	109.7	E84	E84-G86 PolarHBondContact O-N 2.78Å
87	M	77.7	Confident	75.9	Confident	159 Å²	159	130.1 Å²	130.1	78%	0.783	66%	0.657	S	S	*	*			trans	-87.8	120.6	-179.7	-149.9	171.5	-174.8	0	0	108.7	M89	M87-M89 HydrophobicContact CB-CE 4.26Å; M87-M89 PolarHBondContact O-N 2.98Å
88	R	82.5	Confident	77.6	Confident	238 Å²	238	130.5 Å²	130.5	90%	0.898	65%	0.649	S	S	*	*			trans	-66.7	126.9	174.2	-67.9	-170.7	178.5	-148.6	-0.9	109.3
89	M	84.6	Confident	79.4	Confident	81 Å²	81	124.5 Å²	124.5	40%	0.399	63%	0.634	S	S	.	*			trans	-141.1	147	-179.8	54.6	-179	72.6	0	0	111.4	M87 Q93 L94	M87-M89 HydrophobicContact CB-CE 4.26Å; M87-M89 PolarHBondContact O-N 2.98Å; M89-Q93 HydrophobicContact CB-CB 4.04Å; M89-L94 HydrophobicContact CG-CB 4.32Å; M89-L94 HydrophobicContact SD-CB 3.95Å; M89-L94 HydrophobicContact SD-CD1 3.6Å; M89-L94 VanDerWaalsContact SD-CD1 3.6Å; M89-L94 HydrophobicContact SD-CG 4.38Å
90	N	92.6	Very high	81.1	Confident	84 Å²	84	122.3 Å²	122.3	45%	0.449	63%	0.631	S	S	.	*			trans	-79.8	164.8	173.3	68.9	54.2	0	0	0	111.3	R92 Q93 L94	N90-R92 VanDerWaalsContact C-N 3.28Å; N90-R92 PolarHBondContact O-N 2.78Å; N90-R92 WeakPolarHBondContact OD1-CB 3.5Å; N90-R92 PolarHBondContact OD1-N 2.88Å; N90-R92 VanDerWaalsContact OD1-N 3.11Å; N90-Q93 PolarHBondContact ND2-OE1 2.68Å; N90-Q93 VanDerWaalsContact ND2-OE1 3.11Å; N90-Q93 WeakPolarHBondContact O-CB 3.33Å; N90-Q93 PolarHBondContact O-N 2.87Å; N90-Q93 WeakPolarHBondContact OD1-CG 3.27Å; N90-Q93 PolarHBondContact OD1-N 3.3Å; N90-L94 PolarHBondContact O-N 2.91Å
91	S	92.2	Very high	82.6	Confident	98 Å²	98	119.4 Å²	119.4	69%	0.685	61%	0.613	S	S	*	*	H	α-helix	trans	-55.5	-39.7	-176.9	53.2	0	0	0	0	113.4	L94 E95	S91-L94 PolarHBondContact O-N 3.22Å; S91-E95 WeakPolarHBondContact O-CB 3.33Å; S91-E95 PolarHBondContact O-N 2.97Å
92	R	93.3	Very high	84	Confident	187 Å²	187	120.7 Å²	120.7	71%	0.706	61%	0.608	S	S	*	*	H	α-helix	trans	-67.3	-36.3	177.2	-68.4	-177.3	-179.1	-90.4	4.2	112.6	N90 K96	N90-R92 VanDerWaalsContact C-N 3.28Å; N90-R92 PolarHBondContact O-N 2.78Å; N90-R92 WeakPolarHBondContact OD1-CB 3.5Å; N90-R92 PolarHBondContact OD1-N 2.88Å; N90-R92 VanDerWaalsContact OD1-N 3.11Å; R92-K96 VanDerWaalsContact O-CG 3.31Å; R92-K96 WeakPolarHBondContact O-CG 3.48Å; R92-K96 PolarHBondContact O-N 3.12Å
93	Q	93.9	Very high	85.7	Confident	90 Å²	90	117.1 Å²	117.1	42%	0.421	59%	0.591	S	S	.	*	H	α-helix	trans	-68.9	-43	175.9	-73.9	172.4	-43.6	0	0	110.8	M89 N90 E95 K96 Y97	M89-Q93 HydrophobicContact CB-CB 4.04Å; N90-Q93 PolarHBondContact ND2-OE1 2.68Å; N90-Q93 VanDerWaalsContact ND2-OE1 3.11Å; N90-Q93 WeakPolarHBondContact O-CB 3.33Å; N90-Q93 PolarHBondContact O-N 2.87Å; N90-Q93 WeakPolarHBondContact OD1-CG 3.27Å; N90-Q93 PolarHBondContact OD1-N 3.3Å; Q93-E95 VanDerWaalsContact C-N 3.33Å; Q93-E95 PolarHBondContact O-N 2.9Å; Q93-K96 PolarHBondContact O-N 3.05Å; Q93-Y97 WeakPolarHBondContact O-CD2 3.37Å; Q93-Y97 PolarHBondContact O-N 3.3Å
94	L	92.9	Very high	87.4	Confident	102 Å²	102	116.3 Å²	116.3	53%	0.534	59%	0.586	S	S	.	*	H	α-helix	trans	-60.8	-43.4	177.1	-178.6	63.1	0	0	0	111.6	M89 N90 S91 K96 Y97 R98	M89-L94 HydrophobicContact CG-CB 4.32Å; M89-L94 HydrophobicContact SD-CB 3.95Å; M89-L94 HydrophobicContact SD-CD1 3.6Å; M89-L94 VanDerWaalsContact SD-CD1 3.6Å; M89-L94 HydrophobicContact SD-CG 4.38Å; N90-L94 PolarHBondContact O-N 2.91Å; S91-L94 PolarHBondContact O-N 3.22Å; L94-K96 PolarHBondContact O-N 2.93Å; L94-Y97 PolarHBondContact O-N 3.35Å; L94-R98 WeakPolarHBondContact O-CB 3.29Å; L94-R98 PolarHBondContact O-N 3.34Å
95	E	93.6	Very high	88.8	Confident	136 Å²	136	113.3 Å²	113.3	64%	0.636	58%	0.575	S	S	*	*	H	α-helix	trans	-62.7	-41.2	177.9	-169.9	174.3	-161.7	0	0	112.3	S91 Q93 R98 A99	S91-E95 WeakPolarHBondContact O-CB 3.33Å; S91-E95 PolarHBondContact O-N 2.97Å; Q93-E95 VanDerWaalsContact C-N 3.33Å; Q93-E95 PolarHBondContact O-N 2.9Å; E95-R98 WeakPolarHBondContact O-CB 3.3Å; E95-R98 PolarHBondContact O-N 2.79Å; E95-A99 PolarHBondContact O-N 3.4Å
96	K	95.1	Very high	89.9	Confident	156 Å²	156	109 Å²	109	68%	0.678	56%	0.56	S	S	*	*	H	α-helix	trans	-62.9	-44.8	174.6	-73.5	174.9	-179.3	-172	0	112.4	R92 Q93 L94 R98 A99 A100	R92-K96 VanDerWaalsContact O-CG 3.31Å; R92-K96 WeakPolarHBondContact O-CG 3.48Å; R92-K96 PolarHBondContact O-N 3.12Å; Q93-K96 PolarHBondContact O-N 3.05Å; L94-K96 PolarHBondContact O-N 2.93Å; K96-R98 VanDerWaalsContact C-N 3.33Å; K96-A99 PolarHBondContact O-N 3.07Å; K96-A100 WeakPolarHBondContact O-CB 3.39Å; K96-A100 PolarHBondContact O-N 3.41Å
97	Y	90.9	Very high	90.7	Very high	142 Å²	142	114.3 Å²	114.3	56%	0.557	57%	0.569	S	S	*	*	H	α-helix	trans	-64	-41	177	-93.5	-76.7	0	0	0	111.5	Q93 L94 A99 A100 V101	Q93-Y97 WeakPolarHBondContact O-CD2 3.37Å; Q93-Y97 PolarHBondContact O-N 3.3Å; L94-Y97 PolarHBondContact O-N 3.35Å; Y97-A99 PolarHBondContact O-N 3.26Å; Y97-A100 PolarHBondContact O-N 2.99Å; Y97-V101 WeakPolarHBondContact O-CB 3.26Å; Y97-V101 VanDerWaalsContact O-CG2 3.25Å; Y97-V101 WeakPolarHBondContact O-CG2 3.49Å; Y97-V101 PolarHBondContact O-N 3.17Å
98	R	93.4	Very high	90.8	Very high	157 Å²	157	113.7 Å²	113.7	59%	0.592	57%	0.566	S	S	*	*	H	α-helix	trans	-56.6	-49.6	174.7	-170.4	179.2	-165.2	-72.2	-14.4	111.4	L94 E95 K96 A100 V101 E102	L94-R98 WeakPolarHBondContact O-CB 3.29Å; L94-R98 PolarHBondContact O-N 3.34Å; E95-R98 WeakPolarHBondContact O-CB 3.3Å; E95-R98 PolarHBondContact O-N 2.79Å; K96-R98 VanDerWaalsContact C-N 3.33Å; R98-A100 PolarHBondContact O-N 2.95Å; R98-V101 PolarHBondContact O-N 3.13Å; R98-E102 IonicContact CZ-OE1 3.29Å; R98-E102 VanDerWaalsContact NH1-CD 3.31Å; R98-E102 IonicContact NH1-OE1 3.91Å; R98-E102 PolarHBondContact NH1-OE1 2.98Å; R98-E102 IonicContact NH1-OE2 3.17Å; R98-E102 PolarHBondContact NH1-OE2 3.45Å; R98-E102 IonicContact NH2-OE1 2.64Å; R98-E102 PolarHBondContact NH2-OE1 3.37Å; R98-E102 WeakPolarHBondContact O-CG 3.45Å; R98-E102 PolarHBondContact O-N 3.33Å
99	A	94.1	Very high	90.6	Very high	58 Å²	58	108.1 Å²	108.1	48%	0.479	55%	0.553	S	S	.	*	H	α-helix	trans	-62.9	-41.4	178.5	0	0	0	0	0	112.7	E95 K96 Y97 E102 G103	E95-A99 PolarHBondContact O-N 3.4Å; K96-A99 PolarHBondContact O-N 3.07Å; Y97-A99 PolarHBondContact O-N 3.26Å; A99-E102 PolarHBondContact O-N 3.24Å; A99-G103 PolarHBondContact O-N 3.07Å
100	A	94.3	Very high	89.5	Confident	64 Å²	64	109 Å²	109	53%	0.529	57%	0.566	S	S	.	*	H	α-helix	trans	-64.2	-41.7	177.4	0	0	0	0	0	112.1	K96 Y97 R98 G103 L104	K96-A100 WeakPolarHBondContact O-CB 3.39Å; K96-A100 PolarHBondContact O-N 3.41Å; Y97-A100 PolarHBondContact O-N 2.99Å; R98-A100 PolarHBondContact O-N 2.95Å; A100-G103 PolarHBondContact O-N 3.33Å; A100-L104 WeakPolarHBondContact O-CB 3.22Å; A100-L104 PolarHBondContact O-N 3.12Å
101	V	91.6	Very high	88.1	Confident	78 Å²	78	113.9 Å²	113.9	47%	0.473	59%	0.585	S	S	.	*	H	α-helix	trans	-66.4	-43.5	176.8	171.2	0	0	0	0	110.9	Y97 R98 G103 L104 L105	Y97-V101 WeakPolarHBondContact O-CB 3.26Å; Y97-V101 VanDerWaalsContact O-CG2 3.25Å; Y97-V101 WeakPolarHBondContact O-CG2 3.49Å; Y97-V101 PolarHBondContact O-N 3.17Å; R98-V101 PolarHBondContact O-N 3.13Å; V101-G103 PolarHBondContact O-N 2.8Å; V101-L104 PolarHBondContact O-N 3.1Å; V101-L105 HydrophobicContact CG1-CD1 3.86Å; V101-L105 HydrophobicContact CG1-CG 4.31Å; V101-L105 WeakPolarHBondContact O-CB 3.39Å; V101-L105 VanDerWaalsContact O-CG 3.28Å; V101-L105 WeakPolarHBondContact O-CG 3.42Å; V101-L105 PolarHBondContact O-N 3.38Å
102	E	93.7	Very high	86.2	Confident	93 Å²	93	118 Å²	118	44%	0.435	59%	0.593	S	S	.	*	H	α-helix	trans	-61.4	-42.5	176.2	-75.7	178.8	157.6	0	0	112.1	R98 A99 L105 S106	R98-E102 IonicContact CZ-OE1 3.29Å; R98-E102 VanDerWaalsContact NH1-CD 3.31Å; R98-E102 IonicContact NH1-OE1 3.91Å; R98-E102 PolarHBondContact NH1-OE1 2.98Å; R98-E102 IonicContact NH1-OE2 3.17Å; R98-E102 PolarHBondContact NH1-OE2 3.45Å; R98-E102 IonicContact NH2-OE1 2.64Å; R98-E102 PolarHBondContact NH2-OE1 3.37Å; R98-E102 WeakPolarHBondContact O-CG 3.45Å; R98-E102 PolarHBondContact O-N 3.33Å; A99-E102 PolarHBondContact O-N 3.24Å; E102-L105 PolarHBondContact O-N 2.92Å; E102-S106 WeakPolarHBondContact O-CB 3.49Å; E102-S106 PolarHBondContact O-N 3.37Å; E102-S106 PolarHBondContact O-OG 3.37Å
103	G	92.3	Very high	84	Confident	30 Å²	30	112.8 Å²	112.8	31%	0.309	59%	0.591	S	S	.	*	H	α-helix	trans	-58.3	-50.4	173.8	0	0	0	0	0	111.8	A99 A100 V101 L105 S106 E107	A99-G103 PolarHBondContact O-N 3.07Å; A100-G103 PolarHBondContact O-N 3.33Å; V101-G103 PolarHBondContact O-N 2.8Å; G103-L105 VanDerWaalsContact C-N 3.33Å; G103-L105 PolarHBondContact O-N 3.46Å; G103-S106 PolarHBondContact O-N 2.89Å; G103-S106 VanDerWaalsContact O-N 3.16Å; G103-S106 PolarHBondContact O-OG 3.37Å; G103-E107 PolarHBondContact O-N 3.14Å; G103-E107 VanDerWaalsContact O-N 3.08Å
104	L	93.4	Very high	81.9	Confident	107 Å²	107	113.3 Å²	113.3	56%	0.56	61%	0.61	S	S	*	*	H	α-helix	trans	-61.5	-40.7	180	-159.4	105.5	0	0	0	112.5	A100 V101 S106 E107 M108	A100-L104 WeakPolarHBondContact O-CB 3.22Å; A100-L104 PolarHBondContact O-N 3.12Å; V101-L104 PolarHBondContact O-N 3.1Å; L104-S106 VanDerWaalsContact C-N 3.35Å; L104-E107 PolarHBondContact O-N 3.27Å; L104-M108 WeakPolarHBondContact O-CB 3.4Å; L104-M108 WeakPolarHBondContact O-CG 3.43Å; L104-M108 PolarHBondContact O-N 3.44Å
105	L	89.4	Confident	79.3	Confident	94 Å²	94	121.8 Å²	121.8	49%	0.492	64%	0.643	S	S	.	*	H	α-helix	trans	-67.1	-36.9	177.2	-72	173.2	0	0	0	112	V101 E102 G103 E107 M108 L109	V101-L105 HydrophobicContact CG1-CD1 3.86Å; V101-L105 HydrophobicContact CG1-CG 4.31Å; V101-L105 WeakPolarHBondContact O-CB 3.39Å; V101-L105 VanDerWaalsContact O-CG 3.28Å; V101-L105 WeakPolarHBondContact O-CG 3.42Å; V101-L105 PolarHBondContact O-N 3.38Å; E102-L105 PolarHBondContact O-N 2.92Å; G103-L105 VanDerWaalsContact C-N 3.33Å; G103-L105 PolarHBondContact O-N 3.46Å; L105-E107 VanDerWaalsContact C-N 3.33Å; L105-M108 PolarHBondContact O-N 3.34Å; L105-L109 WeakPolarHBondContact O-CB 3.34Å; L105-L109 WeakPolarHBondContact O-CG 3.44Å; L105-L109 PolarHBondContact O-N 3.43Å
106	S	87.2	Confident	78.6	Confident	79 Å²	79	121.1 Å²	121.1	55%	0.552	64%	0.643	S	S	*	*	H	α-helix	trans	-67.7	-32.7	177.4	75.7	0	0	0	0	113	E102 G103 L104	E102-S106 WeakPolarHBondContact O-CB 3.49Å; E102-S106 PolarHBondContact O-N 3.37Å; E102-S106 PolarHBondContact O-OG 3.37Å; G103-S106 PolarHBondContact O-N 2.89Å; G103-S106 VanDerWaalsContact O-N 3.16Å; G103-S106 PolarHBondContact O-OG 3.37Å; L104-S106 VanDerWaalsContact C-N 3.35Å
107	E	86.3	Confident	77.7	Confident	167 Å²	167	119.2 Å²	119.2	78%	0.78	64%	0.641	S	S	*	*	H	α-helix	trans	-75.7	-33.5	174.6	-70.6	-179.4	178.3	0	0	112.2	G103 L104 L105	G103-E107 PolarHBondContact O-N 3.14Å; G103-E107 VanDerWaalsContact O-N 3.08Å; L104-E107 PolarHBondContact O-N 3.27Å; L105-E107 VanDerWaalsContact C-N 3.33Å
108	M	79	Confident	77	Confident	146 Å²	146	117.9 Å²	117.9	72%	0.719	65%	0.646	S	S	*	*	H	α-helix	trans	-81.9	-26.1	-177.4	-72.6	-94.5	-74.6	0	0	113.6	L104 L105 P110	L104-M108 WeakPolarHBondContact O-CB 3.4Å; L104-M108 WeakPolarHBondContact O-CG 3.43Å; L104-M108 PolarHBondContact O-N 3.44Å; L105-M108 PolarHBondContact O-N 3.34Å; M108-P110 VanDerWaalsContact O-CD 3.24Å; M108-P110 WeakPolarHBondContact O-CD 3.39Å
109	L	77.8	Confident	76	Confident	121 Å²	121	115.6 Å²	115.6	63%	0.634	65%	0.649	S	S	*	*	S	Bend	trans	-84.2	110	175.2	-77.5	164.4	0	0	0	109.2	L105 Q111	L105-L109 WeakPolarHBondContact O-CB 3.34Å; L105-L109 WeakPolarHBondContact O-CG 3.44Å; L105-L109 PolarHBondContact O-N 3.43Å; L109-Q111 PolarHBondContact O-N 3.34Å; L109-Q111 VanDerWaalsContact O-N 3.13Å
110	P	63.2	Low	74.9	Confident	101 Å²	101	119.3 Å²	119.3	66%	0.656	66%	0.66	S	S	*	*			trans	-59.4	124.8	169.9	23.8	-30.3	0	0	0	107.8	M108 H112	M108-P110 VanDerWaalsContact O-CD 3.24Å; M108-P110 WeakPolarHBondContact O-CD 3.39Å; P110-H112 PolarHBondContact O-N 3.32Å
111	Q	63.3	Low	73.6	Confident	185 Å²	185	122.9 Å²	122.9	86%	0.864	67%	0.668	S	S	*	*			trans	-60.5	86	167.6	-68.9	-176.1	-4.1	0	0	108.2	L109 A113	L109-Q111 PolarHBondContact O-N 3.34Å; L109-Q111 VanDerWaalsContact O-N 3.13Å; Q111-A113 PolarHBondContact O-N 3.39Å
112	H	51.9	Low	72.3	Confident	184 Å²	184	126.1 Å²	126.1	85%	0.852	68%	0.682	S	S	*	*			trans	-73.7	71.4	154.8	-101.7	-67.5	0	0	0	106.7	P110 A114	P110-H112 PolarHBondContact O-N 3.32Å; H112-A114 PolarHBondContact O-N 3.43Å; H112-A114 VanDerWaalsContact O-N 3.17Å
113	A	47.2	Very low	70.7	Confident	79 Å²	79	128.7 Å²	128.7	65%	0.653	70%	0.701	S	S	*	*			trans	-64.9	110.2	157.5	0	0	0	0	0	105.9	Q111 K115	Q111-A113 PolarHBondContact O-N 3.39Å; A113-K115 PolarHBondContact O-N 3.46Å
114	A	49.9	Very low	68.9	Low	100 Å²	100	136.9 Å²	136.9	83%	0.826	73%	0.734	S	S	*	*			trans	-51.1	120.2	162	0	0	0	0	0	108.9	H112	H112-A114 PolarHBondContact O-N 3.43Å; H112-A114 VanDerWaalsContact O-N 3.17Å
115	K	38.4	Very low	66.7	Low	280 Å²	280	139.6 Å²	139.6	100%	1.217	75%	0.75	S	S	*	*			trans	-153.5	0	151.5	-122.2	179.2	-176.6	179.3	0	108.9	A113	A113-K115 PolarHBondContact O-N 3.46Å

Retrieved 115 of 115 residues in 72.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).