A0A096NI63_PAPAN Loading...

Nuclear envelope phosphatase-regulatory subunit 1

AlphaFold DB (Q5R7J7), UniProt , Accession A0A096NI63, Species PAPAN (Papio anubis, Olive baboon), Gene CNEP1R1, Length 125 aa.

						>A0A096NI63_PAPAN|A0A096NI63|CNEP1R1
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.9	Low	87.2	Confident	153 Å²	153	108.3 Å²	108.3	75%	0.754	57%	0.565	S	S	*	*				0	117.6	0	-111.3	153	98	0	0	108	E5 Q6 D9	M1-E5 WeakPolarHBondContact CA-OE2 3.49Å; M1-E5 HydrophobicContact CG-CB 4.15Å; M1-Q6 HydrophobicContact CB-CG 4.27Å; M1-Q6 HydrophobicContact CE-CG 3.91Å; M1-D9 VanDerWaalsContact CE-OD2 3.24Å; M1-D9 WeakPolarHBondContact CE-OD2 3.27Å
2	N	84	Confident	87.8	Confident	116 Å²	116	104 Å²	104	62%	0.62	56%	0.557	S	S	*	*			trans	-67	152.3	171.3	-80.7	-20	0	0	0	109.3	L4 E5 Q6	N2-L4 PolarHBondContact O-N 2.8Å; N2-L4 VanDerWaalsContact O-N 3.11Å; N2-E5 HydrophobicContact CB-CG 4.38Å; N2-E5 PolarHBondContact N-OE2 3.43Å; N2-E5 PolarHBondContact O-N 3.46Å; N2-Q6 PolarHBondContact O-N 3.15Å
3	S	85.9	Confident	88.2	Confident	93 Å²	93	102.8 Å²	102.8	65%	0.65	55%	0.545	S	S	*	.	H	α-helix	trans	-55.3	-29	176	51.6	0	0	0	0	112.9	A7	S3-A7 PolarHBondContact O-N 3.11Å; S3-A7 VanDerWaalsContact O-N 3.12Å
4	L	88.9	Confident	88.7	Confident	126 Å²	126	99.6 Å²	99.6	66%	0.66	53%	0.525	S	S	*	.	H	α-helix	trans	-65.4	-47.9	174.2	-66.4	175.3	0	0	0	112.3	N2 Q6 A7 E8	N2-L4 PolarHBondContact O-N 2.8Å; N2-L4 VanDerWaalsContact O-N 3.11Å; L4-Q6 VanDerWaalsContact C-N 3.28Å; L4-Q6 PolarHBondContact O-N 3.45Å; L4-A7 PolarHBondContact O-N 3.32Å; L4-A7 VanDerWaalsContact O-N 3.12Å; L4-E8 WeakPolarHBondContact O-CG 3.44Å; L4-E8 PolarHBondContact O-N 2.83Å
5	E	91.5	Very high	89.2	Confident	93 Å²	93	104.4 Å²	104.4	44%	0.435	53%	0.533	S	S	.	.	H	α-helix	trans	-60.3	-41.6	178.5	-63.3	174	136.2	0	0	110.5	M1 N2 A7 E8 D9	M1-E5 WeakPolarHBondContact CA-OE2 3.49Å; M1-E5 HydrophobicContact CG-CB 4.15Å; N2-E5 HydrophobicContact CB-CG 4.38Å; N2-E5 PolarHBondContact N-OE2 3.43Å; N2-E5 PolarHBondContact O-N 3.46Å; E5-A7 PolarHBondContact O-N 3.03Å; E5-E8 PolarHBondContact O-N 3.34Å; E5-D9 WeakPolarHBondContact O-CB 3.14Å; E5-D9 PolarHBondContact O-N 3.43Å
6	Q	88.6	Confident	89.5	Confident	104 Å²	104	108.3 Å²	108.3	49%	0.486	54%	0.539	S	S	.	.	H	α-helix	trans	-61.8	-41	175.6	-70.4	-179.5	-34.2	0	0	112.8	M1 N2 L4 L10	M1-Q6 HydrophobicContact CB-CG 4.27Å; M1-Q6 HydrophobicContact CE-CG 3.91Å; N2-Q6 PolarHBondContact O-N 3.15Å; L4-Q6 VanDerWaalsContact C-N 3.28Å; L4-Q6 PolarHBondContact O-N 3.45Å; Q6-L10 VanDerWaalsContact O-CG 3.29Å; Q6-L10 WeakPolarHBondContact O-CG 3.46Å; Q6-L10 PolarHBondContact O-N 3.37Å
7	A	89.9	Confident	89.8	Confident	56 Å²	56	102.7 Å²	102.7	46%	0.463	51%	0.511	S	S	.	.	H	α-helix	trans	-68.6	-38.5	178.4	0	0	0	0	0	111.9	S3 L4 E5 K11	S3-A7 PolarHBondContact O-N 3.11Å; S3-A7 VanDerWaalsContact O-N 3.12Å; L4-A7 PolarHBondContact O-N 3.32Å; L4-A7 VanDerWaalsContact O-N 3.12Å; E5-A7 PolarHBondContact O-N 3.03Å; A7-K11 WeakPolarHBondContact O-CB 3.47Å; A7-K11 PolarHBondContact O-N 3.08Å
8	E	93.8	Very high	90	Very high	135 Å²	135	99.7 Å²	99.7	63%	0.631	50%	0.499	S	S	*	.	H	α-helix	trans	-64.4	-43.7	174.8	-71.8	-179.8	167.5	0	0	111.6	L4 E5 K11 A12	L4-E8 WeakPolarHBondContact O-CG 3.44Å; L4-E8 PolarHBondContact O-N 2.83Å; E5-E8 PolarHBondContact O-N 3.34Å; E8-K11 PolarHBondContact O-N 3.15Å; E8-A12 WeakPolarHBondContact O-CB 3.4Å; E8-A12 PolarHBondContact O-N 3.32Å
9	D	93.6	Very high	90.2	Very high	93 Å²	93	98.1 Å²	98.1	50%	0.497	49%	0.49	S	S	.	.	H	α-helix	trans	-62.4	-44.5	176.2	-78.6	-14.7	0	0	0	112.2	M1 E5 K11 A12 F13	M1-D9 VanDerWaalsContact CE-OD2 3.24Å; M1-D9 WeakPolarHBondContact CE-OD2 3.27Å; E5-D9 WeakPolarHBondContact O-CB 3.14Å; E5-D9 PolarHBondContact O-N 3.43Å; D9-K11 VanDerWaalsContact C-N 3.32Å; D9-K11 PolarHBondContact O-N 2.94Å; D9-A12 PolarHBondContact O-N 3.15Å; D9-F13 WeakPolarHBondContact O-CB 3.35Å; D9-F13 PolarHBondContact O-N 3.33Å
10	L	91.9	Very high	90.3	Very high	65 Å²	65	99.6 Å²	99.6	34%	0.34	49%	0.491	S	S	.	.	H	α-helix	trans	-62.2	-40.8	176.2	-73.9	168.7	0	0	0	111.7	Q6 F13 E14 M108 L116	Q6-L10 VanDerWaalsContact O-CG 3.29Å; Q6-L10 WeakPolarHBondContact O-CG 3.46Å; Q6-L10 PolarHBondContact O-N 3.37Å; L10-F13 PolarHBondContact O-N 2.78Å; L10-E14 WeakPolarHBondContact O-CB 3.44Å; L10-E14 PolarHBondContact O-N 3.04Å; L10-M108 HydrophobicContact CD2-CE 3.81Å; L10-M108 HydrophobicContact CD2-SD 3.93Å; L10-L116 HydrophobicContact CB-CD2 4.43Å; L10-L116 HydrophobicContact CD2-CD2 3.93Å
11	K	93.1	Very high	90.4	Very high	157 Å²	157	94.9 Å²	94.9	68%	0.683	47%	0.468	S	S	*	.	H	α-helix	trans	-66.9	-39.4	176.4	-172.8	177.6	-177.2	178.3	0	111.7	A7 E8 D9 R15	A7-K11 WeakPolarHBondContact O-CB 3.47Å; A7-K11 PolarHBondContact O-N 3.08Å; E8-K11 PolarHBondContact O-N 3.15Å; D9-K11 VanDerWaalsContact C-N 3.32Å; D9-K11 PolarHBondContact O-N 2.94Å; K11-R15 WeakPolarHBondContact O-CB 3.35Å; K11-R15 PolarHBondContact O-N 3.17Å
12	A	94.6	Very high	91.9	Very high	57 Å²	57	93.9 Å²	93.9	47%	0.471	46%	0.461	S	S	.	.	H	α-helix	trans	-64.1	-42.9	174.5	0	0	0	0	0	111.1	E8 D9 R15 R16	E8-A12 WeakPolarHBondContact O-CB 3.4Å; E8-A12 PolarHBondContact O-N 3.32Å; D9-A12 PolarHBondContact O-N 3.15Å; A12-R15 PolarHBondContact O-N 3.21Å; A12-R16 WeakPolarHBondContact O-CB 3.28Å; A12-R16 PolarHBondContact O-N 3.21Å
13	F	93.3	Very high	92.3	Very high	89 Å²	89	92.8 Å²	92.8	39%	0.39	46%	0.461	S	S	.	.	H	α-helix	trans	-61.6	-49.9	174.4	175	-97.8	0	0	0	112.2	D9 L10 R15 R16 L17 L103 L116	D9-F13 WeakPolarHBondContact O-CB 3.35Å; D9-F13 PolarHBondContact O-N 3.33Å; L10-F13 PolarHBondContact O-N 2.78Å; F13-R15 VanDerWaalsContact C-N 3.3Å; F13-R15 PolarHBondContact O-N 3.32Å; F13-R16 PolarHBondContact O-N 3.39Å; F13-R16 VanDerWaalsContact O-N 3.12Å; F13-L17 HydrophobicContact CE1-CD2 4.05Å; F13-L17 HydrophobicContact CZ-CD2 4.26Å; F13-L17 WeakPolarHBondContact O-CB 3.2Å; F13-L17 PolarHBondContact O-N 2.92Å; F13-L103 HydrophobicContact CE1-CD1 4.42Å; F13-L103 HydrophobicContact CE1-CD2 4.21Å; F13-L116 HydrophobicContact CE1-CD1 4.38Å
14	E	94.8	Very high	92.5	Very high	57 Å²	57	90.5 Å²	90.5	27%	0.266	44%	0.442	S	S	.	.	H	α-helix	trans	-56.2	-46.1	176.8	-178.9	-175.8	158.1	0	0	111	L10 R16 L17 T18 K115 L116	L10-E14 WeakPolarHBondContact O-CB 3.44Å; L10-E14 PolarHBondContact O-N 3.04Å; E14-R16 PolarHBondContact O-N 2.68Å; E14-L17 PolarHBondContact O-N 3.41Å; E14-T18 VanDerWaalsContact O-CB 3.31Å; E14-T18 WeakPolarHBondContact O-CB 3.45Å; E14-T18 PolarHBondContact O-N 2.87Å; E14-T18 PolarHBondContact O-OG1 3.45Å; E14-K115 WeakPolarHBondContact OE1-CG 3.28Å; E14-L116 HydrophobicContact CB-CB 4.38Å; E14-L116 HydrophobicContact CG-CB 4.24Å
15	R	95.8	Very high	92.4	Very high	172 Å²	172	89.3 Å²	89.3	65%	0.649	43%	0.433	S	S	*	.	H	α-helix	trans	-59	-47.7	175.9	178	179.9	174.2	167.8	3.3	111	K11 A12 F13 L17 T18 E19	K11-R15 WeakPolarHBondContact O-CB 3.35Å; K11-R15 PolarHBondContact O-N 3.17Å; A12-R15 PolarHBondContact O-N 3.21Å; F13-R15 VanDerWaalsContact C-N 3.3Å; F13-R15 PolarHBondContact O-N 3.32Å; R15-L17 PolarHBondContact O-N 3.48Å; R15-T18 PolarHBondContact O-N 3.24Å; R15-E19 HydrophobicContact CG-CG 4.46Å; R15-E19 WeakPolarHBondContact CG-OE1 3.34Å; R15-E19 IonicContact CZ-OE1 3.73Å; R15-E19 IonicContact NE-OE1 2.9Å; R15-E19 PolarHBondContact NE-OE1 3.19Å; R15-E19 IonicContact NH2-OE1 3.67Å; R15-E19 WeakPolarHBondContact O-CB 3.38Å; R15-E19 VanDerWaalsContact O-CG 3.32Å; R15-E19 WeakPolarHBondContact O-CG 3.47Å; R15-E19 PolarHBondContact O-N 2.67Å
16	R	95.1	Very high	92.2	Very high	167 Å²	167	88 Å²	88	63%	0.63	43%	0.432	S	S	*	.	H	α-helix	trans	-65.6	-40	-178	-121.6	-55.9	-171.7	-139.3	12.5	112.3	A12 F13 E14 E19 Y20	A12-R16 WeakPolarHBondContact O-CB 3.28Å; A12-R16 PolarHBondContact O-N 3.21Å; F13-R16 PolarHBondContact O-N 3.39Å; F13-R16 VanDerWaalsContact O-N 3.12Å; E14-R16 PolarHBondContact O-N 2.68Å; R16-E19 IonicContact CZ-OE2 3.95Å; R16-E19 IonicContact NH1-OE2 3.02Å; R16-E19 PolarHBondContact NH1-OE2 3.21Å; R16-Y20 WeakPolarHBondContact O-CB 3.29Å; R16-Y20 PolarHBondContact O-N 3.32Å
17	L	93.3	Very high	92.3	Very high	13 Å²	13	85 Å²	85	7%	0.068	43%	0.426	C	S	.	.	H	α-helix	trans	-64.6	-45.7	176.4	-178.4	58.8	0	0	0	111.1	F13 E14 R15 Y20 I21 I95 C99 C110	F13-L17 HydrophobicContact CE1-CD2 4.05Å; F13-L17 HydrophobicContact CZ-CD2 4.26Å; F13-L17 WeakPolarHBondContact O-CB 3.2Å; F13-L17 PolarHBondContact O-N 2.92Å; E14-L17 PolarHBondContact O-N 3.41Å; R15-L17 PolarHBondContact O-N 3.48Å; L17-Y20 PolarHBondContact O-N 2.71Å; L17-I21 HydrophobicContact CD1-CD1 3.89Å; L17-I21 HydrophobicContact CD1-CG1 4.32Å; L17-I21 HydrophobicContact CG-CD1 4.01Å; L17-I21 WeakPolarHBondContact O-CG1 3.4Å; L17-I21 PolarHBondContact O-N 2.85Å; L17-I95 HydrophobicContact CD1-CG2 4.49Å; L17-C99 HydrophobicContact CD2-CB 4.37Å; L17-C110 HydrophobicContact CD2-CB 4.07Å
18	T	94.2	Very high	92.3	Very high	48 Å²	48	82.8 Å²	82.8	29%	0.294	41%	0.406	S	S	.	.	H	α-helix	trans	-61.8	-46.5	177.2	-56.6	0	0	0	0	111.4	E14 R15 Y20 I21 H22 T113	E14-T18 VanDerWaalsContact O-CB 3.31Å; E14-T18 WeakPolarHBondContact O-CB 3.45Å; E14-T18 PolarHBondContact O-N 2.87Å; E14-T18 PolarHBondContact O-OG1 3.45Å; R15-T18 PolarHBondContact O-N 3.24Å; T18-Y20 VanDerWaalsContact C-N 3.31Å; T18-Y20 PolarHBondContact O-N 3.16Å; T18-I21 PolarHBondContact O-N 3.2Å; T18-H22 WeakPolarHBondContact O-CB 3.32Å; T18-H22 PolarHBondContact O-N 3.26Å; T18-T113 WeakPolarHBondContact CA-O 3.29Å
19	E	94.5	Very high	92.2	Very high	69 Å²	69	77.8 Å²	77.8	32%	0.322	39%	0.391	S	S	.	.	H	α-helix	trans	-57.2	-45.5	175.2	-75.6	172.1	-172.5	0	0	111.4	R15 R16 H22 C23	R15-E19 HydrophobicContact CG-CG 4.46Å; R15-E19 WeakPolarHBondContact CG-OE1 3.34Å; R15-E19 IonicContact CZ-OE1 3.73Å; R15-E19 IonicContact NE-OE1 2.9Å; R15-E19 PolarHBondContact NE-OE1 3.19Å; R15-E19 IonicContact NH2-OE1 3.67Å; R15-E19 WeakPolarHBondContact O-CB 3.38Å; R15-E19 VanDerWaalsContact O-CG 3.32Å; R15-E19 WeakPolarHBondContact O-CG 3.47Å; R15-E19 PolarHBondContact O-N 2.67Å; R16-E19 IonicContact CZ-OE2 3.95Å; R16-E19 IonicContact NH1-OE2 3.02Å; R16-E19 PolarHBondContact NH1-OE2 3.21Å; E19-H22 PolarHBondContact O-N 3.39Å; E19-C23 PolarHBondContact O-N 3.05Å; E19-C23 PolarHBondContact O-SG 3.48Å
20	Y	92.2	Very high	92.1	Very high	128 Å²	128	81.8 Å²	81.8	50%	0.502	40%	0.399	S	S	.	.	H	α-helix	trans	-65.1	-46.2	-178.9	-169.9	-111.8	0	0	0	112.4	R16 L17 T18 C23 L24 I95	R16-Y20 WeakPolarHBondContact O-CB 3.29Å; R16-Y20 PolarHBondContact O-N 3.32Å; L17-Y20 PolarHBondContact O-N 2.71Å; T18-Y20 VanDerWaalsContact C-N 3.31Å; T18-Y20 PolarHBondContact O-N 3.16Å; Y20-C23 PolarHBondContact O-N 2.94Å; Y20-L24 HydrophobicContact CD1-CD1 4.03Å; Y20-L24 HydrophobicContact CE1-CD1 3.73Å; Y20-L24 WeakPolarHBondContact O-CG 3.46Å; Y20-L24 PolarHBondContact O-N 3.26Å; Y20-I95 HydrophobicContact CD1-CD1 4.25Å; Y20-I95 HydrophobicContact CD1-CG2 4.29Å; Y20-I95 HydrophobicContact CE1-CD1 3.48Å; Y20-I95 VanDerWaalsContact CE1-CD1 3.48Å; Y20-I95 HydrophobicContact CE1-CG1 4.29Å; Y20-I95 HydrophobicContact CE1-CG2 4.27Å
21	I	91.1	Very high	92.2	Very high	2 Å²	2	82 Å²	82	1%	0.01	40%	0.395	C	S	.	.	H	α-helix	trans	-64.7	-43.4	176.6	-71.9	173.4	0	0	0	110.6	L17 T18 C23 L24 Q25 D112	L17-I21 HydrophobicContact CD1-CD1 3.89Å; L17-I21 HydrophobicContact CD1-CG1 4.32Å; L17-I21 HydrophobicContact CG-CD1 4.01Å; L17-I21 WeakPolarHBondContact O-CG1 3.4Å; L17-I21 PolarHBondContact O-N 2.85Å; T18-I21 PolarHBondContact O-N 3.2Å; I21-C23 VanDerWaalsContact C-N 3.28Å; I21-C23 PolarHBondContact O-N 2.85Å; I21-L24 PolarHBondContact O-N 3.5Å; I21-Q25 WeakPolarHBondContact O-CB 3.47Å; I21-Q25 PolarHBondContact O-N 2.87Å; I21-D112 VanDerWaalsContact CG2-O 3.29Å; I21-D112 WeakPolarHBondContact CG2-O 3.27Å
22	H	90.9	Very high	92.3	Very high	131 Å²	131	80.2 Å²	80.2	61%	0.606	38%	0.384	S	S	*	.	H	α-helix	trans	-62.3	-34	178.8	-174.1	-89.5	0	0	0	112.2	T18 E19 L24 P26	T18-H22 WeakPolarHBondContact O-CB 3.32Å; T18-H22 PolarHBondContact O-N 3.26Å; E19-H22 PolarHBondContact O-N 3.39Å; H22-L24 VanDerWaalsContact C-N 3.34Å; H22-P26 WeakPolarHBondContact O-CD 3.39Å
23	C	91.2	Very high	92.3	Very high	94 Å²	94	83.1 Å²	83.1	64%	0.635	39%	0.389	S	S	*	.	H	α-helix	trans	-67.4	-33.1	172.3	-73.1	0	0	0	0	112.9	E19 Y20 I21	E19-C23 PolarHBondContact O-N 3.05Å; E19-C23 PolarHBondContact O-SG 3.48Å; Y20-C23 PolarHBondContact O-N 2.94Å; I21-C23 VanDerWaalsContact C-N 3.28Å; I21-C23 PolarHBondContact O-N 2.85Å
24	L	89.5	Confident	92.4	Very high	45 Å²	45	83.2 Å²	83.2	24%	0.236	39%	0.393	C	S	.	.	H	α-helix	trans	-83.2	-37.3	-178.6	-66.8	169.9	0	0	0	113	Y20 I21 H22 A27 T28 P92 I95	Y20-L24 HydrophobicContact CD1-CD1 4.03Å; Y20-L24 HydrophobicContact CE1-CD1 3.73Å; Y20-L24 WeakPolarHBondContact O-CG 3.46Å; Y20-L24 PolarHBondContact O-N 3.26Å; I21-L24 PolarHBondContact O-N 3.5Å; H22-L24 VanDerWaalsContact C-N 3.34Å; L24-A27 PolarHBondContact O-N 3.23Å; L24-T28 PolarHBondContact O-N 3.35Å; L24-T28 PolarHBondContact O-OG1 2.92Å; L24-P92 HydrophobicContact CB-CG 4.06Å; L24-I95 HydrophobicContact CD1-CD1 3.44Å; L24-I95 VanDerWaalsContact CD1-CD1 3.44Å
25	Q	87.1	Confident	92.4	Very high	101 Å²	101	82.9 Å²	82.9	47%	0.472	39%	0.393	S	S	.	.	H	α-helix	trans	-53.9	-45.1	-175.5	-170.6	173.3	-41.7	0	0	115.3	I21 A27 T28 G29	I21-Q25 WeakPolarHBondContact O-CB 3.47Å; I21-Q25 PolarHBondContact O-N 2.87Å; Q25-A27 PolarHBondContact O-N 3.48Å; Q25-T28 PolarHBondContact O-N 2.88Å; Q25-G29 PolarHBondContact O-N 2.95Å
26	P	88.1	Confident	92.4	Very high	65 Å²	65	79.1 Å²	79.1	42%	0.422	39%	0.385	S	S	.	.	H	α-helix	trans	-66.6	-37.9	180	23.6	-32.4	0	0	0	111.8	H22 R30	H22-P26 WeakPolarHBondContact O-CD 3.39Å; P26-R30 WeakPolarHBondContact O-CG 3.37Å; P26-R30 PolarHBondContact O-N 2.88Å; P26-R30 VanDerWaalsContact O-N 3.14Å
27	A	90.1	Very high	92.4	Very high	42 Å²	42	75 Å²	75	35%	0.347	38%	0.378	S	S	.	.	H	α-helix	trans	-67.5	-48	175.2	0	0	0	0	0	110.8	L24 Q25 G29 R30 W31	L24-A27 PolarHBondContact O-N 3.23Å; Q25-A27 PolarHBondContact O-N 3.48Å; A27-G29 VanDerWaalsContact C-N 3.32Å; A27-G29 PolarHBondContact O-N 3.38Å; A27-R30 PolarHBondContact O-N 3.42Å; A27-W31 PolarHBondContact O-N 3.36Å; A27-W31 VanDerWaalsContact O-N 3.08Å
28	T	90.7	Very high	92.5	Very high	8 Å²	8	75.3 Å²	75.3	5%	0.049	38%	0.38	C	S	.	.	H	α-helix	trans	-60.3	-40.7	176.6	-67.2	0	0	0	0	112.1	L24 Q25 R30 W31 R32 R88 V89 P92	L24-T28 PolarHBondContact O-N 3.35Å; L24-T28 PolarHBondContact O-OG1 2.92Å; Q25-T28 PolarHBondContact O-N 2.88Å; T28-R30 PolarHBondContact O-N 3.41Å; T28-W31 PolarHBondContact O-N 2.98Å; T28-R32 HydrophobicContact CG2-CG 4.36Å; T28-R32 WeakPolarHBondContact O-CG 3.18Å; T28-R32 PolarHBondContact O-N 3.41Å; T28-R88 PolarHBondContact OG1-O 3.49Å; T28-V89 WeakPolarHBondContact CG2-O 3.5Å; T28-P92 HydrophobicContact CG2-CG 3.94Å; T28-P92 WeakPolarHBondContact OG1-CD 3.42Å; T28-P92 WeakPolarHBondContact OG1-CG 3.29Å
29	G	91.1	Very high	92.5	Very high	30 Å²	30	75.6 Å²	75.6	31%	0.309	38%	0.384	S	S	.	.	H	α-helix	trans	-58.5	-46.7	175	0	0	0	0	0	112.1	Q25 A27 W31 R32 M33	Q25-G29 PolarHBondContact O-N 2.95Å; A27-G29 VanDerWaalsContact C-N 3.32Å; A27-G29 PolarHBondContact O-N 3.38Å; G29-W31 PolarHBondContact O-N 3.23Å; G29-R32 PolarHBondContact O-N 2.89Å; G29-M33 WeakPolarHBondContact O-CG 3.28Å; G29-M33 PolarHBondContact O-N 3.27Å
30	R	92.6	Very high	92.6	Very high	178 Å²	178	76.1 Å²	76.1	67%	0.672	39%	0.392	S	S	*	.	H	α-helix	trans	-58.4	-46.5	174.6	-68.8	173.2	-160	172	4.7	112	P26 A27 T28 R32 M33 L34	P26-R30 WeakPolarHBondContact O-CG 3.37Å; P26-R30 PolarHBondContact O-N 2.88Å; P26-R30 VanDerWaalsContact O-N 3.14Å; A27-R30 PolarHBondContact O-N 3.42Å; T28-R30 PolarHBondContact O-N 3.41Å; R30-R32 VanDerWaalsContact C-N 3.34Å; R30-R32 PolarHBondContact O-N 2.75Å; R30-M33 PolarHBondContact O-N 3.43Å; R30-L34 WeakPolarHBondContact O-CG 3.17Å; R30-L34 PolarHBondContact O-N 2.88Å
31	W	93.6	Very high	92.8	Very high	69 Å²	69	71.9 Å²	71.9	26%	0.261	38%	0.381	S	S	.	.	H	α-helix	trans	-63.4	-39	178.3	-72.1	113.7	0	0	0	112.7	A27 T28 G29 L34 L35 L80 I85 R88 V89	A27-W31 PolarHBondContact O-N 3.36Å; A27-W31 VanDerWaalsContact O-N 3.08Å; T28-W31 PolarHBondContact O-N 2.98Å; G29-W31 PolarHBondContact O-N 3.23Å; W31-L34 HydrophobicContact CE3-CD1 4.24Å; W31-L34 HydrophobicContact CZ3-CD1 4.42Å; W31-L35 WeakPolarHBondContact O-CB 3.22Å; W31-L35 PolarHBondContact O-N 3.38Å; W31-L80 HydrophobicContact CE3-CD2 4.49Å; W31-L80 HydrophobicContact CZ3-CD2 3.84Å; W31-I85 HydrophobicContact CB-CD1 4.47Å; W31-I85 HydrophobicContact CB-CG1 4.29Å; W31-I85 HydrophobicContact CD2-CG1 4.4Å; W31-I85 HydrophobicContact CE3-CD1 3.72Å; W31-I85 HydrophobicContact CE3-CG1 3.9Å; W31-I85 HydrophobicContact CZ3-CD1 4.43Å; W31-R88 HydrophobicContact CG-CB 4.21Å; W31-V89 HydrophobicContact CB-CG1 3.61Å
32	R	94.2	Very high	93	Very high	120 Å²	120	72.7 Å²	72.7	45%	0.453	39%	0.386	S	S	.	.	H	α-helix	trans	-64	-46	175	-72.6	176.9	-178.6	-177.5	1.4	111.5	T28 G29 R30 L34 L35 I36 V89	T28-R32 HydrophobicContact CG2-CG 4.36Å; T28-R32 WeakPolarHBondContact O-CG 3.18Å; T28-R32 PolarHBondContact O-N 3.41Å; G29-R32 PolarHBondContact O-N 2.89Å; R30-R32 VanDerWaalsContact C-N 3.34Å; R30-R32 PolarHBondContact O-N 2.75Å; R32-L34 PolarHBondContact O-N 3.44Å; R32-L35 PolarHBondContact O-N 3.48Å; R32-I36 VanDerWaalsContact O-CG1 3.26Å; R32-I36 WeakPolarHBondContact O-CG1 3.39Å; R32-I36 PolarHBondContact O-N 3.11Å; R32-V89 HydrophobicContact CG-CB 4.08Å; R32-V89 HydrophobicContact CG-CG1 3.93Å; R32-V89 PolarHBondContact NH2-O 3.45Å
33	M	95.5	Very high	93.3	Very high	118 Å²	118	69.4 Å²	69.4	58%	0.581	38%	0.382	S	S	*	.	H	α-helix	trans	-61.4	-45.1	177.2	-70.2	-56.6	-64.4	0	0	111.9	G29 R30 L35 I36 V37	G29-M33 WeakPolarHBondContact O-CG 3.28Å; G29-M33 PolarHBondContact O-N 3.27Å; R30-M33 PolarHBondContact O-N 3.43Å; M33-L35 VanDerWaalsContact C-N 3.35Å; M33-L35 PolarHBondContact O-N 3.4Å; M33-I36 PolarHBondContact O-N 3.17Å; M33-V37 WeakPolarHBondContact O-CG2 3.25Å; M33-V37 PolarHBondContact O-N 2.88Å
34	L	94.3	Very high	93.5	Very high	90 Å²	90	68.1 Å²	68.1	47%	0.471	37%	0.371	S	S	.	.	H	α-helix	trans	-59.4	-45.1	175.2	-74.9	172.9	0	0	0	111.9	R30 W31 R32 I36 V37 V38	R30-L34 WeakPolarHBondContact O-CG 3.17Å; R30-L34 PolarHBondContact O-N 2.88Å; W31-L34 HydrophobicContact CE3-CD1 4.24Å; W31-L34 HydrophobicContact CZ3-CD1 4.42Å; R32-L34 PolarHBondContact O-N 3.44Å; L34-I36 VanDerWaalsContact C-N 3.34Å; L34-I36 PolarHBondContact O-N 2.81Å; L34-V37 PolarHBondContact O-N 3.48Å; L34-V38 WeakPolarHBondContact O-CB 3.49Å; L34-V38 VanDerWaalsContact O-CG2 3.32Å; L34-V38 WeakPolarHBondContact O-CG2 3.45Å; L34-V38 PolarHBondContact O-N 2.92Å
35	L	94.5	Very high	93.7	Very high	51 Å²	51	66.1 Å²	66.1	27%	0.267	36%	0.361	S	S	.	.	H	α-helix	trans	-62.8	-40.9	178.5	-174.4	65.4	0	0	0	112	W31 R32 M33 S39 L77 I85	W31-L35 WeakPolarHBondContact O-CB 3.22Å; W31-L35 PolarHBondContact O-N 3.38Å; R32-L35 PolarHBondContact O-N 3.48Å; M33-L35 VanDerWaalsContact C-N 3.35Å; M33-L35 PolarHBondContact O-N 3.4Å; L35-S39 VanDerWaalsContact O-CB 3.28Å; L35-S39 WeakPolarHBondContact O-CB 3.47Å; L35-S39 PolarHBondContact O-N 3.05Å; L35-S39 PolarHBondContact O-OG 2.91Å; L35-S39 VanDerWaalsContact O-OG 3.14Å; L35-L77 HydrophobicContact CD1-CD1 3.91Å; L35-I85 HydrophobicContact CB-CD1 4.04Å; L35-I85 HydrophobicContact CD1-CD1 4.26Å
36	I	95.6	Very high	94	Very high	92 Å²	92	62.4 Å²	62.4	47%	0.472	35%	0.347	S	S	.	.	H	α-helix	trans	-63.7	-46.7	176.2	-69.1	163.9	0	0	0	110.8	R32 M33 L34 S39 V40	R32-I36 VanDerWaalsContact O-CG1 3.26Å; R32-I36 WeakPolarHBondContact O-CG1 3.39Å; R32-I36 PolarHBondContact O-N 3.11Å; M33-I36 PolarHBondContact O-N 3.17Å; L34-I36 VanDerWaalsContact C-N 3.34Å; L34-I36 PolarHBondContact O-N 2.81Å; I36-S39 PolarHBondContact O-N 3.45Å; I36-S39 PolarHBondContact O-OG 3.47Å; I36-V40 HydrophobicContact CG2-CG2 4.48Å; I36-V40 WeakPolarHBondContact O-CB 3.36Å; I36-V40 VanDerWaalsContact O-CG2 3.29Å; I36-V40 WeakPolarHBondContact O-CG2 3.2Å; I36-V40 PolarHBondContact O-N 3.25Å
37	V	95.8	Very high	94.3	Very high	81 Å²	81	67.6 Å²	67.6	49%	0.491	36%	0.359	S	S	.	.	H	α-helix	trans	-62	-49.3	179.9	170.4	0	0	0	0	110.4	M33 L34 S39 V40 C41	M33-V37 WeakPolarHBondContact O-CG2 3.25Å; M33-V37 PolarHBondContact O-N 2.88Å; L34-V37 PolarHBondContact O-N 3.48Å; V37-S39 VanDerWaalsContact C-N 3.34Å; V37-S39 PolarHBondContact O-N 3.14Å; V37-V40 PolarHBondContact O-N 3.1Å; V37-C41 WeakPolarHBondContact O-CB 3.34Å; V37-C41 PolarHBondContact O-N 3.03Å; V37-C41 PolarHBondContact O-SG 3.38Å
38	V	95.6	Very high	94.3	Very high	19 Å²	19	70.5 Å²	70.5	12%	0.115	37%	0.369	C	S	.	.	H	α-helix	trans	-64.1	-38.9	-179.5	174.6	0	0	0	0	111.4	L34 C41 T42 T76 L77 L80	L34-V38 WeakPolarHBondContact O-CB 3.49Å; L34-V38 VanDerWaalsContact O-CG2 3.32Å; L34-V38 WeakPolarHBondContact O-CG2 3.45Å; L34-V38 PolarHBondContact O-N 2.92Å; V38-C41 PolarHBondContact O-N 3.34Å; V38-T42 WeakPolarHBondContact O-CB 3.42Å; V38-T42 PolarHBondContact O-N 3.05Å; V38-T42 PolarHBondContact O-OG1 3.48Å; V38-T76 HydrophobicContact CG1-CG2 4.28Å; V38-T76 HydrophobicContact CG2-CG2 3.91Å; V38-L77 HydrophobicContact CG1-CB 3.84Å; V38-L77 HydrophobicContact CG1-CD1 4.13Å; V38-L80 HydrophobicContact CB-CD1 4.47Å; V38-L80 HydrophobicContact CG2-CD1 4.14Å
39	S	95.1	Very high	94.3	Very high	54 Å²	54	71.9 Å²	71.9	38%	0.378	37%	0.373	S	S	.	.	H	α-helix	trans	-66.9	-41.4	178.3	68	0	0	0	0	112.2	L35 I36 V37 T42 A43	L35-S39 VanDerWaalsContact O-CB 3.28Å; L35-S39 WeakPolarHBondContact O-CB 3.47Å; L35-S39 PolarHBondContact O-N 3.05Å; L35-S39 PolarHBondContact O-OG 2.91Å; L35-S39 VanDerWaalsContact O-OG 3.14Å; I36-S39 PolarHBondContact O-N 3.45Å; I36-S39 PolarHBondContact O-OG 3.47Å; V37-S39 VanDerWaalsContact C-N 3.34Å; V37-S39 PolarHBondContact O-N 3.14Å; S39-T42 PolarHBondContact O-N 2.9Å; S39-A43 WeakPolarHBondContact O-CB 3.5Å; S39-A43 PolarHBondContact O-N 3.02Å
40	V	96.9	Very high	94.3	Very high	81 Å²	81	76.2 Å²	76.2	49%	0.491	39%	0.388	S	S	.	.	H	α-helix	trans	-63.4	-46.3	174.7	171.9	0	0	0	0	110.7	I36 V37 T42 A43 T44	I36-V40 HydrophobicContact CG2-CG2 4.48Å; I36-V40 WeakPolarHBondContact O-CB 3.36Å; I36-V40 VanDerWaalsContact O-CG2 3.29Å; I36-V40 WeakPolarHBondContact O-CG2 3.2Å; I36-V40 PolarHBondContact O-N 3.25Å; V37-V40 PolarHBondContact O-N 3.1Å; V40-T42 VanDerWaalsContact C-N 3.29Å; V40-T42 PolarHBondContact O-N 3.1Å; V40-A43 PolarHBondContact O-N 3.25Å; V40-T44 HydrophobicContact CG1-CG2 4.48Å; V40-T44 WeakPolarHBondContact O-CG2 3.41Å; V40-T44 PolarHBondContact O-N 3.27Å; V40-T44 PolarHBondContact O-OG1 2.93Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å
41	C	95.3	Very high	94.3	Very high	38 Å²	38	72.9 Å²	72.9	26%	0.257	38%	0.383	S	S	.	.	H	α-helix	trans	-60.3	-39.1	175.3	-67.8	0	0	0	0	112.3	V37 V38 T44 G45 F69	V37-C41 WeakPolarHBondContact O-CB 3.34Å; V37-C41 PolarHBondContact O-N 3.03Å; V37-C41 PolarHBondContact O-SG 3.38Å; V38-C41 PolarHBondContact O-N 3.34Å; C41-T44 PolarHBondContact O-OG1 3.4Å; C41-G45 PolarHBondContact O-N 3.46Å; C41-F69 HydrophobicContact CB-CE1 4.23Å; C41-F69 HydrophobicContact CB-CZ 3.88Å; C41-F69 WeakPolarHBondContact O-CE1 3.29Å
42	T	95.7	Very high	94.1	Very high	20 Å²	20	71.6 Å²	71.6	12%	0.123	38%	0.381	C	S	.	.	H	α-helix	trans	-66.4	-42.9	176.9	-53.1	0	0	0	0	110.6	V38 S39 V40 G45 A46 F70	V38-T42 WeakPolarHBondContact O-CB 3.42Å; V38-T42 PolarHBondContact O-N 3.05Å; V38-T42 PolarHBondContact O-OG1 3.48Å; S39-T42 PolarHBondContact O-N 2.9Å; V40-T42 VanDerWaalsContact C-N 3.29Å; V40-T42 PolarHBondContact O-N 3.1Å; T42-G45 PolarHBondContact O-N 3.44Å; T42-A46 WeakPolarHBondContact O-CB 3.32Å; T42-A46 PolarHBondContact O-N 3.29Å; T42-F70 HydrophobicContact CG2-CE2 4.09Å
43	A	96.4	Very high	93.7	Very high	62 Å²	62	69.7 Å²	69.7	51%	0.512	38%	0.384	S	S	.	.	H	α-helix	trans	-66.1	-44.3	179.9	0	0	0	0	0	112.3	S39 V40 A46 W47	S39-A43 WeakPolarHBondContact O-CB 3.5Å; S39-A43 PolarHBondContact O-N 3.02Å; V40-A43 PolarHBondContact O-N 3.25Å; A43-A46 PolarHBondContact O-N 3.4Å; A43-W47 WeakPolarHBondContact O-CB 3.47Å; A43-W47 PolarHBondContact O-N 2.94Å
44	T	95	Very high	93.2	Very high	67 Å²	67	68.1 Å²	68.1	41%	0.411	38%	0.375	S	S	.	.	H	α-helix	trans	-69.6	-38.4	176.4	56.4	0	0	0	0	111.9	V40 C41 W47 N48	V40-T44 HydrophobicContact CG1-CG2 4.48Å; V40-T44 WeakPolarHBondContact O-CG2 3.41Å; V40-T44 PolarHBondContact O-N 3.27Å; V40-T44 PolarHBondContact O-OG1 2.93Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å; C41-T44 PolarHBondContact O-OG1 3.4Å; T44-W47 PolarHBondContact O-N 2.69Å; T44-N48 PolarHBondContact O-N 3.42Å; T44-N48 VanDerWaalsContact O-N 3.11Å; T44-N48 PolarHBondContact O-ND2 3.41Å
45	G	93.8	Very high	92.7	Very high	3 Å²	3	65 Å²	65	3%	0.031	36%	0.36	C	S	.	.	H	α-helix	trans	-60.5	-46.2	172	0	0	0	0	0	111.9	C41 T42 W47 N48 W49	C41-G45 PolarHBondContact O-N 3.46Å; T42-G45 PolarHBondContact O-N 3.44Å; G45-W47 VanDerWaalsContact C-N 3.35Å; G45-W47 PolarHBondContact O-N 2.86Å; G45-N48 PolarHBondContact O-N 2.89Å; G45-W49 VanDerWaalsContact O-CB 3.27Å; G45-W49 WeakPolarHBondContact O-CB 3.37Å; G45-W49 PolarHBondContact O-N 3.23Å
46	A	94.5	Very high	92.1	Very high	22 Å²	22	71 Å²	71	18%	0.182	39%	0.386	C	S	.	.	H	α-helix	trans	-62.4	-41.9	177.2	0	0	0	0	0	111.8	T42 A43 W49 L50 F70	T42-A46 WeakPolarHBondContact O-CB 3.32Å; T42-A46 PolarHBondContact O-N 3.29Å; A43-A46 PolarHBondContact O-N 3.4Å; A46-W49 PolarHBondContact O-N 2.95Å; A46-L50 WeakPolarHBondContact O-CB 3.42Å; A46-L50 VanDerWaalsContact O-CG 3.22Å; A46-L50 WeakPolarHBondContact O-CG 3.47Å; A46-L50 PolarHBondContact O-N 3.45Å; A46-F70 HydrophobicContact CB-CD2 4.06Å; A46-F70 HydrophobicContact CB-CE2 3.63Å; A46-F70 HydrophobicContact CB-CZ 4.34Å
47	W	93.2	Very high	91.7	Very high	174 Å²	174	73.4 Å²	73.4	66%	0.659	39%	0.394	S	S	*	.	H	α-helix	trans	-59.5	-48.7	177.2	-174.5	-94.3	0	0	0	112	A43 T44 G45 W49 L50 I51	A43-W47 WeakPolarHBondContact O-CB 3.47Å; A43-W47 PolarHBondContact O-N 2.94Å; T44-W47 PolarHBondContact O-N 2.69Å; G45-W47 VanDerWaalsContact C-N 3.35Å; G45-W47 PolarHBondContact O-N 2.86Å; W47-W49 VanDerWaalsContact C-N 3.32Å; W47-W49 PolarHBondContact O-N 3.26Å; W47-L50 PolarHBondContact O-N 3.08Å; W47-I51 HydrophobicContact CD2-CD1 4.17Å; W47-I51 VanDerWaalsContact CE2-CD1 3.48Å; W47-I51 HydrophobicContact CG-CD1 4.32Å; W47-I51 HydrophobicContact CZ2-CD1 3.86Å; W47-I51 WeakPolarHBondContact O-CG1 3.47Å; W47-I51 PolarHBondContact O-N 3.46Å
48	N	91.2	Very high	91.5	Very high	104 Å²	104	71.9 Å²	71.9	56%	0.556	38%	0.384	S	S	*	.	H	α-helix	trans	-63.2	-39.9	176.2	-73.2	-57.9	0	0	0	112	T44 G45 D52	T44-N48 PolarHBondContact O-N 3.42Å; T44-N48 VanDerWaalsContact O-N 3.11Å; T44-N48 PolarHBondContact O-ND2 3.41Å; G45-N48 PolarHBondContact O-N 2.89Å; N48-D52 PolarHBondContact O-N 3.33Å
49	W	91.6	Very high	91.2	Very high	37 Å²	37	74.2 Å²	74.2	14%	0.14	40%	0.401	C	S	.	.	H	α-helix	trans	-64.2	-39.9	178.7	-179.1	54.9	0	0	0	113.1	G45 A46 W47 T55 F60 S63 H67 F70	G45-W49 VanDerWaalsContact O-CB 3.27Å; G45-W49 WeakPolarHBondContact O-CB 3.37Å; G45-W49 PolarHBondContact O-N 3.23Å; A46-W49 PolarHBondContact O-N 2.95Å; W47-W49 VanDerWaalsContact C-N 3.32Å; W47-W49 PolarHBondContact O-N 3.26Å; W49-T55 HydrophobicContact CD2-CG2 4.4Å; W49-T55 HydrophobicContact CZ2-CG2 3.88Å; W49-T55 PolarHBondContact O-OG1 3.35Å; W49-F60 HydrophobicContact CH2-CD2 4.14Å; W49-F60 AromaticContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CZ2-CD2 4.05Å; W49-F60 AromaticContact CZ2-CE2 3.91Å; W49-F60 HydrophobicContact CZ2-CE2 3.91Å; W49-S63 PolarHBondContact NE1-OG 3.23Å; W49-H67 AromaticContact CD1-CD2 3.32Å; W49-H67 AromaticContact CD1-CG 3.5Å; W49-H67 VanDerWaalsContact CD1-CG 3.5Å; W49-H67 AromaticContact CD1-NE2 3.82Å; W49-H67 AromaticContact NE1-CD2 3.95Å; W49-F70 HydrophobicContact CB-CD1 4.3Å; W49-F70 HydrophobicContact CB-CG 4.43Å; W49-F70 HydrophobicContact CD2-CD1 4Å; W49-F70 AromaticContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CE3-CD1 4.26Å; W49-F70 AromaticContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CZ 4.09Å; W49-F70 HydrophobicContact CG-CD1 4.01Å; W49-F70 HydrophobicContact CG-CE1 4.33Å; W49-F70 HydrophobicContact CZ3-CE1 4.16Å; W49-F70 HydrophobicContact CZ3-CZ 4.49Å
50	L	90.7	Very high	90.9	Very high	120 Å²	120	77.4 Å²	77.4	63%	0.628	41%	0.409	S	S	*	.	H	α-helix	trans	-74.8	-28.1	-178.6	-73.8	171.5	0	0	0	113.7	A46 W47	A46-L50 WeakPolarHBondContact O-CB 3.42Å; A46-L50 VanDerWaalsContact O-CG 3.22Å; A46-L50 WeakPolarHBondContact O-CG 3.47Å; A46-L50 PolarHBondContact O-N 3.45Å; W47-L50 PolarHBondContact O-N 3.08Å
51	I	91.2	Very high	90.6	Very high	109 Å²	109	81 Å²	81	56%	0.559	42%	0.418	S	S	*	.	H	α-helix	trans	-84.7	-19.6	178.7	-67.9	175.5	0	0	0	111.7	W47 P53	W47-I51 HydrophobicContact CD2-CD1 4.17Å; W47-I51 VanDerWaalsContact CE2-CD1 3.48Å; W47-I51 HydrophobicContact CG-CD1 4.32Å; W47-I51 HydrophobicContact CZ2-CD1 3.86Å; W47-I51 WeakPolarHBondContact O-CG1 3.47Å; W47-I51 PolarHBondContact O-N 3.46Å; I51-P53 VanDerWaalsContact O-CD 3.28Å; I51-P53 WeakPolarHBondContact O-CD 3.28Å
52	D	89.2	Confident	90.3	Very high	42 Å²	42	82.3 Å²	82.3	23%	0.225	43%	0.425	C	S	.	.			trans	-66.9	115.6	179.9	-178.9	9.3	0	0	0	111.6	N48 E54 T55 H67	N48-D52 PolarHBondContact O-N 3.33Å; D52-E54 PolarHBondContact O-N 3.46Å; D52-E54 WeakPolarHBondContact OD1-CB 3.41Å; D52-E54 PolarHBondContact OD1-N 3.27Å; D52-T55 VanDerWaalsContact O-CB 3.28Å; D52-T55 WeakPolarHBondContact O-CB 3.2Å; D52-T55 PolarHBondContact O-N 3.47Å; D52-T55 VanDerWaalsContact O-N 3.17Å; D52-H67 IonicContact OD2-CD2 3.16Å; D52-H67 IonicContact OD2-CE1 2.71Å; D52-H67 PolarHBondContact OD2-CE1 2.94Å; D52-H67 IonicContact OD2-NE2 2.68Å; D52-H67 PolarHBondContact OD2-NE2 2.94Å
53	P	86.8	Confident	90.1	Very high	79 Å²	79	81.4 Å²	81.4	51%	0.513	42%	0.419	S	S	.	.	G	3₁₀ helix	trans	-64.1	-24.2	178.1	27.6	-36.2	0	0	0	113.2	I51 T55 Q56	I51-P53 VanDerWaalsContact O-CD 3.28Å; I51-P53 WeakPolarHBondContact O-CD 3.28Å; P53-T55 VanDerWaalsContact C-N 3.27Å; P53-T55 PolarHBondContact O-N 2.95Å; P53-Q56 PolarHBondContact O-N 2.94Å
54	E	84.8	Confident	89.8	Confident	85 Å²	85	80 Å²	80	40%	0.397	40%	0.403	S	S	.	.	G	3₁₀ helix	trans	-70.4	-26.1	178	-62.4	-55.4	124.6	0	0	111.9	D52 Q56 K57 V58	D52-E54 PolarHBondContact O-N 3.46Å; D52-E54 WeakPolarHBondContact OD1-CB 3.41Å; D52-E54 PolarHBondContact OD1-N 3.27Å; E54-Q56 PolarHBondContact O-N 2.96Å; E54-K57 PolarHBondContact O-N 3.5Å; E54-K57 IonicContact OE1-NZ 3.84Å; E54-K57 PolarHBondContact OE1-NZ 3.3Å; E54-K57 IonicContact OE2-NZ 3.99Å; E54-V58 PolarHBondContact O-N 2.94Å
55	T	83.3	Confident	89.6	Confident	25 Å²	25	87.3 Å²	87.3	15%	0.153	42%	0.423	C	S	.	.	G	3₁₀ helix	trans	-57.7	-32.4	175.3	-66.1	0	0	0	0	112.4	W49 D52 P53 S63	W49-T55 HydrophobicContact CD2-CG2 4.4Å; W49-T55 HydrophobicContact CZ2-CG2 3.88Å; W49-T55 PolarHBondContact O-OG1 3.35Å; D52-T55 VanDerWaalsContact O-CB 3.28Å; D52-T55 WeakPolarHBondContact O-CB 3.2Å; D52-T55 PolarHBondContact O-N 3.47Å; D52-T55 VanDerWaalsContact O-N 3.17Å; P53-T55 VanDerWaalsContact C-N 3.27Å; P53-T55 PolarHBondContact O-N 2.95Å; T55-S63 WeakPolarHBondContact CG2-OG 3.3Å; T55-S63 PolarHBondContact OG1-OG 3.3Å
56	Q	82.3	Confident	89.4	Confident	176 Å²	176	91.5 Å²	91.5	82%	0.822	45%	0.445	S	S	*	.	G	3₁₀ helix	trans	-80.1	-18.5	179.2	-64.1	-175	-19.7	0	0	113.7	P53 E54	P53-Q56 PolarHBondContact O-N 2.94Å; E54-Q56 PolarHBondContact O-N 2.96Å
57	K	88.1	Confident	89.3	Confident	144 Å²	144	92 Å²	92	63%	0.626	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	-25.8	-174.5	-61.9	177.3	-171.3	168.5	0	113	E54	E54-K57 PolarHBondContact O-N 3.5Å; E54-K57 IonicContact OE1-NZ 3.84Å; E54-K57 PolarHBondContact OE1-NZ 3.3Å; E54-K57 IonicContact OE2-NZ 3.99Å
58	V	90.2	Very high	89.3	Confident	48 Å²	48	87.4 Å²	87.4	29%	0.291	44%	0.436	S	S	.	.	S	Bend	trans	-104	162.8	-177.9	-56.2	0	0	0	0	111.4	E54 T62	E54-V58 PolarHBondContact O-N 2.94Å; V58-T62 HydrophobicContact CB-CG2 4.06Å; V58-T62 HydrophobicContact CG1-CG2 4.48Å; V58-T62 HydrophobicContact CG2-CG2 4.31Å
59	S	90.4	Very high	89.3	Confident	68 Å²	68	88.1 Å²	88.1	48%	0.476	43%	0.434	S	S	.	.			trans	-63.3	154.9	173.9	85.2	0	0	0	0	111.5	F61 T62 S63	S59-F61 PolarHBondContact O-N 3.35Å; S59-T62 WeakPolarHBondContact O-CB 3.26Å; S59-T62 PolarHBondContact O-N 2.92Å; S59-T62 VanDerWaalsContact O-N 3.11Å; S59-T62 WeakPolarHBondContact OG-CB 2.89Å; S59-T62 PolarHBondContact OG-N 3Å; S59-T62 PolarHBondContact OG-OG1 3.36Å; S59-S63 PolarHBondContact O-N 2.94Å
60	F	88.3	Confident	89.3	Confident	122 Å²	122	87.5 Å²	87.5	54%	0.535	43%	0.433	S	S	.	.	H	α-helix	trans	-53.4	-48.9	-178.7	176.7	-104.6	0	0	0	113.2	W49 T62 S63 L64	W49-F60 HydrophobicContact CH2-CD2 4.14Å; W49-F60 AromaticContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CZ2-CD2 4.05Å; W49-F60 AromaticContact CZ2-CE2 3.91Å; W49-F60 HydrophobicContact CZ2-CE2 3.91Å; F60-T62 VanDerWaalsContact C-N 3.35Å; F60-T62 PolarHBondContact O-N 3.14Å; F60-S63 WeakPolarHBondContact O-CB 3.34Å; F60-S63 PolarHBondContact O-N 3.02Å; F60-L64 HydrophobicContact CD1-CD1 4.07Å; F60-L64 HydrophobicContact CE1-CD1 3.47Å; F60-L64 VanDerWaalsContact CE1-CD1 3.47Å; F60-L64 HydrophobicContact CE1-CG 4.16Å; F60-L64 HydrophobicContact CE2-CD1 4.46Å; F60-L64 HydrophobicContact CE2-CD2 4.37Å; F60-L64 HydrophobicContact CE2-CG 4.38Å; F60-L64 HydrophobicContact CZ-CD1 3.7Å; F60-L64 HydrophobicContact CZ-CD2 4.21Å; F60-L64 HydrophobicContact CZ-CG 4.08Å; F60-L64 WeakPolarHBondContact O-CG 3.28Å; F60-L64 PolarHBondContact O-N 2.92Å
61	F	90	Very high	89.5	Confident	156 Å²	156	83.2 Å²	83.2	68%	0.684	41%	0.412	S	S	*	.	H	α-helix	trans	-65.9	-36.3	179.3	-69.2	-72.8	0	0	0	112.8	S59 S63 L64 W65	S59-F61 PolarHBondContact O-N 3.35Å; F61-S63 VanDerWaalsContact C-N 3.35Å; F61-L64 PolarHBondContact O-N 3.39Å; F61-W65 PolarHBondContact O-N 3.42Å; F61-W65 VanDerWaalsContact O-N 3.15Å
62	T	90.6	Very high	89.6	Confident	65 Å²	65	83.1 Å²	83.1	40%	0.399	41%	0.411	S	S	.	.	H	α-helix	trans	-65	-42.2	173.3	-51.7	0	0	0	0	110.8	V58 S59 F60 L64 W65 N66	V58-T62 HydrophobicContact CB-CG2 4.06Å; V58-T62 HydrophobicContact CG1-CG2 4.48Å; V58-T62 HydrophobicContact CG2-CG2 4.31Å; S59-T62 WeakPolarHBondContact O-CB 3.26Å; S59-T62 PolarHBondContact O-N 2.92Å; S59-T62 VanDerWaalsContact O-N 3.11Å; S59-T62 WeakPolarHBondContact OG-CB 2.89Å; S59-T62 PolarHBondContact OG-N 3Å; S59-T62 PolarHBondContact OG-OG1 3.36Å; F60-T62 VanDerWaalsContact C-N 3.35Å; F60-T62 PolarHBondContact O-N 3.14Å; T62-L64 VanDerWaalsContact C-N 3.34Å; T62-L64 PolarHBondContact O-N 3.33Å; T62-W65 WeakPolarHBondContact O-CB 3.29Å; T62-W65 PolarHBondContact O-N 3.03Å; T62-W65 VanDerWaalsContact O-N 3.15Å; T62-N66 PolarHBondContact O-N 3.1Å
63	S	90.8	Very high	89.9	Confident	1 Å²	1	81.6 Å²	81.6	1%	0.007	40%	0.404	C	S	.	.	H	α-helix	trans	-61.1	-43.3	176.4	-174.1	0	0	0	0	111.5	W49 T55 S59 F60 F61 W65 N66 H67	W49-S63 PolarHBondContact NE1-OG 3.23Å; T55-S63 WeakPolarHBondContact CG2-OG 3.3Å; T55-S63 PolarHBondContact OG1-OG 3.3Å; S59-S63 PolarHBondContact O-N 2.94Å; F60-S63 WeakPolarHBondContact O-CB 3.34Å; F60-S63 PolarHBondContact O-N 3.02Å; F61-S63 VanDerWaalsContact C-N 3.35Å; S63-W65 VanDerWaalsContact C-N 3.28Å; S63-W65 PolarHBondContact O-N 3.24Å; S63-N66 WeakPolarHBondContact O-CB 3.4Å; S63-N66 PolarHBondContact O-N 3.28Å; S63-N66 VanDerWaalsContact O-N 3.08Å; S63-H67 PolarHBondContact O-CD2 2.91Å; S63-H67 VanDerWaalsContact O-CD2 3.32Å; S63-H67 PolarHBondContact O-N 3Å; S63-H67 VanDerWaalsContact O-N 3.15Å
64	L	90.4	Very high	90.3	Very high	33 Å²	33	79.3 Å²	79.3	17%	0.173	39%	0.389	C	S	.	.	H	α-helix	trans	-59.9	-37.6	174.7	-69.9	-177.9	0	0	0	112.6	F60 F61 T62 N66 H67 F70 T71	F60-L64 HydrophobicContact CD1-CD1 4.07Å; F60-L64 HydrophobicContact CE1-CD1 3.47Å; F60-L64 VanDerWaalsContact CE1-CD1 3.47Å; F60-L64 HydrophobicContact CE1-CG 4.16Å; F60-L64 HydrophobicContact CE2-CD1 4.46Å; F60-L64 HydrophobicContact CE2-CD2 4.37Å; F60-L64 HydrophobicContact CE2-CG 4.38Å; F60-L64 HydrophobicContact CZ-CD1 3.7Å; F60-L64 HydrophobicContact CZ-CD2 4.21Å; F60-L64 HydrophobicContact CZ-CG 4.08Å; F60-L64 WeakPolarHBondContact O-CG 3.28Å; F60-L64 PolarHBondContact O-N 2.92Å; F61-L64 PolarHBondContact O-N 3.39Å; T62-L64 VanDerWaalsContact C-N 3.34Å; T62-L64 PolarHBondContact O-N 3.33Å; L64-N66 VanDerWaalsContact C-N 3.34Å; L64-H67 CarbonylContact O-C 3.44Å; L64-H67 PolarHBondContact O-N 2.9Å; L64-F70 HydrophobicContact CD2-CD1 4.05Å; L64-F70 HydrophobicContact CD2-CE1 3.92Å; L64-T71 PolarHBondContact O-OG1 3.06Å
65	W	89.9	Confident	90.8	Very high	220 Å²	220	80.5 Å²	80.5	83%	0.833	40%	0.397	S	S	*	.	H	α-helix	trans	-66.5	-34.4	174.4	-99.1	99.8	0	0	0	113.1	F61 T62 S63 H67	F61-W65 PolarHBondContact O-N 3.42Å; F61-W65 VanDerWaalsContact O-N 3.15Å; T62-W65 WeakPolarHBondContact O-CB 3.29Å; T62-W65 PolarHBondContact O-N 3.03Å; T62-W65 VanDerWaalsContact O-N 3.15Å; S63-W65 VanDerWaalsContact C-N 3.28Å; S63-W65 PolarHBondContact O-N 3.24Å; W65-H67 VanDerWaalsContact C-N 3.25Å; W65-H67 PolarHBondContact O-N 3.22Å
66	N	90.7	Very high	91.4	Very high	91 Å²	91	82.1 Å²	82.1	49%	0.487	41%	0.407	S	S	.	.	H	α-helix	trans	-71.5	-21.4	176.7	-67.4	-11.7	0	0	0	112.8	T62 S63 L64 P68	T62-N66 PolarHBondContact O-N 3.1Å; S63-N66 WeakPolarHBondContact O-CB 3.4Å; S63-N66 PolarHBondContact O-N 3.28Å; S63-N66 VanDerWaalsContact O-N 3.08Å; L64-N66 VanDerWaalsContact C-N 3.34Å; N66-P68 WeakPolarHBondContact O-CD 3.41Å
67	H	92.2	Very high	92	Very high	34 Å²	34	75.5 Å²	75.5	16%	0.157	38%	0.377	C	S	.	.			trans	-116.2	66	-177.6	-70.9	-84.6	0	0	0	112.1	W49 D52 S63 L64 W65 F69 F70 T71	W49-H67 AromaticContact CD1-CD2 3.32Å; W49-H67 AromaticContact CD1-CG 3.5Å; W49-H67 VanDerWaalsContact CD1-CG 3.5Å; W49-H67 AromaticContact CD1-NE2 3.82Å; W49-H67 AromaticContact NE1-CD2 3.95Å; D52-H67 IonicContact OD2-CD2 3.16Å; D52-H67 IonicContact OD2-CE1 2.71Å; D52-H67 PolarHBondContact OD2-CE1 2.94Å; D52-H67 IonicContact OD2-NE2 2.68Å; D52-H67 PolarHBondContact OD2-NE2 2.94Å; S63-H67 PolarHBondContact O-CD2 2.91Å; S63-H67 VanDerWaalsContact O-CD2 3.32Å; S63-H67 PolarHBondContact O-N 3Å; S63-H67 VanDerWaalsContact O-N 3.15Å; L64-H67 CarbonylContact O-C 3.44Å; L64-H67 PolarHBondContact O-N 2.9Å; W65-H67 VanDerWaalsContact C-N 3.25Å; W65-H67 PolarHBondContact O-N 3.22Å; H67-F69 VanDerWaalsContact C-N 3.28Å; H67-F69 PolarHBondContact O-N 3.26Å; H67-F70 HydrophobicContact CB-CB 4.35Å; H67-F70 PolarHBondContact O-N 3.5Å; H67-T71 PolarHBondContact O-N 3.04Å; H67-T71 PolarHBondContact O-OG1 3.02Å
68	P	91.6	Very high	92.3	Very high	76 Å²	76	73 Å²	73	49%	0.494	37%	0.37	S	S	.	.	H	α-helix	trans	-62.1	-32.5	-172.1	24.4	-34.8	0	0	0	113.3	N66 T71 I72	N66-P68 WeakPolarHBondContact O-CD 3.41Å; P68-T71 PolarHBondContact O-N 3.11Å; P68-I72 WeakPolarHBondContact O-CB 3.43Å; P68-I72 WeakPolarHBondContact O-CG1 3.12Å; P68-I72 PolarHBondContact O-N 3.39Å
69	F	91.5	Very high	92.5	Very high	119 Å²	119	72.6 Å²	72.6	52%	0.522	38%	0.375	S	S	.	.	H	α-helix	trans	-63.2	-44.4	178.1	-177.2	-98.3	0	0	0	112.3	C41 H67 S73	C41-F69 HydrophobicContact CB-CE1 4.23Å; C41-F69 HydrophobicContact CB-CZ 3.88Å; C41-F69 WeakPolarHBondContact O-CE1 3.29Å; H67-F69 VanDerWaalsContact C-N 3.28Å; H67-F69 PolarHBondContact O-N 3.26Å; F69-S73 WeakPolarHBondContact O-CB 3.44Å; F69-S73 PolarHBondContact O-N 3.3Å; F69-S73 PolarHBondContact O-OG 2.77Å
70	F	92.9	Very high	92.7	Very high	25 Å²	25	70.6 Å²	70.6	11%	0.11	36%	0.359	C	S	.	.	H	α-helix	trans	-67.3	-44.8	175.4	174.8	-118.6	0	0	0	111	T42 A46 W49 L64 H67 I72 S73 C74	T42-F70 HydrophobicContact CG2-CE2 4.09Å; A46-F70 HydrophobicContact CB-CD2 4.06Å; A46-F70 HydrophobicContact CB-CE2 3.63Å; A46-F70 HydrophobicContact CB-CZ 4.34Å; W49-F70 HydrophobicContact CB-CD1 4.3Å; W49-F70 HydrophobicContact CB-CG 4.43Å; W49-F70 HydrophobicContact CD2-CD1 4Å; W49-F70 AromaticContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CE3-CD1 4.26Å; W49-F70 AromaticContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CZ 4.09Å; W49-F70 HydrophobicContact CG-CD1 4.01Å; W49-F70 HydrophobicContact CG-CE1 4.33Å; W49-F70 HydrophobicContact CZ3-CE1 4.16Å; W49-F70 HydrophobicContact CZ3-CZ 4.49Å; L64-F70 HydrophobicContact CD2-CD1 4.05Å; L64-F70 HydrophobicContact CD2-CE1 3.92Å; H67-F70 HydrophobicContact CB-CB 4.35Å; H67-F70 PolarHBondContact O-N 3.5Å; F70-I72 PolarHBondContact O-N 3.28Å; F70-S73 WeakPolarHBondContact CA-OG 3.44Å; F70-S73 PolarHBondContact O-N 3.46Å; F70-S73 PolarHBondContact O-OG 3.14Å; F70-C74 WeakPolarHBondContact CE2-SG 3.39Å; F70-C74 WeakPolarHBondContact CZ-SG 3.33Å; F70-C74 WeakPolarHBondContact O-CB 3.35Å; F70-C74 PolarHBondContact O-N 2.99Å; F70-C74 PolarHBondContact O-SG 2.84Å
71	T	93.6	Very high	92.9	Very high	30 Å²	30	70.8 Å²	70.8	18%	0.184	36%	0.36	C	S	.	.	H	α-helix	trans	-63.4	-45.2	-178.8	-61.4	0	0	0	0	112.4	L64 H67 P68 C74 I75	L64-T71 PolarHBondContact O-OG1 3.06Å; H67-T71 PolarHBondContact O-N 3.04Å; H67-T71 PolarHBondContact O-OG1 3.02Å; P68-T71 PolarHBondContact O-N 3.11Å; T71-C74 PolarHBondContact O-N 3.3Å; T71-I75 HydrophobicContact CG2-CD1 3.86Å; T71-I75 VanDerWaalsContact O-CG1 3.27Å; T71-I75 WeakPolarHBondContact O-CG1 3.19Å; T71-I75 PolarHBondContact O-N 3.38Å
72	I	94.9	Very high	93.1	Very high	107 Å²	107	71.9 Å²	71.9	55%	0.549	37%	0.365	S	S	.	.	H	α-helix	trans	-65.2	-41.1	178.4	-67.2	167	0	0	0	111.3	P68 F70 I75 T76	P68-I72 WeakPolarHBondContact O-CB 3.43Å; P68-I72 WeakPolarHBondContact O-CG1 3.12Å; P68-I72 PolarHBondContact O-N 3.39Å; F70-I72 PolarHBondContact O-N 3.28Å; I72-I75 PolarHBondContact O-N 3.01Å; I72-T76 WeakPolarHBondContact O-CB 3.47Å; I72-T76 PolarHBondContact O-N 2.82Å; I72-T76 PolarHBondContact O-OG1 3.05Å
73	S	94.8	Very high	93.2	Very high	9 Å²	9	71.3 Å²	71.3	6%	0.063	37%	0.367	C	S	.	.	H	α-helix	trans	-66	-41.7	178	52.6	0	0	0	0	111.8	F69 F70 T76 L77	F69-S73 WeakPolarHBondContact O-CB 3.44Å; F69-S73 PolarHBondContact O-N 3.3Å; F69-S73 PolarHBondContact O-OG 2.77Å; F70-S73 WeakPolarHBondContact CA-OG 3.44Å; F70-S73 PolarHBondContact O-N 3.46Å; F70-S73 PolarHBondContact O-OG 3.14Å; S73-T76 PolarHBondContact O-N 3.42Å; S73-L77 WeakPolarHBondContact O-CB 3.44Å; S73-L77 PolarHBondContact O-N 3.1Å
74	C	95	Very high	93.2	Very high	31 Å²	31	72.5 Å²	72.5	21%	0.209	38%	0.379	C	S	.	.	H	α-helix	trans	-59.2	-49	171.3	-78.8	0	0	0	0	112.8	F70 T71 T76 L77 I78	F70-C74 WeakPolarHBondContact CE2-SG 3.39Å; F70-C74 WeakPolarHBondContact CZ-SG 3.33Å; F70-C74 WeakPolarHBondContact O-CB 3.35Å; F70-C74 PolarHBondContact O-N 2.99Å; F70-C74 PolarHBondContact O-SG 2.84Å; T71-C74 PolarHBondContact O-N 3.3Å; C74-T76 VanDerWaalsContact C-N 3.31Å; C74-T76 PolarHBondContact O-N 2.93Å; C74-L77 PolarHBondContact O-N 3.31Å; C74-I78 VanDerWaalsContact O-CG1 3.28Å; C74-I78 WeakPolarHBondContact O-CG1 3.5Å; C74-I78 PolarHBondContact O-N 3.43Å
75	I	95.5	Very high	93.3	Very high	110 Å²	110	71 Å²	71	56%	0.564	37%	0.371	S	S	*	.	H	α-helix	trans	-61	-43	178	-70.1	168.5	0	0	0	110.5	T71 I72 L77 I78 G79	T71-I75 HydrophobicContact CG2-CD1 3.86Å; T71-I75 VanDerWaalsContact O-CG1 3.27Å; T71-I75 WeakPolarHBondContact O-CG1 3.19Å; T71-I75 PolarHBondContact O-N 3.38Å; I72-I75 PolarHBondContact O-N 3.01Å; I75-L77 PolarHBondContact O-N 2.96Å; I75-I78 PolarHBondContact O-N 3.34Å; I75-G79 PolarHBondContact O-N 3.23Å
76	T	94.9	Very high	93.3	Very high	60 Å²	60	66 Å²	66	37%	0.368	36%	0.357	S	S	.	.	H	α-helix	trans	-61	-46.3	176.8	-57.5	0	0	0	0	110.6	V38 I72 S73 C74 I78 G79 L80	V38-T76 HydrophobicContact CG1-CG2 4.28Å; V38-T76 HydrophobicContact CG2-CG2 3.91Å; I72-T76 WeakPolarHBondContact O-CB 3.47Å; I72-T76 PolarHBondContact O-N 2.82Å; I72-T76 PolarHBondContact O-OG1 3.05Å; S73-T76 PolarHBondContact O-N 3.42Å; C74-T76 VanDerWaalsContact C-N 3.31Å; C74-T76 PolarHBondContact O-N 2.93Å; T76-I78 PolarHBondContact O-N 2.9Å; T76-G79 PolarHBondContact O-N 2.88Å; T76-L80 HydrophobicContact CG2-CD1 4.34Å; T76-L80 HydrophobicContact CG2-CG 4.48Å; T76-L80 VanDerWaalsContact O-CG 3.29Å; T76-L80 WeakPolarHBondContact O-CG 3.45Å; T76-L80 PolarHBondContact O-N 3.32Å
77	L	94.9	Very high	93.3	Very high	37 Å²	37	69 Å²	69	19%	0.194	37%	0.365	C	S	.	.	H	α-helix	trans	-59.9	-47.3	178.1	-174	63.7	0	0	0	111.5	L35 V38 S73 C74 I75 G79 L80 F81	L35-L77 HydrophobicContact CD1-CD1 3.91Å; V38-L77 HydrophobicContact CG1-CB 3.84Å; V38-L77 HydrophobicContact CG1-CD1 4.13Å; S73-L77 WeakPolarHBondContact O-CB 3.44Å; S73-L77 PolarHBondContact O-N 3.1Å; C74-L77 PolarHBondContact O-N 3.31Å; I75-L77 PolarHBondContact O-N 2.96Å; L77-G79 PolarHBondContact O-N 2.97Å; L77-L80 PolarHBondContact O-N 2.94Å; L77-F81 HydrophobicContact CD1-CD2 4.35Å; L77-F81 HydrophobicContact CD1-CE2 3.86Å; L77-F81 HydrophobicContact CD2-CE2 4.28Å; L77-F81 HydrophobicContact CG-CD2 4.07Å; L77-F81 HydrophobicContact CG-CE2 3.74Å; L77-F81 WeakPolarHBondContact O-CD2 3.3Å; L77-F81 PolarHBondContact O-N 2.9Å
78	I	95.3	Very high	93.3	Very high	92 Å²	92	73.4 Å²	73.4	47%	0.472	38%	0.381	S	S	.	.	H	α-helix	trans	-59.5	-46.6	176	-68.3	166.5	0	0	0	110.5	C74 I75 T76 L80 F81 F82	C74-I78 VanDerWaalsContact O-CG1 3.28Å; C74-I78 WeakPolarHBondContact O-CG1 3.5Å; C74-I78 PolarHBondContact O-N 3.43Å; I75-I78 PolarHBondContact O-N 3.34Å; T76-I78 PolarHBondContact O-N 2.9Å; I78-L80 VanDerWaalsContact C-N 3.33Å; I78-L80 PolarHBondContact O-N 2.92Å; I78-F81 WeakPolarHBondContact O-CB 3.5Å; I78-F81 PolarHBondContact O-N 3.39Å; I78-F81 VanDerWaalsContact O-N 3.14Å; I78-F82 HydrophobicContact CG2-CD2 3.72Å; I78-F82 HydrophobicContact CG2-CE2 3.57Å; I78-F82 VanDerWaalsContact O-CD2 3.29Å; I78-F82 WeakPolarHBondContact O-CD2 3.29Å; I78-F82 PolarHBondContact O-N 3.48Å
79	G	95.3	Very high	93.3	Very high	39 Å²	39	70.5 Å²	70.5	40%	0.402	36%	0.361	S	S	.	.	H	α-helix	trans	-58.8	-41.9	176.4	0	0	0	0	0	112.8	I75 T76 L77 F81 F82 A83	I75-G79 PolarHBondContact O-N 3.23Å; T76-G79 PolarHBondContact O-N 2.88Å; L77-G79 PolarHBondContact O-N 2.97Å; G79-F81 VanDerWaalsContact C-N 3.34Å; G79-F81 PolarHBondContact O-N 3.12Å; G79-F82 PolarHBondContact O-N 3.4Å; G79-A83 WeakPolarHBondContact O-CB 3.36Å; G79-A83 PolarHBondContact O-N 2.88Å
80	L	93.9	Very high	93.3	Very high	26 Å²	26	66.3 Å²	66.3	14%	0.136	35%	0.345	C	S	.	.	H	α-helix	trans	-63.2	-39.3	175.2	-69.8	176.8	0	0	0	112	W31 V38 T76 L77 I78 A83 G84 I85	W31-L80 HydrophobicContact CE3-CD2 4.49Å; W31-L80 HydrophobicContact CZ3-CD2 3.84Å; V38-L80 HydrophobicContact CB-CD1 4.47Å; V38-L80 HydrophobicContact CG2-CD1 4.14Å; T76-L80 HydrophobicContact CG2-CD1 4.34Å; T76-L80 HydrophobicContact CG2-CG 4.48Å; T76-L80 VanDerWaalsContact O-CG 3.29Å; T76-L80 WeakPolarHBondContact O-CG 3.45Å; T76-L80 PolarHBondContact O-N 3.32Å; L77-L80 PolarHBondContact O-N 2.94Å; I78-L80 VanDerWaalsContact C-N 3.33Å; I78-L80 PolarHBondContact O-N 2.92Å; L80-A83 PolarHBondContact O-N 3.4Å; L80-G84 PolarHBondContact O-N 3.39Å; L80-I85 HydrophobicContact CB-CB 4.32Å; L80-I85 HydrophobicContact CB-CD1 4.12Å; L80-I85 HydrophobicContact CB-CG2 4.13Å; L80-I85 HydrophobicContact CD1-CD1 4.12Å; L80-I85 HydrophobicContact CD2-CD1 4.2Å; L80-I85 HydrophobicContact CG-CD1 4.38Å; L80-I85 VanDerWaalsContact O-CB 3.25Å; L80-I85 WeakPolarHBondContact O-CB 3.49Å; L80-I85 WeakPolarHBondContact O-CG2 3.32Å; L80-I85 PolarHBondContact O-N 3.47Å; L80-I85 VanDerWaalsContact O-N 3.1Å
81	F	92.8	Very high	93.1	Very high	125 Å²	125	66.6 Å²	66.6	55%	0.548	35%	0.352	S	S	.	.	H	α-helix	trans	-60.7	-48.7	174.3	-84	-68.2	0	0	0	111.8	L77 I78 G79 A83 G84	L77-F81 HydrophobicContact CD1-CD2 4.35Å; L77-F81 HydrophobicContact CD1-CE2 3.86Å; L77-F81 HydrophobicContact CD2-CE2 4.28Å; L77-F81 HydrophobicContact CG-CD2 4.07Å; L77-F81 HydrophobicContact CG-CE2 3.74Å; L77-F81 WeakPolarHBondContact O-CD2 3.3Å; L77-F81 PolarHBondContact O-N 2.9Å; I78-F81 WeakPolarHBondContact O-CB 3.5Å; I78-F81 PolarHBondContact O-N 3.39Å; I78-F81 VanDerWaalsContact O-N 3.14Å; G79-F81 VanDerWaalsContact C-N 3.34Å; G79-F81 PolarHBondContact O-N 3.12Å; F81-A83 VanDerWaalsContact C-N 3.33Å; F81-A83 PolarHBondContact O-N 3.37Å; F81-G84 PolarHBondContact O-N 2.88Å
82	F	93.6	Very high	92.9	Very high	179 Å²	179	65.9 Å²	65.9	79%	0.785	35%	0.348	S	S	*	.	H	α-helix	trans	-65.3	-33.8	177	-78.2	-70.3	0	0	0	113.1	I78 G79 G84	I78-F82 HydrophobicContact CG2-CD2 3.72Å; I78-F82 HydrophobicContact CG2-CE2 3.57Å; I78-F82 VanDerWaalsContact O-CD2 3.29Å; I78-F82 WeakPolarHBondContact O-CD2 3.29Å; I78-F82 PolarHBondContact O-N 3.48Å; G79-F82 PolarHBondContact O-N 3.4Å; F82-G84 PolarHBondContact O-N 2.85Å
83	A	92.5	Very high	92.6	Very high	54 Å²	54	63 Å²	63	45%	0.446	34%	0.338	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.3	1.7	173	0	0	0	0	0	113.8	G79 L80 F81	G79-A83 WeakPolarHBondContact O-CB 3.36Å; G79-A83 PolarHBondContact O-N 2.88Å; L80-A83 PolarHBondContact O-N 3.4Å; F81-A83 VanDerWaalsContact C-N 3.33Å; F81-A83 PolarHBondContact O-N 3.37Å
84	G	91.2	Very high	92.5	Very high	25 Å²	25	65.8 Å²	65.8	26%	0.258	35%	0.352	S	S	.	.	T	Hydrogen-bonded Turn	trans	73.1	30.1	176.2	0	0	0	0	0	112.9	L80 F81 F82 H86 K87 R88	L80-G84 PolarHBondContact O-N 3.39Å; F81-G84 PolarHBondContact O-N 2.88Å; F82-G84 PolarHBondContact O-N 2.85Å; G84-H86 PolarHBondContact O-N 2.84Å; G84-H86 VanDerWaalsContact O-N 3.1Å; G84-K87 PolarHBondContact O-N 3.05Å; G84-R88 PolarHBondContact O-N 2.94Å
85	I	92.5	Very high	92.3	Very high	3 Å²	3	66.1 Å²	66.1	2%	0.015	35%	0.351	C	S	.	.	H	α-helix	trans	-52.5	-36.5	-179.1	-167.2	167.2	0	0	0	111.9	W31 L35 L80 K87 R88 V89	W31-I85 HydrophobicContact CB-CD1 4.47Å; W31-I85 HydrophobicContact CB-CG1 4.29Å; W31-I85 HydrophobicContact CD2-CG1 4.4Å; W31-I85 HydrophobicContact CE3-CD1 3.72Å; W31-I85 HydrophobicContact CE3-CG1 3.9Å; W31-I85 HydrophobicContact CZ3-CD1 4.43Å; L35-I85 HydrophobicContact CB-CD1 4.04Å; L35-I85 HydrophobicContact CD1-CD1 4.26Å; L80-I85 HydrophobicContact CB-CB 4.32Å; L80-I85 HydrophobicContact CB-CD1 4.12Å; L80-I85 HydrophobicContact CB-CG2 4.13Å; L80-I85 HydrophobicContact CD1-CD1 4.12Å; L80-I85 HydrophobicContact CD2-CD1 4.2Å; L80-I85 HydrophobicContact CG-CD1 4.38Å; L80-I85 VanDerWaalsContact O-CB 3.25Å; L80-I85 WeakPolarHBondContact O-CB 3.49Å; L80-I85 WeakPolarHBondContact O-CG2 3.32Å; L80-I85 PolarHBondContact O-N 3.47Å; L80-I85 VanDerWaalsContact O-N 3.1Å; I85-K87 VanDerWaalsContact C-N 3.35Å; I85-K87 PolarHBondContact O-N 3.35Å; I85-R88 WeakPolarHBondContact O-CA 3.3Å; I85-R88 WeakPolarHBondContact O-CB 3.4Å; I85-R88 PolarHBondContact O-N 3.17Å; I85-V89 HydrophobicContact CG1-CG1 4.01Å; I85-V89 WeakPolarHBondContact O-CG2 3.3Å; I85-V89 PolarHBondContact O-N 3.4Å
86	H	90.7	Very high	92.1	Very high	115 Å²	115	60.9 Å²	60.9	53%	0.532	32%	0.324	S	S	.	.	H	α-helix	trans	-53	-52.8	177.6	-173.5	-92.8	0	0	0	110.8	G84 R88 V89 V90	G84-H86 PolarHBondContact O-N 2.84Å; G84-H86 VanDerWaalsContact O-N 3.1Å; H86-R88 VanDerWaalsContact C-N 3.26Å; H86-R88 PolarHBondContact O-N 3Å; H86-V89 VanDerWaalsContact O-CG2 3.29Å; H86-V89 WeakPolarHBondContact O-CG2 3.4Å; H86-V89 PolarHBondContact O-N 3.35Å; H86-V90 VanDerWaalsContact O-CG2 3.28Å; H86-V90 WeakPolarHBondContact O-CG2 3.41Å; H86-V90 PolarHBondContact O-N 2.91Å; H86-V90 VanDerWaalsContact O-N 3.11Å
87	K	90.4	Very high	92.1	Very high	153 Å²	153	60.2 Å²	60.2	67%	0.665	33%	0.325	S	S	*	.	H	α-helix	trans	-59.2	-37.5	178.1	-61.6	-66.8	-175	179	0	111.8	G84 I85 A91	G84-K87 PolarHBondContact O-N 3.05Å; I85-K87 VanDerWaalsContact C-N 3.35Å; I85-K87 PolarHBondContact O-N 3.35Å; K87-A91 VanDerWaalsContact O-CB 3.3Å; K87-A91 WeakPolarHBondContact O-CB 3.31Å; K87-A91 PolarHBondContact O-N 3.26Å
88	R	90.9	Very high	92	Very high	126 Å²	126	67 Å²	67	48%	0.475	35%	0.348	S	S	.	.	H	α-helix	trans	-69.8	-37.6	179.9	-59.6	-179.6	-177.1	-84.3	2.5	112.9	T28 W31 G84 I85 H86	T28-R88 PolarHBondContact OG1-O 3.49Å; W31-R88 HydrophobicContact CG-CB 4.21Å; G84-R88 PolarHBondContact O-N 2.94Å; I85-R88 WeakPolarHBondContact O-CA 3.3Å; I85-R88 WeakPolarHBondContact O-CB 3.4Å; I85-R88 PolarHBondContact O-N 3.17Å; H86-R88 VanDerWaalsContact C-N 3.26Å; H86-R88 PolarHBondContact O-N 3Å
89	V	92.4	Very high	92	Very high	15 Å²	15	63.9 Å²	63.9	9%	0.091	33%	0.333	C	S	.	.	H	α-helix	trans	-81.5	-24.1	-178.7	-61.2	0	0	0	0	113.7	T28 W31 R32 I85 H86	T28-V89 WeakPolarHBondContact CG2-O 3.5Å; W31-V89 HydrophobicContact CB-CG1 3.61Å; R32-V89 HydrophobicContact CG-CB 4.08Å; R32-V89 HydrophobicContact CG-CG1 3.93Å; R32-V89 PolarHBondContact NH2-O 3.45Å; I85-V89 HydrophobicContact CG1-CG1 4.01Å; I85-V89 WeakPolarHBondContact O-CG2 3.3Å; I85-V89 PolarHBondContact O-N 3.4Å; H86-V89 VanDerWaalsContact O-CG2 3.29Å; H86-V89 WeakPolarHBondContact O-CG2 3.4Å; H86-V89 PolarHBondContact O-N 3.35Å
90	V	91	Very high	91.9	Very high	31 Å²	31	65.3 Å²	65.3	19%	0.188	33%	0.327	C	S	.	.	H	α-helix	trans	-99.3	-9.6	178.4	-52.5	0	0	0	0	114.3	H86 S93 I94	H86-V90 VanDerWaalsContact O-CG2 3.28Å; H86-V90 WeakPolarHBondContact O-CG2 3.41Å; H86-V90 PolarHBondContact O-N 2.91Å; H86-V90 VanDerWaalsContact O-N 3.11Å; V90-S93 PolarHBondContact O-N 2.71Å; V90-S93 PolarHBondContact O-OG 3.45Å; V90-I94 HydrophobicContact CB-CD1 4.23Å; V90-I94 HydrophobicContact CB-CG1 4.43Å; V90-I94 HydrophobicContact CG2-CD1 3.45Å; V90-I94 VanDerWaalsContact CG2-CD1 3.45Å; V90-I94 HydrophobicContact CG2-CG1 4.17Å; V90-I94 WeakPolarHBondContact O-CG1 3.48Å; V90-I94 PolarHBondContact O-N 2.86Å
91	A	89.6	Confident	92	Very high	31 Å²	31	68.8 Å²	68.8	26%	0.256	35%	0.349	S	S	.	.	H	α-helix	trans	-53.3	-49.7	-177.3	0	0	0	0	0	113.4	K87 S93 I94 I95	K87-A91 VanDerWaalsContact O-CB 3.3Å; K87-A91 WeakPolarHBondContact O-CB 3.31Å; K87-A91 PolarHBondContact O-N 3.26Å; A91-S93 PolarHBondContact O-N 3.31Å; A91-I94 PolarHBondContact O-N 3.38Å; A91-I95 WeakPolarHBondContact O-CD1 3.37Å; A91-I95 WeakPolarHBondContact O-CG1 3.41Å; A91-I95 PolarHBondContact O-N 2.84Å; A91-I95 VanDerWaalsContact O-N 3.1Å
92	P	88.7	Confident	92	Very high	15 Å²	15	67 Å²	67	10%	0.097	35%	0.349	C	S	.	.	H	α-helix	trans	-61.5	-41.5	179.9	-21.4	32.6	0	0	0	112.9	L24 T28 I95 A96	L24-P92 HydrophobicContact CB-CG 4.06Å; T28-P92 HydrophobicContact CG2-CG 3.94Å; T28-P92 WeakPolarHBondContact OG1-CD 3.42Å; T28-P92 WeakPolarHBondContact OG1-CG 3.29Å; P92-I95 PolarHBondContact O-N 3.44Å; P92-A96 WeakPolarHBondContact O-CB 3.35Å; P92-A96 PolarHBondContact O-N 2.87Å
93	S	89.2	Confident	91.9	Very high	48 Å²	48	59 Å²	59	34%	0.336	31%	0.314	S	S	.	.	H	α-helix	trans	-70.2	-34.3	-178.8	56.8	0	0	0	0	112.2	V90 A91 A97	V90-S93 PolarHBondContact O-N 2.71Å; V90-S93 PolarHBondContact O-OG 3.45Å; A91-S93 PolarHBondContact O-N 3.31Å; S93-A97 WeakPolarHBondContact O-CB 3.08Å; S93-A97 PolarHBondContact O-N 2.8Å
94	I	92	Very high	91.9	Very high	67 Å²	67	58.7 Å²	58.7	34%	0.344	31%	0.311	S	S	.	.	H	α-helix	trans	-64	-44.6	173.4	-69.5	173.5	0	0	0	110.6	V90 A91 A97 R98	V90-I94 HydrophobicContact CB-CD1 4.23Å; V90-I94 HydrophobicContact CB-CG1 4.43Å; V90-I94 HydrophobicContact CG2-CD1 3.45Å; V90-I94 VanDerWaalsContact CG2-CD1 3.45Å; V90-I94 HydrophobicContact CG2-CG1 4.17Å; V90-I94 WeakPolarHBondContact O-CG1 3.48Å; V90-I94 PolarHBondContact O-N 2.86Å; A91-I94 PolarHBondContact O-N 3.38Å; I94-A97 PolarHBondContact O-N 3.37Å; I94-R98 VanDerWaalsContact O-CG 3.3Å; I94-R98 WeakPolarHBondContact O-CG 3.48Å; I94-R98 PolarHBondContact O-N 2.84Å
95	I	91.5	Very high	91.9	Very high	37 Å²	37	64.6 Å²	64.6	19%	0.19	33%	0.332	C	S	.	.	H	α-helix	trans	-63.3	-51.2	179.2	-66.8	153.3	0	0	0	110.1	L17 Y20 L24 A91 P92 A97 R98 C99	L17-I95 HydrophobicContact CD1-CG2 4.49Å; Y20-I95 HydrophobicContact CD1-CD1 4.25Å; Y20-I95 HydrophobicContact CD1-CG2 4.29Å; Y20-I95 HydrophobicContact CE1-CD1 3.48Å; Y20-I95 VanDerWaalsContact CE1-CD1 3.48Å; Y20-I95 HydrophobicContact CE1-CG1 4.29Å; Y20-I95 HydrophobicContact CE1-CG2 4.27Å; L24-I95 HydrophobicContact CD1-CD1 3.44Å; L24-I95 VanDerWaalsContact CD1-CD1 3.44Å; A91-I95 WeakPolarHBondContact O-CD1 3.37Å; A91-I95 WeakPolarHBondContact O-CG1 3.41Å; A91-I95 PolarHBondContact O-N 2.84Å; A91-I95 VanDerWaalsContact O-N 3.1Å; P92-I95 PolarHBondContact O-N 3.44Å; I95-A97 VanDerWaalsContact C-N 3.31Å; I95-A97 PolarHBondContact O-N 2.76Å; I95-R98 PolarHBondContact O-N 3.26Å; I95-C99 PolarHBondContact O-N 3.24Å; I95-C99 PolarHBondContact O-SG 2.91Å; I95-C99 VanDerWaalsContact O-SG 3.4Å
96	A	91.6	Very high	91.7	Very high	1 Å²	1	71.5 Å²	71.5	1%	0.008	36%	0.359	C	S	.	.	H	α-helix	trans	-58.3	-42.6	178	0	0	0	0	0	111.8	P92 R98 C99 R100	P92-A96 WeakPolarHBondContact O-CB 3.35Å; P92-A96 PolarHBondContact O-N 2.87Å; A96-R98 PolarHBondContact O-N 3.26Å; A96-C99 PolarHBondContact O-N 3.05Å; A96-R100 VanDerWaalsContact O-CG 3.3Å; A96-R100 WeakPolarHBondContact O-CG 3.4Å; A96-R100 PolarHBondContact O-N 2.69Å
97	A	93.8	Very high	91.7	Very high	46 Å²	46	69.1 Å²	69.1	38%	0.38	35%	0.35	S	S	.	.	H	α-helix	trans	-61.8	-43.8	176.5	0	0	0	0	0	112.6	S93 I94 I95 R100 T101	S93-A97 WeakPolarHBondContact O-CB 3.08Å; S93-A97 PolarHBondContact O-N 2.8Å; I94-A97 PolarHBondContact O-N 3.37Å; I95-A97 VanDerWaalsContact C-N 3.31Å; I95-A97 PolarHBondContact O-N 2.76Å; A97-R100 WeakPolarHBondContact O-CB 3.35Å; A97-R100 PolarHBondContact O-N 2.97Å; A97-T101 PolarHBondContact O-N 2.85Å; A97-T101 PolarHBondContact O-OG1 3.26Å
98	R	94.1	Very high	91.8	Very high	180 Å²	180	62.8 Å²	62.8	68%	0.679	32%	0.323	S	S	*	.	H	α-helix	trans	-63.5	-42.6	176.4	-72.1	174.5	-179.5	-164.7	-0.9	111.9	I94 I95 A96 R100 T101 V102	I94-R98 VanDerWaalsContact O-CG 3.3Å; I94-R98 WeakPolarHBondContact O-CG 3.48Å; I94-R98 PolarHBondContact O-N 2.84Å; I95-R98 PolarHBondContact O-N 3.26Å; A96-R98 PolarHBondContact O-N 3.26Å; R98-R100 VanDerWaalsContact C-N 3.32Å; R98-R100 PolarHBondContact O-N 3.2Å; R98-T101 WeakPolarHBondContact O-CB 3.17Å; R98-T101 PolarHBondContact O-N 2.9Å; R98-V102 PolarHBondContact O-N 2.74Å
99	C	93.9	Very high	92	Very high	25 Å²	25	57.8 Å²	57.8	17%	0.169	31%	0.307	C	S	.	.	H	α-helix	trans	-59.8	-43.9	174	-69.2	0	0	0	0	111	L17 I95 A96 T101 V102 L103	L17-C99 HydrophobicContact CD2-CB 4.37Å; I95-C99 PolarHBondContact O-N 3.24Å; I95-C99 PolarHBondContact O-SG 2.91Å; I95-C99 VanDerWaalsContact O-SG 3.4Å; A96-C99 PolarHBondContact O-N 3.05Å; C99-T101 VanDerWaalsContact C-N 3.31Å; C99-T101 PolarHBondContact O-N 3.03Å; C99-V102 PolarHBondContact O-N 2.93Å; C99-L103 HydrophobicContact CB-CD1 4.5Å; C99-L103 VanDerWaalsContact O-CB 3.3Å; C99-L103 WeakPolarHBondContact O-CB 3.27Å; C99-L103 WeakPolarHBondContact O-CG 3.48Å; C99-L103 PolarHBondContact O-N 2.95Å
100	R	94.1	Very high	92	Very high	69 Å²	69	57.1 Å²	57.1	26%	0.26	30%	0.304	S	S	.	.	H	α-helix	trans	-59.9	-38.7	175.8	-71.2	174.5	-166.9	125.2	8.8	113	A96 A97 R98 L103 A104 C110 D111 D112	A96-R100 VanDerWaalsContact O-CG 3.3Å; A96-R100 WeakPolarHBondContact O-CG 3.4Å; A96-R100 PolarHBondContact O-N 2.69Å; A97-R100 WeakPolarHBondContact O-CB 3.35Å; A97-R100 PolarHBondContact O-N 2.97Å; R98-R100 VanDerWaalsContact C-N 3.32Å; R98-R100 PolarHBondContact O-N 3.2Å; R100-L103 PolarHBondContact O-N 3.44Å; R100-A104 VanDerWaalsContact O-CB 3.27Å; R100-A104 WeakPolarHBondContact O-CB 3.46Å; R100-A104 PolarHBondContact O-N 3.37Å; R100-C110 PolarHBondContact NE-O 3.48Å; R100-C110 PolarHBondContact NH2-O 3.25Å; R100-D111 PolarHBondContact NH2-O 3.46Å; R100-D112 IonicContact CZ-OD1 3.54Å; R100-D112 IonicContact NH1-OD1 3.45Å; R100-D112 PolarHBondContact NH1-OD1 3.16Å; R100-D112 IonicContact NH2-OD1 2.71Å; R100-D112 PolarHBondContact NH2-OD1 2.91Å
101	T	94.6	Very high	92.1	Very high	100 Å²	100	57.9 Å²	57.9	61%	0.613	31%	0.307	S	S	*	.	H	α-helix	trans	-59.9	-48.1	176.7	-57.3	0	0	0	0	111.2	A97 R98 C99 A104	A97-T101 PolarHBondContact O-N 2.85Å; A97-T101 PolarHBondContact O-OG1 3.26Å; R98-T101 WeakPolarHBondContact O-CB 3.17Å; R98-T101 PolarHBondContact O-N 2.9Å; C99-T101 VanDerWaalsContact C-N 3.31Å; C99-T101 PolarHBondContact O-N 3.03Å; T101-A104 PolarHBondContact O-N 3.45Å
102	V	93.2	Very high	92.1	Very high	88 Å²	88	61.3 Å²	61.3	53%	0.533	32%	0.321	S	S	.	.	H	α-helix	trans	-68.3	-43.1	178.6	178.9	0	0	0	0	111.3	R98 C99 A104 E105 Y106	R98-V102 PolarHBondContact O-N 2.74Å; C99-V102 PolarHBondContact O-N 2.93Å; V102-A104 VanDerWaalsContact C-N 3.26Å; V102-A104 PolarHBondContact O-N 3.28Å; V102-E105 PolarHBondContact O-N 3.32Å; V102-Y106 WeakPolarHBondContact O-CD2 3.3Å
103	L	92.7	Very high	92.1	Very high	11 Å²	11	63.9 Å²	63.9	6%	0.058	34%	0.336	C	S	.	.	H	α-helix	trans	-66.2	-27.4	179.7	-70.9	172.4	0	0	0	113.1	F13 C99 R100 E105 Y106 M108 C110 L116	F13-L103 HydrophobicContact CE1-CD1 4.42Å; F13-L103 HydrophobicContact CE1-CD2 4.21Å; C99-L103 HydrophobicContact CB-CD1 4.5Å; C99-L103 VanDerWaalsContact O-CB 3.3Å; C99-L103 WeakPolarHBondContact O-CB 3.27Å; C99-L103 WeakPolarHBondContact O-CG 3.48Å; C99-L103 PolarHBondContact O-N 2.95Å; R100-L103 PolarHBondContact O-N 3.44Å; L103-E105 PolarHBondContact O-N 3.36Å; L103-Y106 PolarHBondContact O-N 3.31Å; L103-M108 CarbonylContact C-O 3.59Å; L103-M108 VanDerWaalsContact C-O 3.24Å; L103-M108 HydrophobicContact CB-CB 3.99Å; L103-M108 HydrophobicContact CD2-CB 4.18Å; L103-M108 HydrophobicContact CD2-CE 3.96Å; L103-M108 CarbonylContact O-C 3.24Å; L103-M108 WeakPolarHBondContact O-CA 3.24Å; L103-M108 PolarHBondContact O-N 3.03Å; L103-M108 VanDerWaalsContact O-O 3.12Å; L103-C110 HydrophobicContact CD1-CB 3.98Å; L103-L116 HydrophobicContact CD1-CD1 3.42Å; L103-L116 VanDerWaalsContact CD1-CD1 3.42Å; L103-L116 HydrophobicContact CD2-CD1 3.74Å; L103-L116 HydrophobicContact CG-CD1 4.2Å
104	A	91.8	Very high	92.2	Very high	47 Å²	47	61.6 Å²	61.6	39%	0.388	32%	0.32	S	S	.	.	H	α-helix	trans	-61.3	-32.6	179.2	0	0	0	0	0	112.4	R100 T101 V102 Y106 N107 M108	R100-A104 VanDerWaalsContact O-CB 3.27Å; R100-A104 WeakPolarHBondContact O-CB 3.46Å; R100-A104 PolarHBondContact O-N 3.37Å; T101-A104 PolarHBondContact O-N 3.45Å; V102-A104 VanDerWaalsContact C-N 3.26Å; V102-A104 PolarHBondContact O-N 3.28Å; A104-Y106 PolarHBondContact O-N 3.47Å; A104-N107 PolarHBondContact O-N 3.33Å; A104-N107 VanDerWaalsContact O-N 3.16Å; A104-M108 PolarHBondContact N-O 3.01Å
105	E	90.4	Very high	92.2	Very high	148 Å²	148	64 Å²	64	69%	0.692	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.6	-26.7	175.1	-62	-178.3	179.3	0	0	112.3	V102 L103	V102-E105 PolarHBondContact O-N 3.32Å; L103-E105 PolarHBondContact O-N 3.36Å
106	Y	89.5	Confident	92.3	Very high	148 Å²	148	63 Å²	63	58%	0.58	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.2	16.5	-178.9	-59.8	-82.7	0	0	0	113.4	V102 L103 A104 M108	V102-Y106 WeakPolarHBondContact O-CD2 3.3Å; L103-Y106 PolarHBondContact O-N 3.31Å; A104-Y106 PolarHBondContact O-N 3.47Å; Y106-M108 VanDerWaalsContact CB-CE 3.41Å; Y106-M108 HydrophobicContact CG-CE 4.08Å; Y106-M108 PolarHBondContact O-N 3.22Å
107	N	90.5	Very high	92.3	Very high	65 Å²	65	66.9 Å²	66.9	35%	0.348	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	54	38.2	-171	-60.9	-68	0	0	0	112.2	A104 K119	A104-N107 PolarHBondContact O-N 3.33Å; A104-N107 VanDerWaalsContact O-N 3.16Å; N107-K119 HydrophobicContact CB-CB 4.43Å; N107-K119 WeakPolarHBondContact O-CA 3.29Å; N107-K119 VanDerWaalsContact O-CB 3.3Å; N107-K119 WeakPolarHBondContact O-CB 3.41Å; N107-K119 PolarHBondContact O-N 3.37Å
108	M	92.4	Very high	92.1	Very high	21 Å²	21	71 Å²	71	10%	0.103	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	169	175.3	-64	-173.8	-72	0	0	110.4	L10 L103 A104 Y106 L116 I117 L118	L10-M108 HydrophobicContact CD2-CE 3.81Å; L10-M108 HydrophobicContact CD2-SD 3.93Å; L103-M108 CarbonylContact C-O 3.59Å; L103-M108 VanDerWaalsContact C-O 3.24Å; L103-M108 HydrophobicContact CB-CB 3.99Å; L103-M108 HydrophobicContact CD2-CB 4.18Å; L103-M108 HydrophobicContact CD2-CE 3.96Å; L103-M108 CarbonylContact O-C 3.24Å; L103-M108 WeakPolarHBondContact O-CA 3.24Å; L103-M108 PolarHBondContact O-N 3.03Å; L103-M108 VanDerWaalsContact O-O 3.12Å; A104-M108 PolarHBondContact N-O 3.01Å; Y106-M108 VanDerWaalsContact CB-CE 3.41Å; Y106-M108 HydrophobicContact CG-CE 4.08Å; Y106-M108 PolarHBondContact O-N 3.22Å; M108-L116 HydrophobicContact SD-CD2 3.7Å; M108-L116 HydrophobicContact SD-CG 4.33Å; M108-I117 CarbonylContact C-O 3.51Å; M108-I117 VanDerWaalsContact CA-O 3.31Å; M108-I117 WeakPolarHBondContact CA-O 3.42Å; M108-L118 HydrophobicContact CG-CG 4.42Å
109	S	94.4	Very high	91.8	Very high	20 Å²	20	67.4 Å²	67.4	14%	0.14	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.5	173.4	171	-174	0	0	0	0	108	L116 I117	S109-L116 CarbonylContact O-C 3.45Å; S109-L116 WeakPolarHBondContact O-CD1 3.3Å; S109-I117 PolarHBondContact N-O 3.12Å; S109-I117 PolarHBondContact O-N 3.12Å
110	C	93.6	Very high	91.2	Very high	2 Å²	2	71.7 Å²	71.7	1%	0.014	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	156.4	165	67.7	0	0	0	0	110.7	L17 R100 L103 K115	L17-C110 HydrophobicContact CD2-CB 4.07Å; R100-C110 PolarHBondContact NE-O 3.48Å; R100-C110 PolarHBondContact NH2-O 3.25Å; L103-C110 HydrophobicContact CD1-CB 3.98Å; C110-K115 CarbonylContact C-O 3.49Å; C110-K115 WeakPolarHBondContact CA-O 3.07Å; C110-K115 WeakPolarHBondContact CB-O 3.31Å
111	D	92.6	Very high	90.2	Very high	47 Å²	47	78.5 Å²	78.5	25%	0.251	40%	0.4	S	S	.	.			trans	-80	-178.7	168.8	71	12.7	0	0	0	111.4	R100 T113 G114 K115 I117	R100-D111 PolarHBondContact NH2-O 3.46Å; D111-T113 PolarHBondContact O-N 2.79Å; D111-T113 VanDerWaalsContact OD1-CA 3.3Å; D111-T113 WeakPolarHBondContact OD1-CA 3.47Å; D111-T113 WeakPolarHBondContact OD1-CB 3.41Å; D111-T113 PolarHBondContact OD1-N 2.76Å; D111-T113 PolarHBondContact OD1-OG1 3.4Å; D111-T113 PolarHBondContact OD2-OG1 2.77Å; D111-T113 VanDerWaalsContact OD2-OG1 3.05Å; D111-G114 PolarHBondContact O-N 3.3Å; D111-G114 PolarHBondContact OD1-N 3.04Å; D111-K115 PolarHBondContact N-O 3.11Å; D111-K115 WeakPolarHBondContact OD1-CB 3.44Å; D111-K115 PolarHBondContact OD1-N 3.23Å; D111-K115 WeakPolarHBondContact OD2-CB 3.45Å; D111-I117 HydrophobicContact CB-CD1 4.18Å
112	D	89.4	Confident	89	Confident	103 Å²	103	78.4 Å²	78.4	55%	0.551	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.5	-5.6	178.1	-70	-36.7	0	0	0	113.4	I21 R100	I21-D112 VanDerWaalsContact CG2-O 3.29Å; I21-D112 WeakPolarHBondContact CG2-O 3.27Å; R100-D112 IonicContact CZ-OD1 3.54Å; R100-D112 IonicContact NH1-OD1 3.45Å; R100-D112 PolarHBondContact NH1-OD1 3.16Å; R100-D112 IonicContact NH2-OD1 2.71Å; R100-D112 PolarHBondContact NH2-OD1 2.91Å
113	T	89.9	Confident	87.9	Confident	69 Å²	69	82.9 Å²	82.9	42%	0.423	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.8	-14.7	173.8	77.1	0	0	0	0	112.3	T18 D111	T18-T113 WeakPolarHBondContact CA-O 3.29Å; D111-T113 PolarHBondContact O-N 2.79Å; D111-T113 VanDerWaalsContact OD1-CA 3.3Å; D111-T113 WeakPolarHBondContact OD1-CA 3.47Å; D111-T113 WeakPolarHBondContact OD1-CB 3.41Å; D111-T113 PolarHBondContact OD1-N 2.76Å; D111-T113 PolarHBondContact OD1-OG1 3.4Å; D111-T113 PolarHBondContact OD2-OG1 2.77Å; D111-T113 VanDerWaalsContact OD2-OG1 3.05Å
114	G	90.4	Very high	86.5	Confident	0 Å²	0	89.1 Å²	89.1	0%	0	45%	0.454	C	S	.	.	S	Bend	trans	101	1.1	-177.4	0	0	0	0	0	114.5	D111	D111-G114 PolarHBondContact O-N 3.3Å; D111-G114 PolarHBondContact OD1-N 3.04Å
115	K	92.5	Very high	84.5	Confident	117 Å²	117	99 Å²	99	51%	0.509	49%	0.493	S	S	.	.			trans	-69.9	136	177.6	-171.5	175	-176.5	176.9	0	110.6	E14 C110 D111	E14-K115 WeakPolarHBondContact OE1-CG 3.28Å; C110-K115 CarbonylContact C-O 3.49Å; C110-K115 WeakPolarHBondContact CA-O 3.07Å; C110-K115 WeakPolarHBondContact CB-O 3.31Å; D111-K115 PolarHBondContact N-O 3.11Å; D111-K115 WeakPolarHBondContact OD1-CB 3.44Å; D111-K115 PolarHBondContact OD1-N 3.23Å; D111-K115 WeakPolarHBondContact OD2-CB 3.45Å
116	L	93.6	Very high	84.2	Confident	16 Å²	16	96.6 Å²	96.6	8%	0.084	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	140.3	-180	-155.1	69.7	0	0	0	111.4	L10 F13 E14 L103 M108 S109	L10-L116 HydrophobicContact CB-CD2 4.43Å; L10-L116 HydrophobicContact CD2-CD2 3.93Å; F13-L116 HydrophobicContact CE1-CD1 4.38Å; E14-L116 HydrophobicContact CB-CB 4.38Å; E14-L116 HydrophobicContact CG-CB 4.24Å; L103-L116 HydrophobicContact CD1-CD1 3.42Å; L103-L116 VanDerWaalsContact CD1-CD1 3.42Å; L103-L116 HydrophobicContact CD2-CD1 3.74Å; L103-L116 HydrophobicContact CG-CD1 4.2Å; M108-L116 HydrophobicContact SD-CD2 3.7Å; M108-L116 HydrophobicContact SD-CG 4.33Å; S109-L116 CarbonylContact O-C 3.45Å; S109-L116 WeakPolarHBondContact O-CD1 3.3Å
117	I	91.6	Very high	84	Confident	82 Å²	82	93.9 Å²	93.9	42%	0.421	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	118.8	179.7	-59.7	169.5	0	0	0	107.3	M108 S109 D111	M108-I117 CarbonylContact C-O 3.51Å; M108-I117 VanDerWaalsContact CA-O 3.31Å; M108-I117 WeakPolarHBondContact CA-O 3.42Å; S109-I117 PolarHBondContact N-O 3.12Å; S109-I117 PolarHBondContact O-N 3.12Å; D111-I117 HydrophobicContact CB-CD1 4.18Å
118	L	89.7	Confident	83.6	Confident	133 Å²	133	95.5 Å²	95.5	70%	0.696	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.2	126.9	172.9	-67.7	88	0	0	0	109.1	M108	M108-L118 HydrophobicContact CG-CG 4.42Å
119	K	87.1	Confident	83.1	Confident	105 Å²	105	99.9 Å²	99.9	46%	0.457	51%	0.507	S	S	.	.	P	Polyproline II helix	trans	-84.7	145.1	172.1	-59.8	-174.9	-178.4	176.7	0	109.2	N107 R121	N107-K119 HydrophobicContact CB-CB 4.43Å; N107-K119 WeakPolarHBondContact O-CA 3.29Å; N107-K119 VanDerWaalsContact O-CB 3.3Å; N107-K119 WeakPolarHBondContact O-CB 3.41Å; N107-K119 PolarHBondContact O-N 3.37Å; K119-R121 PolarHBondContact O-N 3.49Å
120	P	81	Confident	82.4	Confident	114 Å²	114	104.9 Å²	104.9	74%	0.74	53%	0.53	S	S	*	.	P	Polyproline II helix	trans	-55.8	140.9	171.1	-19.8	30.9	0	0	0	110.2
121	R	73.6	Confident	81.6	Confident	213 Å²	213	111.7 Å²	111.7	80%	0.804	57%	0.565	S	S	*	*	P	Polyproline II helix	trans	-62	134.6	168.8	-71.5	-172.7	-169.1	-167.5	3.1	108.1	K119 H123	K119-R121 PolarHBondContact O-N 3.49Å; R121-H123 PolarHBondContact O-N 3.15Å; R121-H123 VanDerWaalsContact O-N 3.15Å
122	P	68.7	Low	80.8	Confident	98 Å²	98	116.4 Å²	116.4	64%	0.636	59%	0.587	S	S	*	*	P	Polyproline II helix	trans	-58.8	123.4	169.4	11.9	-13.2	0	0	0	108.2	V124	P122-V124 PolarHBondContact O-N 3.08Å; P122-V124 VanDerWaalsContact O-N 3.08Å
123	H	70.3	Confident	80.2	Confident	181 Å²	181	117.4 Å²	117.4	84%	0.838	59%	0.59	S	S	*	*			trans	-60.1	114.1	169.4	-71.6	-83	0	0	0	106.7	R121 Q125	R121-H123 PolarHBondContact O-N 3.15Å; R121-H123 VanDerWaalsContact O-N 3.15Å; H123-Q125 PolarHBondContact O-N 3.08Å; H123-Q125 VanDerWaalsContact O-N 3.08Å
124	V	62.5	Low	79.4	Confident	143 Å²	143	121.4 Å²	121.4	87%	0.867	60%	0.604	S	S	*	*			trans	-63	111.5	166	-178.1	0	0	0	0	105.2	P122	P122-V124 PolarHBondContact O-N 3.08Å; P122-V124 VanDerWaalsContact O-N 3.08Å
125	Q	51.6	Low	78.4	Confident	255 Å²	255	132.5 Å²	132.5	100%	1.192	66%	0.658	S	S	*	*			trans	-66.6	0	168	-95	-178.9	-94.2	0	0	110.3	H123	H123-Q125 PolarHBondContact O-N 3.08Å; H123-Q125 VanDerWaalsContact O-N 3.08Å

Retrieved 125 of 125 residues in 39.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).