NEPR1_PONAB Loading...

Nuclear envelope phosphatase-regulatory subunit 1

Forms with the serine/threonine protein phosphatase CTDNEP1 an active complex which dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol (By similarity).

AlphaFold DB , UniProt , Accession Q5R7J7, Species PONAB (Pongo abelii, Sumatran orangutan), Gene CNEP1R1, Length 125 aa.

						>NEPR1_PONAB|Q5R7J7|CNEP1R1
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.9	Low	87.2	Confident	153 Å²	153	108.3 Å²	108.3	75%	0.754	57%	0.565	S	S	*	*				0	117.6	0	-111.3	153	98	0	0	108	E5 Q6 D9	M1-E5 WeakPolarHBondContact CA-OE2 3.49Å; M1-E5 HydrophobicContact CG-CB 4.15Å; M1-Q6 HydrophobicContact CB-CG 4.27Å; M1-Q6 HydrophobicContact CE-CG 3.91Å; M1-D9 VanDerWaalsContact CE-OD2 3.24Å; M1-D9 WeakPolarHBondContact CE-OD2 3.27Å
2	N	84	Confident	87.8	Confident	116 Å²	116	104 Å²	104	62%	0.62	56%	0.557	S	S	*	*			trans	-67	152.3	171.3	-80.7	-20	0	0	0	109.3	L4 E5 Q6	N2-L4 PolarHBondContact O-N 2.8Å; N2-L4 VanDerWaalsContact O-N 3.11Å; N2-E5 HydrophobicContact CB-CG 4.38Å; N2-E5 PolarHBondContact N-OE2 3.43Å; N2-E5 PolarHBondContact O-N 3.46Å; N2-Q6 PolarHBondContact O-N 3.15Å
3	S	85.9	Confident	88.2	Confident	93 Å²	93	102.8 Å²	102.8	65%	0.65	55%	0.545	S	S	*	.	H	α-helix	trans	-55.3	-29	176	51.6	0	0	0	0	112.9	A7	S3-A7 PolarHBondContact O-N 3.11Å; S3-A7 VanDerWaalsContact O-N 3.12Å
4	L	88.9	Confident	88.7	Confident	126 Å²	126	99.6 Å²	99.6	66%	0.66	53%	0.525	S	S	*	.	H	α-helix	trans	-65.4	-47.9	174.2	-66.4	175.3	0	0	0	112.3	N2 Q6 A7 E8	N2-L4 PolarHBondContact O-N 2.8Å; N2-L4 VanDerWaalsContact O-N 3.11Å; L4-Q6 VanDerWaalsContact C-N 3.28Å; L4-Q6 PolarHBondContact O-N 3.45Å; L4-A7 PolarHBondContact O-N 3.32Å; L4-A7 VanDerWaalsContact O-N 3.12Å; L4-E8 WeakPolarHBondContact O-CG 3.44Å; L4-E8 PolarHBondContact O-N 2.83Å
5	E	91.5	Very high	89.2	Confident	93 Å²	93	104.4 Å²	104.4	44%	0.435	53%	0.533	S	S	.	.	H	α-helix	trans	-60.3	-41.6	178.5	-63.3	174	136.2	0	0	110.5	M1 N2 A7 E8 D9	M1-E5 WeakPolarHBondContact CA-OE2 3.49Å; M1-E5 HydrophobicContact CG-CB 4.15Å; N2-E5 HydrophobicContact CB-CG 4.38Å; N2-E5 PolarHBondContact N-OE2 3.43Å; N2-E5 PolarHBondContact O-N 3.46Å; E5-A7 PolarHBondContact O-N 3.03Å; E5-E8 PolarHBondContact O-N 3.34Å; E5-D9 WeakPolarHBondContact O-CB 3.14Å; E5-D9 PolarHBondContact O-N 3.43Å
6	Q	88.6	Confident	89.5	Confident	104 Å²	104	108.3 Å²	108.3	49%	0.486	54%	0.539	S	S	.	.	H	α-helix	trans	-61.8	-41	175.6	-70.4	-179.5	-34.2	0	0	112.8	M1 N2 L4 L10	M1-Q6 HydrophobicContact CB-CG 4.27Å; M1-Q6 HydrophobicContact CE-CG 3.91Å; N2-Q6 PolarHBondContact O-N 3.15Å; L4-Q6 VanDerWaalsContact C-N 3.28Å; L4-Q6 PolarHBondContact O-N 3.45Å; Q6-L10 VanDerWaalsContact O-CG 3.29Å; Q6-L10 WeakPolarHBondContact O-CG 3.46Å; Q6-L10 PolarHBondContact O-N 3.37Å
7	A	89.9	Confident	89.8	Confident	56 Å²	56	102.7 Å²	102.7	46%	0.463	51%	0.511	S	S	.	.	H	α-helix	trans	-68.6	-38.5	178.4	0	0	0	0	0	111.9	S3 L4 E5 K11	S3-A7 PolarHBondContact O-N 3.11Å; S3-A7 VanDerWaalsContact O-N 3.12Å; L4-A7 PolarHBondContact O-N 3.32Å; L4-A7 VanDerWaalsContact O-N 3.12Å; E5-A7 PolarHBondContact O-N 3.03Å; A7-K11 WeakPolarHBondContact O-CB 3.47Å; A7-K11 PolarHBondContact O-N 3.08Å
8	E	93.8	Very high	90	Very high	135 Å²	135	99.7 Å²	99.7	63%	0.631	50%	0.499	S	S	*	.	H	α-helix	trans	-64.4	-43.7	174.8	-71.8	-179.8	167.5	0	0	111.6	L4 E5 K11 A12	L4-E8 WeakPolarHBondContact O-CG 3.44Å; L4-E8 PolarHBondContact O-N 2.83Å; E5-E8 PolarHBondContact O-N 3.34Å; E8-K11 PolarHBondContact O-N 3.15Å; E8-A12 WeakPolarHBondContact O-CB 3.4Å; E8-A12 PolarHBondContact O-N 3.32Å
9	D	93.6	Very high	90.2	Very high	93 Å²	93	98.1 Å²	98.1	50%	0.497	49%	0.49	S	S	.	.	H	α-helix	trans	-62.4	-44.5	176.2	-78.6	-14.7	0	0	0	112.2	M1 E5 K11 A12 F13	M1-D9 VanDerWaalsContact CE-OD2 3.24Å; M1-D9 WeakPolarHBondContact CE-OD2 3.27Å; E5-D9 WeakPolarHBondContact O-CB 3.14Å; E5-D9 PolarHBondContact O-N 3.43Å; D9-K11 VanDerWaalsContact C-N 3.32Å; D9-K11 PolarHBondContact O-N 2.94Å; D9-A12 PolarHBondContact O-N 3.15Å; D9-F13 WeakPolarHBondContact O-CB 3.35Å; D9-F13 PolarHBondContact O-N 3.33Å
10	L	91.9	Very high	90.3	Very high	65 Å²	65	99.6 Å²	99.6	34%	0.34	49%	0.491	S	S	.	.	H	α-helix	trans	-62.2	-40.8	176.2	-73.9	168.7	0	0	0	111.7	Q6 F13 E14 M108 L116	Q6-L10 VanDerWaalsContact O-CG 3.29Å; Q6-L10 WeakPolarHBondContact O-CG 3.46Å; Q6-L10 PolarHBondContact O-N 3.37Å; L10-F13 PolarHBondContact O-N 2.78Å; L10-E14 WeakPolarHBondContact O-CB 3.44Å; L10-E14 PolarHBondContact O-N 3.04Å; L10-M108 HydrophobicContact CD2-CE 3.81Å; L10-M108 HydrophobicContact CD2-SD 3.93Å; L10-L116 HydrophobicContact CB-CD2 4.43Å; L10-L116 HydrophobicContact CD2-CD2 3.93Å
11	K	93.1	Very high	90.4	Very high	157 Å²	157	94.9 Å²	94.9	68%	0.683	47%	0.468	S	S	*	.	H	α-helix	trans	-66.9	-39.4	176.4	-172.8	177.6	-177.2	178.3	0	111.7	A7 E8 D9 R15	A7-K11 WeakPolarHBondContact O-CB 3.47Å; A7-K11 PolarHBondContact O-N 3.08Å; E8-K11 PolarHBondContact O-N 3.15Å; D9-K11 VanDerWaalsContact C-N 3.32Å; D9-K11 PolarHBondContact O-N 2.94Å; K11-R15 WeakPolarHBondContact O-CB 3.35Å; K11-R15 PolarHBondContact O-N 3.17Å
12	A	94.6	Very high	91.9	Very high	57 Å²	57	93.9 Å²	93.9	47%	0.471	46%	0.461	S	S	.	.	H	α-helix	trans	-64.1	-42.9	174.5	0	0	0	0	0	111.1	E8 D9 R15 R16	E8-A12 WeakPolarHBondContact O-CB 3.4Å; E8-A12 PolarHBondContact O-N 3.32Å; D9-A12 PolarHBondContact O-N 3.15Å; A12-R15 PolarHBondContact O-N 3.21Å; A12-R16 WeakPolarHBondContact O-CB 3.28Å; A12-R16 PolarHBondContact O-N 3.21Å
13	F	93.3	Very high	92.3	Very high	89 Å²	89	92.8 Å²	92.8	39%	0.39	46%	0.461	S	S	.	.	H	α-helix	trans	-61.6	-49.9	174.4	175	-97.8	0	0	0	112.2	D9 L10 R15 R16 L17 L103 L116	D9-F13 WeakPolarHBondContact O-CB 3.35Å; D9-F13 PolarHBondContact O-N 3.33Å; L10-F13 PolarHBondContact O-N 2.78Å; F13-R15 VanDerWaalsContact C-N 3.3Å; F13-R15 PolarHBondContact O-N 3.32Å; F13-R16 PolarHBondContact O-N 3.39Å; F13-R16 VanDerWaalsContact O-N 3.12Å; F13-L17 HydrophobicContact CE1-CD2 4.05Å; F13-L17 HydrophobicContact CZ-CD2 4.26Å; F13-L17 WeakPolarHBondContact O-CB 3.2Å; F13-L17 PolarHBondContact O-N 2.92Å; F13-L103 HydrophobicContact CE1-CD1 4.42Å; F13-L103 HydrophobicContact CE1-CD2 4.21Å; F13-L116 HydrophobicContact CE1-CD1 4.38Å
14	E	94.8	Very high	92.5	Very high	57 Å²	57	90.5 Å²	90.5	27%	0.266	44%	0.442	S	S	.	.	H	α-helix	trans	-56.2	-46.1	176.8	-178.9	-175.8	158.1	0	0	111	L10 R16 L17 T18 K115 L116	L10-E14 WeakPolarHBondContact O-CB 3.44Å; L10-E14 PolarHBondContact O-N 3.04Å; E14-R16 PolarHBondContact O-N 2.68Å; E14-L17 PolarHBondContact O-N 3.41Å; E14-T18 VanDerWaalsContact O-CB 3.31Å; E14-T18 WeakPolarHBondContact O-CB 3.45Å; E14-T18 PolarHBondContact O-N 2.87Å; E14-T18 PolarHBondContact O-OG1 3.45Å; E14-K115 WeakPolarHBondContact OE1-CG 3.28Å; E14-L116 HydrophobicContact CB-CB 4.38Å; E14-L116 HydrophobicContact CG-CB 4.24Å
15	R	95.8	Very high	92.4	Very high	172 Å²	172	89.3 Å²	89.3	65%	0.649	43%	0.433	S	S	*	.	H	α-helix	trans	-59	-47.7	175.9	178	179.9	174.2	167.8	3.3	111	K11 A12 F13 L17 T18 E19	K11-R15 WeakPolarHBondContact O-CB 3.35Å; K11-R15 PolarHBondContact O-N 3.17Å; A12-R15 PolarHBondContact O-N 3.21Å; F13-R15 VanDerWaalsContact C-N 3.3Å; F13-R15 PolarHBondContact O-N 3.32Å; R15-L17 PolarHBondContact O-N 3.48Å; R15-T18 PolarHBondContact O-N 3.24Å; R15-E19 HydrophobicContact CG-CG 4.46Å; R15-E19 WeakPolarHBondContact CG-OE1 3.34Å; R15-E19 IonicContact CZ-OE1 3.73Å; R15-E19 IonicContact NE-OE1 2.9Å; R15-E19 PolarHBondContact NE-OE1 3.19Å; R15-E19 IonicContact NH2-OE1 3.67Å; R15-E19 WeakPolarHBondContact O-CB 3.38Å; R15-E19 VanDerWaalsContact O-CG 3.32Å; R15-E19 WeakPolarHBondContact O-CG 3.47Å; R15-E19 PolarHBondContact O-N 2.67Å
16	R	95.1	Very high	92.2	Very high	167 Å²	167	88 Å²	88	63%	0.63	43%	0.432	S	S	*	.	H	α-helix	trans	-65.6	-40	-178	-121.6	-55.9	-171.7	-139.3	12.5	112.3	A12 F13 E14 E19 Y20	A12-R16 WeakPolarHBondContact O-CB 3.28Å; A12-R16 PolarHBondContact O-N 3.21Å; F13-R16 PolarHBondContact O-N 3.39Å; F13-R16 VanDerWaalsContact O-N 3.12Å; E14-R16 PolarHBondContact O-N 2.68Å; R16-E19 IonicContact CZ-OE2 3.95Å; R16-E19 IonicContact NH1-OE2 3.02Å; R16-E19 PolarHBondContact NH1-OE2 3.21Å; R16-Y20 WeakPolarHBondContact O-CB 3.29Å; R16-Y20 PolarHBondContact O-N 3.32Å
17	L	93.3	Very high	92.3	Very high	13 Å²	13	85 Å²	85	7%	0.068	43%	0.426	C	S	.	.	H	α-helix	trans	-64.6	-45.7	176.4	-178.4	58.8	0	0	0	111.1	F13 E14 R15 Y20 I21 I95 C99 C110	F13-L17 HydrophobicContact CE1-CD2 4.05Å; F13-L17 HydrophobicContact CZ-CD2 4.26Å; F13-L17 WeakPolarHBondContact O-CB 3.2Å; F13-L17 PolarHBondContact O-N 2.92Å; E14-L17 PolarHBondContact O-N 3.41Å; R15-L17 PolarHBondContact O-N 3.48Å; L17-Y20 PolarHBondContact O-N 2.71Å; L17-I21 HydrophobicContact CD1-CD1 3.89Å; L17-I21 HydrophobicContact CD1-CG1 4.32Å; L17-I21 HydrophobicContact CG-CD1 4.01Å; L17-I21 WeakPolarHBondContact O-CG1 3.4Å; L17-I21 PolarHBondContact O-N 2.85Å; L17-I95 HydrophobicContact CD1-CG2 4.49Å; L17-C99 HydrophobicContact CD2-CB 4.37Å; L17-C110 HydrophobicContact CD2-CB 4.07Å
18	T	94.2	Very high	92.3	Very high	48 Å²	48	82.8 Å²	82.8	29%	0.294	41%	0.406	S	S	.	.	H	α-helix	trans	-61.8	-46.5	177.2	-56.6	0	0	0	0	111.4	E14 R15 Y20 I21 H22 T113	E14-T18 VanDerWaalsContact O-CB 3.31Å; E14-T18 WeakPolarHBondContact O-CB 3.45Å; E14-T18 PolarHBondContact O-N 2.87Å; E14-T18 PolarHBondContact O-OG1 3.45Å; R15-T18 PolarHBondContact O-N 3.24Å; T18-Y20 VanDerWaalsContact C-N 3.31Å; T18-Y20 PolarHBondContact O-N 3.16Å; T18-I21 PolarHBondContact O-N 3.2Å; T18-H22 WeakPolarHBondContact O-CB 3.32Å; T18-H22 PolarHBondContact O-N 3.26Å; T18-T113 WeakPolarHBondContact CA-O 3.29Å
19	E	94.5	Very high	92.2	Very high	69 Å²	69	77.8 Å²	77.8	32%	0.322	39%	0.391	S	S	.	.	H	α-helix	trans	-57.2	-45.5	175.2	-75.6	172.1	-172.5	0	0	111.4	R15 R16 H22 C23	R15-E19 HydrophobicContact CG-CG 4.46Å; R15-E19 WeakPolarHBondContact CG-OE1 3.34Å; R15-E19 IonicContact CZ-OE1 3.73Å; R15-E19 IonicContact NE-OE1 2.9Å; R15-E19 PolarHBondContact NE-OE1 3.19Å; R15-E19 IonicContact NH2-OE1 3.67Å; R15-E19 WeakPolarHBondContact O-CB 3.38Å; R15-E19 VanDerWaalsContact O-CG 3.32Å; R15-E19 WeakPolarHBondContact O-CG 3.47Å; R15-E19 PolarHBondContact O-N 2.67Å; R16-E19 IonicContact CZ-OE2 3.95Å; R16-E19 IonicContact NH1-OE2 3.02Å; R16-E19 PolarHBondContact NH1-OE2 3.21Å; E19-H22 PolarHBondContact O-N 3.39Å; E19-C23 PolarHBondContact O-N 3.05Å; E19-C23 PolarHBondContact O-SG 3.48Å
20	Y	92.2	Very high	92.1	Very high	128 Å²	128	81.8 Å²	81.8	50%	0.502	40%	0.399	S	S	.	.	H	α-helix	trans	-65.1	-46.2	-178.9	-169.9	-111.8	0	0	0	112.4	R16 L17 T18 C23 L24 I95	R16-Y20 WeakPolarHBondContact O-CB 3.29Å; R16-Y20 PolarHBondContact O-N 3.32Å; L17-Y20 PolarHBondContact O-N 2.71Å; T18-Y20 VanDerWaalsContact C-N 3.31Å; T18-Y20 PolarHBondContact O-N 3.16Å; Y20-C23 PolarHBondContact O-N 2.94Å; Y20-L24 HydrophobicContact CD1-CD1 4.03Å; Y20-L24 HydrophobicContact CE1-CD1 3.73Å; Y20-L24 WeakPolarHBondContact O-CG 3.46Å; Y20-L24 PolarHBondContact O-N 3.26Å; Y20-I95 HydrophobicContact CD1-CD1 4.25Å; Y20-I95 HydrophobicContact CD1-CG2 4.29Å; Y20-I95 HydrophobicContact CE1-CD1 3.48Å; Y20-I95 VanDerWaalsContact CE1-CD1 3.48Å; Y20-I95 HydrophobicContact CE1-CG1 4.29Å; Y20-I95 HydrophobicContact CE1-CG2 4.27Å
21	I	91.1	Very high	92.2	Very high	2 Å²	2	82 Å²	82	1%	0.01	40%	0.395	C	S	.	.	H	α-helix	trans	-64.7	-43.4	176.6	-71.9	173.4	0	0	0	110.6	L17 T18 C23 L24 Q25 D112	L17-I21 HydrophobicContact CD1-CD1 3.89Å; L17-I21 HydrophobicContact CD1-CG1 4.32Å; L17-I21 HydrophobicContact CG-CD1 4.01Å; L17-I21 WeakPolarHBondContact O-CG1 3.4Å; L17-I21 PolarHBondContact O-N 2.85Å; T18-I21 PolarHBondContact O-N 3.2Å; I21-C23 VanDerWaalsContact C-N 3.28Å; I21-C23 PolarHBondContact O-N 2.85Å; I21-L24 PolarHBondContact O-N 3.5Å; I21-Q25 WeakPolarHBondContact O-CB 3.47Å; I21-Q25 PolarHBondContact O-N 2.87Å; I21-D112 VanDerWaalsContact CG2-O 3.29Å; I21-D112 WeakPolarHBondContact CG2-O 3.27Å
22	H	90.9	Very high	92.3	Very high	131 Å²	131	80.2 Å²	80.2	61%	0.606	38%	0.384	S	S	*	.	H	α-helix	trans	-62.3	-34	178.8	-174.1	-89.5	0	0	0	112.2	T18 E19 L24 P26	T18-H22 WeakPolarHBondContact O-CB 3.32Å; T18-H22 PolarHBondContact O-N 3.26Å; E19-H22 PolarHBondContact O-N 3.39Å; H22-L24 VanDerWaalsContact C-N 3.34Å; H22-P26 WeakPolarHBondContact O-CD 3.39Å
23	C	91.2	Very high	92.3	Very high	94 Å²	94	83.1 Å²	83.1	64%	0.635	39%	0.389	S	S	*	.	H	α-helix	trans	-67.4	-33.1	172.3	-73.1	0	0	0	0	112.9	E19 Y20 I21	E19-C23 PolarHBondContact O-N 3.05Å; E19-C23 PolarHBondContact O-SG 3.48Å; Y20-C23 PolarHBondContact O-N 2.94Å; I21-C23 VanDerWaalsContact C-N 3.28Å; I21-C23 PolarHBondContact O-N 2.85Å
24	L	89.5	Confident	92.4	Very high	45 Å²	45	83.2 Å²	83.2	24%	0.236	39%	0.393	C	S	.	.	H	α-helix	trans	-83.2	-37.3	-178.6	-66.8	169.9	0	0	0	113	Y20 I21 H22 A27 T28 P92 I95	Y20-L24 HydrophobicContact CD1-CD1 4.03Å; Y20-L24 HydrophobicContact CE1-CD1 3.73Å; Y20-L24 WeakPolarHBondContact O-CG 3.46Å; Y20-L24 PolarHBondContact O-N 3.26Å; I21-L24 PolarHBondContact O-N 3.5Å; H22-L24 VanDerWaalsContact C-N 3.34Å; L24-A27 PolarHBondContact O-N 3.23Å; L24-T28 PolarHBondContact O-N 3.35Å; L24-T28 PolarHBondContact O-OG1 2.92Å; L24-P92 HydrophobicContact CB-CG 4.06Å; L24-I95 HydrophobicContact CD1-CD1 3.44Å; L24-I95 VanDerWaalsContact CD1-CD1 3.44Å
25	Q	87.1	Confident	92.4	Very high	101 Å²	101	82.9 Å²	82.9	47%	0.472	39%	0.393	S	S	.	.	H	α-helix	trans	-53.9	-45.1	-175.5	-170.6	173.3	-41.7	0	0	115.3	I21 A27 T28 G29	I21-Q25 WeakPolarHBondContact O-CB 3.47Å; I21-Q25 PolarHBondContact O-N 2.87Å; Q25-A27 PolarHBondContact O-N 3.48Å; Q25-T28 PolarHBondContact O-N 2.88Å; Q25-G29 PolarHBondContact O-N 2.95Å
26	P	88.1	Confident	92.4	Very high	65 Å²	65	79.1 Å²	79.1	42%	0.422	39%	0.385	S	S	.	.	H	α-helix	trans	-66.6	-37.9	180	23.6	-32.4	0	0	0	111.8	H22 R30	H22-P26 WeakPolarHBondContact O-CD 3.39Å; P26-R30 WeakPolarHBondContact O-CG 3.37Å; P26-R30 PolarHBondContact O-N 2.88Å; P26-R30 VanDerWaalsContact O-N 3.14Å
27	A	90.1	Very high	92.4	Very high	42 Å²	42	75 Å²	75	35%	0.347	38%	0.378	S	S	.	.	H	α-helix	trans	-67.5	-48	175.2	0	0	0	0	0	110.8	L24 Q25 G29 R30 W31	L24-A27 PolarHBondContact O-N 3.23Å; Q25-A27 PolarHBondContact O-N 3.48Å; A27-G29 VanDerWaalsContact C-N 3.32Å; A27-G29 PolarHBondContact O-N 3.38Å; A27-R30 PolarHBondContact O-N 3.42Å; A27-W31 PolarHBondContact O-N 3.36Å; A27-W31 VanDerWaalsContact O-N 3.08Å
28	T	90.7	Very high	92.5	Very high	8 Å²	8	75.3 Å²	75.3	5%	0.049	38%	0.38	C	S	.	.	H	α-helix	trans	-60.3	-40.7	176.6	-67.2	0	0	0	0	112.1	L24 Q25 R30 W31 R32 R88 V89 P92	L24-T28 PolarHBondContact O-N 3.35Å; L24-T28 PolarHBondContact O-OG1 2.92Å; Q25-T28 PolarHBondContact O-N 2.88Å; T28-R30 PolarHBondContact O-N 3.41Å; T28-W31 PolarHBondContact O-N 2.98Å; T28-R32 HydrophobicContact CG2-CG 4.36Å; T28-R32 WeakPolarHBondContact O-CG 3.18Å; T28-R32 PolarHBondContact O-N 3.41Å; T28-R88 PolarHBondContact OG1-O 3.49Å; T28-V89 WeakPolarHBondContact CG2-O 3.5Å; T28-P92 HydrophobicContact CG2-CG 3.94Å; T28-P92 WeakPolarHBondContact OG1-CD 3.42Å; T28-P92 WeakPolarHBondContact OG1-CG 3.29Å
29	G	91.1	Very high	92.5	Very high	30 Å²	30	75.6 Å²	75.6	31%	0.309	38%	0.384	S	S	.	.	H	α-helix	trans	-58.5	-46.7	175	0	0	0	0	0	112.1	Q25 A27 W31 R32 M33	Q25-G29 PolarHBondContact O-N 2.95Å; A27-G29 VanDerWaalsContact C-N 3.32Å; A27-G29 PolarHBondContact O-N 3.38Å; G29-W31 PolarHBondContact O-N 3.23Å; G29-R32 PolarHBondContact O-N 2.89Å; G29-M33 WeakPolarHBondContact O-CG 3.28Å; G29-M33 PolarHBondContact O-N 3.27Å
30	R	92.6	Very high	92.6	Very high	178 Å²	178	76.1 Å²	76.1	67%	0.672	39%	0.392	S	S	*	.	H	α-helix	trans	-58.4	-46.5	174.6	-68.8	173.2	-160	172	4.7	112	P26 A27 T28 R32 M33 L34	P26-R30 WeakPolarHBondContact O-CG 3.37Å; P26-R30 PolarHBondContact O-N 2.88Å; P26-R30 VanDerWaalsContact O-N 3.14Å; A27-R30 PolarHBondContact O-N 3.42Å; T28-R30 PolarHBondContact O-N 3.41Å; R30-R32 VanDerWaalsContact C-N 3.34Å; R30-R32 PolarHBondContact O-N 2.75Å; R30-M33 PolarHBondContact O-N 3.43Å; R30-L34 WeakPolarHBondContact O-CG 3.17Å; R30-L34 PolarHBondContact O-N 2.88Å
31	W	93.6	Very high	92.8	Very high	69 Å²	69	71.9 Å²	71.9	26%	0.261	38%	0.381	S	S	.	.	H	α-helix	trans	-63.4	-39	178.3	-72.1	113.7	0	0	0	112.7	A27 T28 G29 L34 L35 L80 I85 R88 V89	A27-W31 PolarHBondContact O-N 3.36Å; A27-W31 VanDerWaalsContact O-N 3.08Å; T28-W31 PolarHBondContact O-N 2.98Å; G29-W31 PolarHBondContact O-N 3.23Å; W31-L34 HydrophobicContact CE3-CD1 4.24Å; W31-L34 HydrophobicContact CZ3-CD1 4.42Å; W31-L35 WeakPolarHBondContact O-CB 3.22Å; W31-L35 PolarHBondContact O-N 3.38Å; W31-L80 HydrophobicContact CE3-CD2 4.49Å; W31-L80 HydrophobicContact CZ3-CD2 3.84Å; W31-I85 HydrophobicContact CB-CD1 4.47Å; W31-I85 HydrophobicContact CB-CG1 4.29Å; W31-I85 HydrophobicContact CD2-CG1 4.4Å; W31-I85 HydrophobicContact CE3-CD1 3.72Å; W31-I85 HydrophobicContact CE3-CG1 3.9Å; W31-I85 HydrophobicContact CZ3-CD1 4.43Å; W31-R88 HydrophobicContact CG-CB 4.21Å; W31-V89 HydrophobicContact CB-CG1 3.61Å
32	R	94.2	Very high	93	Very high	120 Å²	120	72.7 Å²	72.7	45%	0.453	39%	0.386	S	S	.	.	H	α-helix	trans	-64	-46	175	-72.6	176.9	-178.6	-177.5	1.4	111.5	T28 G29 R30 L34 L35 I36 V89	T28-R32 HydrophobicContact CG2-CG 4.36Å; T28-R32 WeakPolarHBondContact O-CG 3.18Å; T28-R32 PolarHBondContact O-N 3.41Å; G29-R32 PolarHBondContact O-N 2.89Å; R30-R32 VanDerWaalsContact C-N 3.34Å; R30-R32 PolarHBondContact O-N 2.75Å; R32-L34 PolarHBondContact O-N 3.44Å; R32-L35 PolarHBondContact O-N 3.48Å; R32-I36 VanDerWaalsContact O-CG1 3.26Å; R32-I36 WeakPolarHBondContact O-CG1 3.39Å; R32-I36 PolarHBondContact O-N 3.11Å; R32-V89 HydrophobicContact CG-CB 4.08Å; R32-V89 HydrophobicContact CG-CG1 3.93Å; R32-V89 PolarHBondContact NH2-O 3.45Å
33	M	95.5	Very high	93.3	Very high	118 Å²	118	69.4 Å²	69.4	58%	0.581	38%	0.382	S	S	*	.	H	α-helix	trans	-61.4	-45.1	177.2	-70.2	-56.6	-64.4	0	0	111.9	G29 R30 L35 I36 V37	G29-M33 WeakPolarHBondContact O-CG 3.28Å; G29-M33 PolarHBondContact O-N 3.27Å; R30-M33 PolarHBondContact O-N 3.43Å; M33-L35 VanDerWaalsContact C-N 3.35Å; M33-L35 PolarHBondContact O-N 3.4Å; M33-I36 PolarHBondContact O-N 3.17Å; M33-V37 WeakPolarHBondContact O-CG2 3.25Å; M33-V37 PolarHBondContact O-N 2.88Å
34	L	94.3	Very high	93.5	Very high	90 Å²	90	68.1 Å²	68.1	47%	0.471	37%	0.371	S	S	.	.	H	α-helix	trans	-59.4	-45.1	175.2	-74.9	172.9	0	0	0	111.9	R30 W31 R32 I36 V37 V38	R30-L34 WeakPolarHBondContact O-CG 3.17Å; R30-L34 PolarHBondContact O-N 2.88Å; W31-L34 HydrophobicContact CE3-CD1 4.24Å; W31-L34 HydrophobicContact CZ3-CD1 4.42Å; R32-L34 PolarHBondContact O-N 3.44Å; L34-I36 VanDerWaalsContact C-N 3.34Å; L34-I36 PolarHBondContact O-N 2.81Å; L34-V37 PolarHBondContact O-N 3.48Å; L34-V38 WeakPolarHBondContact O-CB 3.49Å; L34-V38 VanDerWaalsContact O-CG2 3.32Å; L34-V38 WeakPolarHBondContact O-CG2 3.45Å; L34-V38 PolarHBondContact O-N 2.92Å
35	L	94.5	Very high	93.7	Very high	51 Å²	51	66.1 Å²	66.1	27%	0.267	36%	0.361	S	S	.	.	H	α-helix	trans	-62.8	-40.9	178.5	-174.4	65.4	0	0	0	112	W31 R32 M33 S39 L77 I85	W31-L35 WeakPolarHBondContact O-CB 3.22Å; W31-L35 PolarHBondContact O-N 3.38Å; R32-L35 PolarHBondContact O-N 3.48Å; M33-L35 VanDerWaalsContact C-N 3.35Å; M33-L35 PolarHBondContact O-N 3.4Å; L35-S39 VanDerWaalsContact O-CB 3.28Å; L35-S39 WeakPolarHBondContact O-CB 3.47Å; L35-S39 PolarHBondContact O-N 3.05Å; L35-S39 PolarHBondContact O-OG 2.91Å; L35-S39 VanDerWaalsContact O-OG 3.14Å; L35-L77 HydrophobicContact CD1-CD1 3.91Å; L35-I85 HydrophobicContact CB-CD1 4.04Å; L35-I85 HydrophobicContact CD1-CD1 4.26Å
36	I	95.6	Very high	94	Very high	92 Å²	92	62.4 Å²	62.4	47%	0.472	35%	0.347	S	S	.	.	H	α-helix	trans	-63.7	-46.7	176.2	-69.1	163.9	0	0	0	110.8	R32 M33 L34 S39 V40	R32-I36 VanDerWaalsContact O-CG1 3.26Å; R32-I36 WeakPolarHBondContact O-CG1 3.39Å; R32-I36 PolarHBondContact O-N 3.11Å; M33-I36 PolarHBondContact O-N 3.17Å; L34-I36 VanDerWaalsContact C-N 3.34Å; L34-I36 PolarHBondContact O-N 2.81Å; I36-S39 PolarHBondContact O-N 3.45Å; I36-S39 PolarHBondContact O-OG 3.47Å; I36-V40 HydrophobicContact CG2-CG2 4.48Å; I36-V40 WeakPolarHBondContact O-CB 3.36Å; I36-V40 VanDerWaalsContact O-CG2 3.29Å; I36-V40 WeakPolarHBondContact O-CG2 3.2Å; I36-V40 PolarHBondContact O-N 3.25Å
37	V	95.8	Very high	94.3	Very high	81 Å²	81	67.6 Å²	67.6	49%	0.491	36%	0.359	S	S	.	.	H	α-helix	trans	-62	-49.3	179.9	170.4	0	0	0	0	110.4	M33 L34 S39 V40 C41	M33-V37 WeakPolarHBondContact O-CG2 3.25Å; M33-V37 PolarHBondContact O-N 2.88Å; L34-V37 PolarHBondContact O-N 3.48Å; V37-S39 VanDerWaalsContact C-N 3.34Å; V37-S39 PolarHBondContact O-N 3.14Å; V37-V40 PolarHBondContact O-N 3.1Å; V37-C41 WeakPolarHBondContact O-CB 3.34Å; V37-C41 PolarHBondContact O-N 3.03Å; V37-C41 PolarHBondContact O-SG 3.38Å
38	V	95.6	Very high	94.3	Very high	19 Å²	19	70.5 Å²	70.5	12%	0.115	37%	0.369	C	S	.	.	H	α-helix	trans	-64.1	-38.9	-179.5	174.6	0	0	0	0	111.4	L34 C41 T42 T76 L77 L80	L34-V38 WeakPolarHBondContact O-CB 3.49Å; L34-V38 VanDerWaalsContact O-CG2 3.32Å; L34-V38 WeakPolarHBondContact O-CG2 3.45Å; L34-V38 PolarHBondContact O-N 2.92Å; V38-C41 PolarHBondContact O-N 3.34Å; V38-T42 WeakPolarHBondContact O-CB 3.42Å; V38-T42 PolarHBondContact O-N 3.05Å; V38-T42 PolarHBondContact O-OG1 3.48Å; V38-T76 HydrophobicContact CG1-CG2 4.28Å; V38-T76 HydrophobicContact CG2-CG2 3.91Å; V38-L77 HydrophobicContact CG1-CB 3.84Å; V38-L77 HydrophobicContact CG1-CD1 4.13Å; V38-L80 HydrophobicContact CB-CD1 4.47Å; V38-L80 HydrophobicContact CG2-CD1 4.14Å
39	S	95.1	Very high	94.3	Very high	54 Å²	54	71.9 Å²	71.9	38%	0.378	37%	0.373	S	S	.	.	H	α-helix	trans	-66.9	-41.4	178.3	68	0	0	0	0	112.2	L35 I36 V37 T42 A43	L35-S39 VanDerWaalsContact O-CB 3.28Å; L35-S39 WeakPolarHBondContact O-CB 3.47Å; L35-S39 PolarHBondContact O-N 3.05Å; L35-S39 PolarHBondContact O-OG 2.91Å; L35-S39 VanDerWaalsContact O-OG 3.14Å; I36-S39 PolarHBondContact O-N 3.45Å; I36-S39 PolarHBondContact O-OG 3.47Å; V37-S39 VanDerWaalsContact C-N 3.34Å; V37-S39 PolarHBondContact O-N 3.14Å; S39-T42 PolarHBondContact O-N 2.9Å; S39-A43 WeakPolarHBondContact O-CB 3.5Å; S39-A43 PolarHBondContact O-N 3.02Å
40	V	96.9	Very high	94.3	Very high	81 Å²	81	76.2 Å²	76.2	49%	0.491	39%	0.388	S	S	.	.	H	α-helix	trans	-63.4	-46.3	174.7	171.9	0	0	0	0	110.7	I36 V37 T42 A43 T44	I36-V40 HydrophobicContact CG2-CG2 4.48Å; I36-V40 WeakPolarHBondContact O-CB 3.36Å; I36-V40 VanDerWaalsContact O-CG2 3.29Å; I36-V40 WeakPolarHBondContact O-CG2 3.2Å; I36-V40 PolarHBondContact O-N 3.25Å; V37-V40 PolarHBondContact O-N 3.1Å; V40-T42 VanDerWaalsContact C-N 3.29Å; V40-T42 PolarHBondContact O-N 3.1Å; V40-A43 PolarHBondContact O-N 3.25Å; V40-T44 HydrophobicContact CG1-CG2 4.48Å; V40-T44 WeakPolarHBondContact O-CG2 3.41Å; V40-T44 PolarHBondContact O-N 3.27Å; V40-T44 PolarHBondContact O-OG1 2.93Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å
41	C	95.3	Very high	94.3	Very high	38 Å²	38	72.9 Å²	72.9	26%	0.257	38%	0.383	S	S	.	.	H	α-helix	trans	-60.3	-39.1	175.3	-67.8	0	0	0	0	112.3	V37 V38 T44 G45 F69	V37-C41 WeakPolarHBondContact O-CB 3.34Å; V37-C41 PolarHBondContact O-N 3.03Å; V37-C41 PolarHBondContact O-SG 3.38Å; V38-C41 PolarHBondContact O-N 3.34Å; C41-T44 PolarHBondContact O-OG1 3.4Å; C41-G45 PolarHBondContact O-N 3.46Å; C41-F69 HydrophobicContact CB-CE1 4.23Å; C41-F69 HydrophobicContact CB-CZ 3.88Å; C41-F69 WeakPolarHBondContact O-CE1 3.29Å
42	T	95.7	Very high	94.1	Very high	20 Å²	20	71.6 Å²	71.6	12%	0.123	38%	0.381	C	S	.	.	H	α-helix	trans	-66.4	-42.9	176.9	-53.1	0	0	0	0	110.6	V38 S39 V40 G45 A46 F70	V38-T42 WeakPolarHBondContact O-CB 3.42Å; V38-T42 PolarHBondContact O-N 3.05Å; V38-T42 PolarHBondContact O-OG1 3.48Å; S39-T42 PolarHBondContact O-N 2.9Å; V40-T42 VanDerWaalsContact C-N 3.29Å; V40-T42 PolarHBondContact O-N 3.1Å; T42-G45 PolarHBondContact O-N 3.44Å; T42-A46 WeakPolarHBondContact O-CB 3.32Å; T42-A46 PolarHBondContact O-N 3.29Å; T42-F70 HydrophobicContact CG2-CE2 4.09Å
43	A	96.4	Very high	93.7	Very high	62 Å²	62	69.7 Å²	69.7	51%	0.512	38%	0.384	S	S	.	.	H	α-helix	trans	-66.1	-44.3	179.9	0	0	0	0	0	112.3	S39 V40 A46 W47	S39-A43 WeakPolarHBondContact O-CB 3.5Å; S39-A43 PolarHBondContact O-N 3.02Å; V40-A43 PolarHBondContact O-N 3.25Å; A43-A46 PolarHBondContact O-N 3.4Å; A43-W47 WeakPolarHBondContact O-CB 3.47Å; A43-W47 PolarHBondContact O-N 2.94Å
44	T	95	Very high	93.2	Very high	67 Å²	67	68.1 Å²	68.1	41%	0.411	38%	0.375	S	S	.	.	H	α-helix	trans	-69.6	-38.4	176.4	56.4	0	0	0	0	111.9	V40 C41 W47 N48	V40-T44 HydrophobicContact CG1-CG2 4.48Å; V40-T44 WeakPolarHBondContact O-CG2 3.41Å; V40-T44 PolarHBondContact O-N 3.27Å; V40-T44 PolarHBondContact O-OG1 2.93Å; V40-T44 VanDerWaalsContact O-OG1 3.1Å; C41-T44 PolarHBondContact O-OG1 3.4Å; T44-W47 PolarHBondContact O-N 2.69Å; T44-N48 PolarHBondContact O-N 3.42Å; T44-N48 VanDerWaalsContact O-N 3.11Å; T44-N48 PolarHBondContact O-ND2 3.41Å
45	G	93.8	Very high	92.7	Very high	3 Å²	3	65 Å²	65	3%	0.031	36%	0.36	C	S	.	.	H	α-helix	trans	-60.5	-46.2	172	0	0	0	0	0	111.9	C41 T42 W47 N48 W49	C41-G45 PolarHBondContact O-N 3.46Å; T42-G45 PolarHBondContact O-N 3.44Å; G45-W47 VanDerWaalsContact C-N 3.35Å; G45-W47 PolarHBondContact O-N 2.86Å; G45-N48 PolarHBondContact O-N 2.89Å; G45-W49 VanDerWaalsContact O-CB 3.27Å; G45-W49 WeakPolarHBondContact O-CB 3.37Å; G45-W49 PolarHBondContact O-N 3.23Å
46	A	94.5	Very high	92.1	Very high	22 Å²	22	71 Å²	71	18%	0.182	39%	0.386	C	S	.	.	H	α-helix	trans	-62.4	-41.9	177.2	0	0	0	0	0	111.8	T42 A43 W49 L50 F70	T42-A46 WeakPolarHBondContact O-CB 3.32Å; T42-A46 PolarHBondContact O-N 3.29Å; A43-A46 PolarHBondContact O-N 3.4Å; A46-W49 PolarHBondContact O-N 2.95Å; A46-L50 WeakPolarHBondContact O-CB 3.42Å; A46-L50 VanDerWaalsContact O-CG 3.22Å; A46-L50 WeakPolarHBondContact O-CG 3.47Å; A46-L50 PolarHBondContact O-N 3.45Å; A46-F70 HydrophobicContact CB-CD2 4.06Å; A46-F70 HydrophobicContact CB-CE2 3.63Å; A46-F70 HydrophobicContact CB-CZ 4.34Å
47	W	93.2	Very high	91.7	Very high	174 Å²	174	73.4 Å²	73.4	66%	0.659	39%	0.394	S	S	*	.	H	α-helix	trans	-59.5	-48.7	177.2	-174.5	-94.3	0	0	0	112	A43 T44 G45 W49 L50 I51	A43-W47 WeakPolarHBondContact O-CB 3.47Å; A43-W47 PolarHBondContact O-N 2.94Å; T44-W47 PolarHBondContact O-N 2.69Å; G45-W47 VanDerWaalsContact C-N 3.35Å; G45-W47 PolarHBondContact O-N 2.86Å; W47-W49 VanDerWaalsContact C-N 3.32Å; W47-W49 PolarHBondContact O-N 3.26Å; W47-L50 PolarHBondContact O-N 3.08Å; W47-I51 HydrophobicContact CD2-CD1 4.17Å; W47-I51 VanDerWaalsContact CE2-CD1 3.48Å; W47-I51 HydrophobicContact CG-CD1 4.32Å; W47-I51 HydrophobicContact CZ2-CD1 3.86Å; W47-I51 WeakPolarHBondContact O-CG1 3.47Å; W47-I51 PolarHBondContact O-N 3.46Å
48	N	91.2	Very high	91.5	Very high	104 Å²	104	71.9 Å²	71.9	56%	0.556	38%	0.384	S	S	*	.	H	α-helix	trans	-63.2	-39.9	176.2	-73.2	-57.9	0	0	0	112	T44 G45 D52	T44-N48 PolarHBondContact O-N 3.42Å; T44-N48 VanDerWaalsContact O-N 3.11Å; T44-N48 PolarHBondContact O-ND2 3.41Å; G45-N48 PolarHBondContact O-N 2.89Å; N48-D52 PolarHBondContact O-N 3.33Å
49	W	91.6	Very high	91.2	Very high	37 Å²	37	74.2 Å²	74.2	14%	0.14	40%	0.401	C	S	.	.	H	α-helix	trans	-64.2	-39.9	178.7	-179.1	54.9	0	0	0	113.1	G45 A46 W47 T55 F60 S63 H67 F70	G45-W49 VanDerWaalsContact O-CB 3.27Å; G45-W49 WeakPolarHBondContact O-CB 3.37Å; G45-W49 PolarHBondContact O-N 3.23Å; A46-W49 PolarHBondContact O-N 2.95Å; W47-W49 VanDerWaalsContact C-N 3.32Å; W47-W49 PolarHBondContact O-N 3.26Å; W49-T55 HydrophobicContact CD2-CG2 4.4Å; W49-T55 HydrophobicContact CZ2-CG2 3.88Å; W49-T55 PolarHBondContact O-OG1 3.35Å; W49-F60 HydrophobicContact CH2-CD2 4.14Å; W49-F60 AromaticContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CZ2-CD2 4.05Å; W49-F60 AromaticContact CZ2-CE2 3.91Å; W49-F60 HydrophobicContact CZ2-CE2 3.91Å; W49-S63 PolarHBondContact NE1-OG 3.23Å; W49-H67 AromaticContact CD1-CD2 3.32Å; W49-H67 AromaticContact CD1-CG 3.5Å; W49-H67 VanDerWaalsContact CD1-CG 3.5Å; W49-H67 AromaticContact CD1-NE2 3.82Å; W49-H67 AromaticContact NE1-CD2 3.95Å; W49-F70 HydrophobicContact CB-CD1 4.3Å; W49-F70 HydrophobicContact CB-CG 4.43Å; W49-F70 HydrophobicContact CD2-CD1 4Å; W49-F70 AromaticContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CE3-CD1 4.26Å; W49-F70 AromaticContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CZ 4.09Å; W49-F70 HydrophobicContact CG-CD1 4.01Å; W49-F70 HydrophobicContact CG-CE1 4.33Å; W49-F70 HydrophobicContact CZ3-CE1 4.16Å; W49-F70 HydrophobicContact CZ3-CZ 4.49Å
50	L	90.7	Very high	90.9	Very high	120 Å²	120	77.4 Å²	77.4	63%	0.628	41%	0.409	S	S	*	.	H	α-helix	trans	-74.8	-28.1	-178.6	-73.8	171.5	0	0	0	113.7	A46 W47	A46-L50 WeakPolarHBondContact O-CB 3.42Å; A46-L50 VanDerWaalsContact O-CG 3.22Å; A46-L50 WeakPolarHBondContact O-CG 3.47Å; A46-L50 PolarHBondContact O-N 3.45Å; W47-L50 PolarHBondContact O-N 3.08Å
51	I	91.2	Very high	90.6	Very high	109 Å²	109	81 Å²	81	56%	0.559	42%	0.418	S	S	*	.	H	α-helix	trans	-84.7	-19.6	178.7	-67.9	175.5	0	0	0	111.7	W47 P53	W47-I51 HydrophobicContact CD2-CD1 4.17Å; W47-I51 VanDerWaalsContact CE2-CD1 3.48Å; W47-I51 HydrophobicContact CG-CD1 4.32Å; W47-I51 HydrophobicContact CZ2-CD1 3.86Å; W47-I51 WeakPolarHBondContact O-CG1 3.47Å; W47-I51 PolarHBondContact O-N 3.46Å; I51-P53 VanDerWaalsContact O-CD 3.28Å; I51-P53 WeakPolarHBondContact O-CD 3.28Å
52	D	89.2	Confident	90.3	Very high	42 Å²	42	82.3 Å²	82.3	23%	0.225	43%	0.425	C	S	.	.			trans	-66.9	115.6	179.9	-178.9	9.3	0	0	0	111.6	N48 E54 T55 H67	N48-D52 PolarHBondContact O-N 3.33Å; D52-E54 PolarHBondContact O-N 3.46Å; D52-E54 WeakPolarHBondContact OD1-CB 3.41Å; D52-E54 PolarHBondContact OD1-N 3.27Å; D52-T55 VanDerWaalsContact O-CB 3.28Å; D52-T55 WeakPolarHBondContact O-CB 3.2Å; D52-T55 PolarHBondContact O-N 3.47Å; D52-T55 VanDerWaalsContact O-N 3.17Å; D52-H67 IonicContact OD2-CD2 3.16Å; D52-H67 IonicContact OD2-CE1 2.71Å; D52-H67 PolarHBondContact OD2-CE1 2.94Å; D52-H67 IonicContact OD2-NE2 2.68Å; D52-H67 PolarHBondContact OD2-NE2 2.94Å
53	P	86.8	Confident	90.1	Very high	79 Å²	79	81.4 Å²	81.4	51%	0.513	42%	0.419	S	S	.	.	G	3₁₀ helix	trans	-64.1	-24.2	178.1	27.6	-36.2	0	0	0	113.2	I51 T55 Q56	I51-P53 VanDerWaalsContact O-CD 3.28Å; I51-P53 WeakPolarHBondContact O-CD 3.28Å; P53-T55 VanDerWaalsContact C-N 3.27Å; P53-T55 PolarHBondContact O-N 2.95Å; P53-Q56 PolarHBondContact O-N 2.94Å
54	E	84.8	Confident	89.8	Confident	85 Å²	85	80 Å²	80	40%	0.397	40%	0.403	S	S	.	.	G	3₁₀ helix	trans	-70.4	-26.1	178	-62.4	-55.4	124.6	0	0	111.9	D52 Q56 K57 V58	D52-E54 PolarHBondContact O-N 3.46Å; D52-E54 WeakPolarHBondContact OD1-CB 3.41Å; D52-E54 PolarHBondContact OD1-N 3.27Å; E54-Q56 PolarHBondContact O-N 2.96Å; E54-K57 PolarHBondContact O-N 3.5Å; E54-K57 IonicContact OE1-NZ 3.84Å; E54-K57 PolarHBondContact OE1-NZ 3.3Å; E54-K57 IonicContact OE2-NZ 3.99Å; E54-V58 PolarHBondContact O-N 2.94Å
55	T	83.3	Confident	89.6	Confident	25 Å²	25	87.3 Å²	87.3	15%	0.153	42%	0.423	C	S	.	.	G	3₁₀ helix	trans	-57.7	-32.4	175.3	-66.1	0	0	0	0	112.4	W49 D52 P53 S63	W49-T55 HydrophobicContact CD2-CG2 4.4Å; W49-T55 HydrophobicContact CZ2-CG2 3.88Å; W49-T55 PolarHBondContact O-OG1 3.35Å; D52-T55 VanDerWaalsContact O-CB 3.28Å; D52-T55 WeakPolarHBondContact O-CB 3.2Å; D52-T55 PolarHBondContact O-N 3.47Å; D52-T55 VanDerWaalsContact O-N 3.17Å; P53-T55 VanDerWaalsContact C-N 3.27Å; P53-T55 PolarHBondContact O-N 2.95Å; T55-S63 WeakPolarHBondContact CG2-OG 3.3Å; T55-S63 PolarHBondContact OG1-OG 3.3Å
56	Q	82.3	Confident	89.4	Confident	176 Å²	176	91.5 Å²	91.5	82%	0.822	45%	0.445	S	S	*	.	G	3₁₀ helix	trans	-80.1	-18.5	179.2	-64.1	-175	-19.7	0	0	113.7	P53 E54	P53-Q56 PolarHBondContact O-N 2.94Å; E54-Q56 PolarHBondContact O-N 2.96Å
57	K	88.1	Confident	89.3	Confident	144 Å²	144	92 Å²	92	63%	0.626	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.9	-25.8	-174.5	-61.9	177.3	-171.3	168.5	0	113	E54	E54-K57 PolarHBondContact O-N 3.5Å; E54-K57 IonicContact OE1-NZ 3.84Å; E54-K57 PolarHBondContact OE1-NZ 3.3Å; E54-K57 IonicContact OE2-NZ 3.99Å
58	V	90.2	Very high	89.3	Confident	48 Å²	48	87.4 Å²	87.4	29%	0.291	44%	0.436	S	S	.	.	S	Bend	trans	-104	162.8	-177.9	-56.2	0	0	0	0	111.4	E54 T62	E54-V58 PolarHBondContact O-N 2.94Å; V58-T62 HydrophobicContact CB-CG2 4.06Å; V58-T62 HydrophobicContact CG1-CG2 4.48Å; V58-T62 HydrophobicContact CG2-CG2 4.31Å
59	S	90.4	Very high	89.3	Confident	68 Å²	68	88.1 Å²	88.1	48%	0.476	43%	0.434	S	S	.	.			trans	-63.3	154.9	173.9	85.2	0	0	0	0	111.5	F61 T62 S63	S59-F61 PolarHBondContact O-N 3.35Å; S59-T62 WeakPolarHBondContact O-CB 3.26Å; S59-T62 PolarHBondContact O-N 2.92Å; S59-T62 VanDerWaalsContact O-N 3.11Å; S59-T62 WeakPolarHBondContact OG-CB 2.89Å; S59-T62 PolarHBondContact OG-N 3Å; S59-T62 PolarHBondContact OG-OG1 3.36Å; S59-S63 PolarHBondContact O-N 2.94Å
60	F	88.3	Confident	89.3	Confident	122 Å²	122	87.5 Å²	87.5	54%	0.535	43%	0.433	S	S	.	.	H	α-helix	trans	-53.4	-48.9	-178.7	176.7	-104.6	0	0	0	113.2	W49 T62 S63 L64	W49-F60 HydrophobicContact CH2-CD2 4.14Å; W49-F60 AromaticContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CH2-CE2 3.7Å; W49-F60 HydrophobicContact CZ2-CD2 4.05Å; W49-F60 AromaticContact CZ2-CE2 3.91Å; W49-F60 HydrophobicContact CZ2-CE2 3.91Å; F60-T62 VanDerWaalsContact C-N 3.35Å; F60-T62 PolarHBondContact O-N 3.14Å; F60-S63 WeakPolarHBondContact O-CB 3.34Å; F60-S63 PolarHBondContact O-N 3.02Å; F60-L64 HydrophobicContact CD1-CD1 4.07Å; F60-L64 HydrophobicContact CE1-CD1 3.47Å; F60-L64 VanDerWaalsContact CE1-CD1 3.47Å; F60-L64 HydrophobicContact CE1-CG 4.16Å; F60-L64 HydrophobicContact CE2-CD1 4.46Å; F60-L64 HydrophobicContact CE2-CD2 4.37Å; F60-L64 HydrophobicContact CE2-CG 4.38Å; F60-L64 HydrophobicContact CZ-CD1 3.7Å; F60-L64 HydrophobicContact CZ-CD2 4.21Å; F60-L64 HydrophobicContact CZ-CG 4.08Å; F60-L64 WeakPolarHBondContact O-CG 3.28Å; F60-L64 PolarHBondContact O-N 2.92Å
61	F	90	Very high	89.5	Confident	156 Å²	156	83.2 Å²	83.2	68%	0.684	41%	0.412	S	S	*	.	H	α-helix	trans	-65.9	-36.3	179.3	-69.2	-72.8	0	0	0	112.8	S59 S63 L64 W65	S59-F61 PolarHBondContact O-N 3.35Å; F61-S63 VanDerWaalsContact C-N 3.35Å; F61-L64 PolarHBondContact O-N 3.39Å; F61-W65 PolarHBondContact O-N 3.42Å; F61-W65 VanDerWaalsContact O-N 3.15Å
62	T	90.6	Very high	89.6	Confident	65 Å²	65	83.1 Å²	83.1	40%	0.399	41%	0.411	S	S	.	.	H	α-helix	trans	-65	-42.2	173.3	-51.7	0	0	0	0	110.8	V58 S59 F60 L64 W65 N66	V58-T62 HydrophobicContact CB-CG2 4.06Å; V58-T62 HydrophobicContact CG1-CG2 4.48Å; V58-T62 HydrophobicContact CG2-CG2 4.31Å; S59-T62 WeakPolarHBondContact O-CB 3.26Å; S59-T62 PolarHBondContact O-N 2.92Å; S59-T62 VanDerWaalsContact O-N 3.11Å; S59-T62 WeakPolarHBondContact OG-CB 2.89Å; S59-T62 PolarHBondContact OG-N 3Å; S59-T62 PolarHBondContact OG-OG1 3.36Å; F60-T62 VanDerWaalsContact C-N 3.35Å; F60-T62 PolarHBondContact O-N 3.14Å; T62-L64 VanDerWaalsContact C-N 3.34Å; T62-L64 PolarHBondContact O-N 3.33Å; T62-W65 WeakPolarHBondContact O-CB 3.29Å; T62-W65 PolarHBondContact O-N 3.03Å; T62-W65 VanDerWaalsContact O-N 3.15Å; T62-N66 PolarHBondContact O-N 3.1Å
63	S	90.8	Very high	89.9	Confident	1 Å²	1	81.6 Å²	81.6	1%	0.007	40%	0.404	C	S	.	.	H	α-helix	trans	-61.1	-43.3	176.4	-174.1	0	0	0	0	111.5	W49 T55 S59 F60 F61 W65 N66 H67	W49-S63 PolarHBondContact NE1-OG 3.23Å; T55-S63 WeakPolarHBondContact CG2-OG 3.3Å; T55-S63 PolarHBondContact OG1-OG 3.3Å; S59-S63 PolarHBondContact O-N 2.94Å; F60-S63 WeakPolarHBondContact O-CB 3.34Å; F60-S63 PolarHBondContact O-N 3.02Å; F61-S63 VanDerWaalsContact C-N 3.35Å; S63-W65 VanDerWaalsContact C-N 3.28Å; S63-W65 PolarHBondContact O-N 3.24Å; S63-N66 WeakPolarHBondContact O-CB 3.4Å; S63-N66 PolarHBondContact O-N 3.28Å; S63-N66 VanDerWaalsContact O-N 3.08Å; S63-H67 PolarHBondContact O-CD2 2.91Å; S63-H67 VanDerWaalsContact O-CD2 3.32Å; S63-H67 PolarHBondContact O-N 3Å; S63-H67 VanDerWaalsContact O-N 3.15Å
64	L	90.4	Very high	90.3	Very high	33 Å²	33	79.3 Å²	79.3	17%	0.173	39%	0.389	C	S	.	.	H	α-helix	trans	-59.9	-37.6	174.7	-69.9	-177.9	0	0	0	112.6	F60 F61 T62 N66 H67 F70 T71	F60-L64 HydrophobicContact CD1-CD1 4.07Å; F60-L64 HydrophobicContact CE1-CD1 3.47Å; F60-L64 VanDerWaalsContact CE1-CD1 3.47Å; F60-L64 HydrophobicContact CE1-CG 4.16Å; F60-L64 HydrophobicContact CE2-CD1 4.46Å; F60-L64 HydrophobicContact CE2-CD2 4.37Å; F60-L64 HydrophobicContact CE2-CG 4.38Å; F60-L64 HydrophobicContact CZ-CD1 3.7Å; F60-L64 HydrophobicContact CZ-CD2 4.21Å; F60-L64 HydrophobicContact CZ-CG 4.08Å; F60-L64 WeakPolarHBondContact O-CG 3.28Å; F60-L64 PolarHBondContact O-N 2.92Å; F61-L64 PolarHBondContact O-N 3.39Å; T62-L64 VanDerWaalsContact C-N 3.34Å; T62-L64 PolarHBondContact O-N 3.33Å; L64-N66 VanDerWaalsContact C-N 3.34Å; L64-H67 CarbonylContact O-C 3.44Å; L64-H67 PolarHBondContact O-N 2.9Å; L64-F70 HydrophobicContact CD2-CD1 4.05Å; L64-F70 HydrophobicContact CD2-CE1 3.92Å; L64-T71 PolarHBondContact O-OG1 3.06Å
65	W	89.9	Confident	90.8	Very high	220 Å²	220	80.5 Å²	80.5	83%	0.833	40%	0.397	S	S	*	.	H	α-helix	trans	-66.5	-34.4	174.4	-99.1	99.8	0	0	0	113.1	F61 T62 S63 H67	F61-W65 PolarHBondContact O-N 3.42Å; F61-W65 VanDerWaalsContact O-N 3.15Å; T62-W65 WeakPolarHBondContact O-CB 3.29Å; T62-W65 PolarHBondContact O-N 3.03Å; T62-W65 VanDerWaalsContact O-N 3.15Å; S63-W65 VanDerWaalsContact C-N 3.28Å; S63-W65 PolarHBondContact O-N 3.24Å; W65-H67 VanDerWaalsContact C-N 3.25Å; W65-H67 PolarHBondContact O-N 3.22Å
66	N	90.7	Very high	91.4	Very high	91 Å²	91	82.1 Å²	82.1	49%	0.487	41%	0.407	S	S	.	.	H	α-helix	trans	-71.5	-21.4	176.7	-67.4	-11.7	0	0	0	112.8	T62 S63 L64 P68	T62-N66 PolarHBondContact O-N 3.1Å; S63-N66 WeakPolarHBondContact O-CB 3.4Å; S63-N66 PolarHBondContact O-N 3.28Å; S63-N66 VanDerWaalsContact O-N 3.08Å; L64-N66 VanDerWaalsContact C-N 3.34Å; N66-P68 WeakPolarHBondContact O-CD 3.41Å
67	H	92.2	Very high	92	Very high	34 Å²	34	75.5 Å²	75.5	16%	0.157	38%	0.377	C	S	.	.			trans	-116.2	66	-177.6	-70.9	-84.6	0	0	0	112.1	W49 D52 S63 L64 W65 F69 F70 T71	W49-H67 AromaticContact CD1-CD2 3.32Å; W49-H67 AromaticContact CD1-CG 3.5Å; W49-H67 VanDerWaalsContact CD1-CG 3.5Å; W49-H67 AromaticContact CD1-NE2 3.82Å; W49-H67 AromaticContact NE1-CD2 3.95Å; D52-H67 IonicContact OD2-CD2 3.16Å; D52-H67 IonicContact OD2-CE1 2.71Å; D52-H67 PolarHBondContact OD2-CE1 2.94Å; D52-H67 IonicContact OD2-NE2 2.68Å; D52-H67 PolarHBondContact OD2-NE2 2.94Å; S63-H67 PolarHBondContact O-CD2 2.91Å; S63-H67 VanDerWaalsContact O-CD2 3.32Å; S63-H67 PolarHBondContact O-N 3Å; S63-H67 VanDerWaalsContact O-N 3.15Å; L64-H67 CarbonylContact O-C 3.44Å; L64-H67 PolarHBondContact O-N 2.9Å; W65-H67 VanDerWaalsContact C-N 3.25Å; W65-H67 PolarHBondContact O-N 3.22Å; H67-F69 VanDerWaalsContact C-N 3.28Å; H67-F69 PolarHBondContact O-N 3.26Å; H67-F70 HydrophobicContact CB-CB 4.35Å; H67-F70 PolarHBondContact O-N 3.5Å; H67-T71 PolarHBondContact O-N 3.04Å; H67-T71 PolarHBondContact O-OG1 3.02Å
68	P	91.6	Very high	92.3	Very high	76 Å²	76	73 Å²	73	49%	0.494	37%	0.37	S	S	.	.	H	α-helix	trans	-62.1	-32.5	-172.1	24.4	-34.8	0	0	0	113.3	N66 T71 I72	N66-P68 WeakPolarHBondContact O-CD 3.41Å; P68-T71 PolarHBondContact O-N 3.11Å; P68-I72 WeakPolarHBondContact O-CB 3.43Å; P68-I72 WeakPolarHBondContact O-CG1 3.12Å; P68-I72 PolarHBondContact O-N 3.39Å
69	F	91.5	Very high	92.5	Very high	119 Å²	119	72.6 Å²	72.6	52%	0.522	38%	0.375	S	S	.	.	H	α-helix	trans	-63.2	-44.4	178.1	-177.2	-98.3	0	0	0	112.3	C41 H67 S73	C41-F69 HydrophobicContact CB-CE1 4.23Å; C41-F69 HydrophobicContact CB-CZ 3.88Å; C41-F69 WeakPolarHBondContact O-CE1 3.29Å; H67-F69 VanDerWaalsContact C-N 3.28Å; H67-F69 PolarHBondContact O-N 3.26Å; F69-S73 WeakPolarHBondContact O-CB 3.44Å; F69-S73 PolarHBondContact O-N 3.3Å; F69-S73 PolarHBondContact O-OG 2.77Å
70	F	92.9	Very high	92.7	Very high	25 Å²	25	70.6 Å²	70.6	11%	0.11	36%	0.359	C	S	.	.	H	α-helix	trans	-67.3	-44.8	175.4	174.8	-118.6	0	0	0	111	T42 A46 W49 L64 H67 I72 S73 C74	T42-F70 HydrophobicContact CG2-CE2 4.09Å; A46-F70 HydrophobicContact CB-CD2 4.06Å; A46-F70 HydrophobicContact CB-CE2 3.63Å; A46-F70 HydrophobicContact CB-CZ 4.34Å; W49-F70 HydrophobicContact CB-CD1 4.3Å; W49-F70 HydrophobicContact CB-CG 4.43Å; W49-F70 HydrophobicContact CD2-CD1 4Å; W49-F70 AromaticContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CD2-CE1 3.85Å; W49-F70 HydrophobicContact CE3-CD1 4.26Å; W49-F70 AromaticContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CE1 3.69Å; W49-F70 HydrophobicContact CE3-CZ 4.09Å; W49-F70 HydrophobicContact CG-CD1 4.01Å; W49-F70 HydrophobicContact CG-CE1 4.33Å; W49-F70 HydrophobicContact CZ3-CE1 4.16Å; W49-F70 HydrophobicContact CZ3-CZ 4.49Å; L64-F70 HydrophobicContact CD2-CD1 4.05Å; L64-F70 HydrophobicContact CD2-CE1 3.92Å; H67-F70 HydrophobicContact CB-CB 4.35Å; H67-F70 PolarHBondContact O-N 3.5Å; F70-I72 PolarHBondContact O-N 3.28Å; F70-S73 WeakPolarHBondContact CA-OG 3.44Å; F70-S73 PolarHBondContact O-N 3.46Å; F70-S73 PolarHBondContact O-OG 3.14Å; F70-C74 WeakPolarHBondContact CE2-SG 3.39Å; F70-C74 WeakPolarHBondContact CZ-SG 3.33Å; F70-C74 WeakPolarHBondContact O-CB 3.35Å; F70-C74 PolarHBondContact O-N 2.99Å; F70-C74 PolarHBondContact O-SG 2.84Å
71	T	93.6	Very high	92.9	Very high	30 Å²	30	70.8 Å²	70.8	18%	0.184	36%	0.36	C	S	.	.	H	α-helix	trans	-63.4	-45.2	-178.8	-61.4	0	0	0	0	112.4	L64 H67 P68 C74 I75	L64-T71 PolarHBondContact O-OG1 3.06Å; H67-T71 PolarHBondContact O-N 3.04Å; H67-T71 PolarHBondContact O-OG1 3.02Å; P68-T71 PolarHBondContact O-N 3.11Å; T71-C74 PolarHBondContact O-N 3.3Å; T71-I75 HydrophobicContact CG2-CD1 3.86Å; T71-I75 VanDerWaalsContact O-CG1 3.27Å; T71-I75 WeakPolarHBondContact O-CG1 3.19Å; T71-I75 PolarHBondContact O-N 3.38Å
72	I	94.9	Very high	93.1	Very high	107 Å²	107	71.9 Å²	71.9	55%	0.549	37%	0.365	S	S	.	.	H	α-helix	trans	-65.2	-41.1	178.4	-67.2	167	0	0	0	111.3	P68 F70 I75 T76	P68-I72 WeakPolarHBondContact O-CB 3.43Å; P68-I72 WeakPolarHBondContact O-CG1 3.12Å; P68-I72 PolarHBondContact O-N 3.39Å; F70-I72 PolarHBondContact O-N 3.28Å; I72-I75 PolarHBondContact O-N 3.01Å; I72-T76 WeakPolarHBondContact O-CB 3.47Å; I72-T76 PolarHBondContact O-N 2.82Å; I72-T76 PolarHBondContact O-OG1 3.05Å
73	S	94.8	Very high	93.2	Very high	9 Å²	9	71.3 Å²	71.3	6%	0.063	37%	0.367	C	S	.	.	H	α-helix	trans	-66	-41.7	178	52.6	0	0	0	0	111.8	F69 F70 T76 L77	F69-S73 WeakPolarHBondContact O-CB 3.44Å; F69-S73 PolarHBondContact O-N 3.3Å; F69-S73 PolarHBondContact O-OG 2.77Å; F70-S73 WeakPolarHBondContact CA-OG 3.44Å; F70-S73 PolarHBondContact O-N 3.46Å; F70-S73 PolarHBondContact O-OG 3.14Å; S73-T76 PolarHBondContact O-N 3.42Å; S73-L77 WeakPolarHBondContact O-CB 3.44Å; S73-L77 PolarHBondContact O-N 3.1Å
74	C	95	Very high	93.2	Very high	31 Å²	31	72.5 Å²	72.5	21%	0.209	38%	0.379	C	S	.	.	H	α-helix	trans	-59.2	-49	171.3	-78.8	0	0	0	0	112.8	F70 T71 T76 L77 I78	F70-C74 WeakPolarHBondContact CE2-SG 3.39Å; F70-C74 WeakPolarHBondContact CZ-SG 3.33Å; F70-C74 WeakPolarHBondContact O-CB 3.35Å; F70-C74 PolarHBondContact O-N 2.99Å; F70-C74 PolarHBondContact O-SG 2.84Å; T71-C74 PolarHBondContact O-N 3.3Å; C74-T76 VanDerWaalsContact C-N 3.31Å; C74-T76 PolarHBondContact O-N 2.93Å; C74-L77 PolarHBondContact O-N 3.31Å; C74-I78 VanDerWaalsContact O-CG1 3.28Å; C74-I78 WeakPolarHBondContact O-CG1 3.5Å; C74-I78 PolarHBondContact O-N 3.43Å
75	I	95.5	Very high	93.3	Very high	110 Å²	110	71 Å²	71	56%	0.564	37%	0.371	S	S	*	.	H	α-helix	trans	-61	-43	178	-70.1	168.5	0	0	0	110.5	T71 I72 L77 I78 G79	T71-I75 HydrophobicContact CG2-CD1 3.86Å; T71-I75 VanDerWaalsContact O-CG1 3.27Å; T71-I75 WeakPolarHBondContact O-CG1 3.19Å; T71-I75 PolarHBondContact O-N 3.38Å; I72-I75 PolarHBondContact O-N 3.01Å; I75-L77 PolarHBondContact O-N 2.96Å; I75-I78 PolarHBondContact O-N 3.34Å; I75-G79 PolarHBondContact O-N 3.23Å
76	T	94.9	Very high	93.3	Very high	60 Å²	60	66 Å²	66	37%	0.368	36%	0.357	S	S	.	.	H	α-helix	trans	-61	-46.3	176.8	-57.5	0	0	0	0	110.6	V38 I72 S73 C74 I78 G79 L80	V38-T76 HydrophobicContact CG1-CG2 4.28Å; V38-T76 HydrophobicContact CG2-CG2 3.91Å; I72-T76 WeakPolarHBondContact O-CB 3.47Å; I72-T76 PolarHBondContact O-N 2.82Å; I72-T76 PolarHBondContact O-OG1 3.05Å; S73-T76 PolarHBondContact O-N 3.42Å; C74-T76 VanDerWaalsContact C-N 3.31Å; C74-T76 PolarHBondContact O-N 2.93Å; T76-I78 PolarHBondContact O-N 2.9Å; T76-G79 PolarHBondContact O-N 2.88Å; T76-L80 HydrophobicContact CG2-CD1 4.34Å; T76-L80 HydrophobicContact CG2-CG 4.48Å; T76-L80 VanDerWaalsContact O-CG 3.29Å; T76-L80 WeakPolarHBondContact O-CG 3.45Å; T76-L80 PolarHBondContact O-N 3.32Å
77	L	94.9	Very high	93.3	Very high	37 Å²	37	69 Å²	69	19%	0.194	37%	0.365	C	S	.	.	H	α-helix	trans	-59.9	-47.3	178.1	-174	63.7	0	0	0	111.5	L35 V38 S73 C74 I75 G79 L80 F81	L35-L77 HydrophobicContact CD1-CD1 3.91Å; V38-L77 HydrophobicContact CG1-CB 3.84Å; V38-L77 HydrophobicContact CG1-CD1 4.13Å; S73-L77 WeakPolarHBondContact O-CB 3.44Å; S73-L77 PolarHBondContact O-N 3.1Å; C74-L77 PolarHBondContact O-N 3.31Å; I75-L77 PolarHBondContact O-N 2.96Å; L77-G79 PolarHBondContact O-N 2.97Å; L77-L80 PolarHBondContact O-N 2.94Å; L77-F81 HydrophobicContact CD1-CD2 4.35Å; L77-F81 HydrophobicContact CD1-CE2 3.86Å; L77-F81 HydrophobicContact CD2-CE2 4.28Å; L77-F81 HydrophobicContact CG-CD2 4.07Å; L77-F81 HydrophobicContact CG-CE2 3.74Å; L77-F81 WeakPolarHBondContact O-CD2 3.3Å; L77-F81 PolarHBondContact O-N 2.9Å
78	I	95.3	Very high	93.3	Very high	92 Å²	92	73.4 Å²	73.4	47%	0.472	38%	0.381	S	S	.	.	H	α-helix	trans	-59.5	-46.6	176	-68.3	166.5	0	0	0	110.5	C74 I75 T76 L80 F81 F82	C74-I78 VanDerWaalsContact O-CG1 3.28Å; C74-I78 WeakPolarHBondContact O-CG1 3.5Å; C74-I78 PolarHBondContact O-N 3.43Å; I75-I78 PolarHBondContact O-N 3.34Å; T76-I78 PolarHBondContact O-N 2.9Å; I78-L80 VanDerWaalsContact C-N 3.33Å; I78-L80 PolarHBondContact O-N 2.92Å; I78-F81 WeakPolarHBondContact O-CB 3.5Å; I78-F81 PolarHBondContact O-N 3.39Å; I78-F81 VanDerWaalsContact O-N 3.14Å; I78-F82 HydrophobicContact CG2-CD2 3.72Å; I78-F82 HydrophobicContact CG2-CE2 3.57Å; I78-F82 VanDerWaalsContact O-CD2 3.29Å; I78-F82 WeakPolarHBondContact O-CD2 3.29Å; I78-F82 PolarHBondContact O-N 3.48Å
79	G	95.3	Very high	93.3	Very high	39 Å²	39	70.5 Å²	70.5	40%	0.402	36%	0.361	S	S	.	.	H	α-helix	trans	-58.8	-41.9	176.4	0	0	0	0	0	112.8	I75 T76 L77 F81 F82 A83	I75-G79 PolarHBondContact O-N 3.23Å; T76-G79 PolarHBondContact O-N 2.88Å; L77-G79 PolarHBondContact O-N 2.97Å; G79-F81 VanDerWaalsContact C-N 3.34Å; G79-F81 PolarHBondContact O-N 3.12Å; G79-F82 PolarHBondContact O-N 3.4Å; G79-A83 WeakPolarHBondContact O-CB 3.36Å; G79-A83 PolarHBondContact O-N 2.88Å
80	L	93.9	Very high	93.3	Very high	26 Å²	26	66.3 Å²	66.3	14%	0.136	35%	0.345	C	S	.	.	H	α-helix	trans	-63.2	-39.3	175.2	-69.8	176.8	0	0	0	112	W31 V38 T76 L77 I78 A83 G84 I85	W31-L80 HydrophobicContact CE3-CD2 4.49Å; W31-L80 HydrophobicContact CZ3-CD2 3.84Å; V38-L80 HydrophobicContact CB-CD1 4.47Å; V38-L80 HydrophobicContact CG2-CD1 4.14Å; T76-L80 HydrophobicContact CG2-CD1 4.34Å; T76-L80 HydrophobicContact CG2-CG 4.48Å; T76-L80 VanDerWaalsContact O-CG 3.29Å; T76-L80 WeakPolarHBondContact O-CG 3.45Å; T76-L80 PolarHBondContact O-N 3.32Å; L77-L80 PolarHBondContact O-N 2.94Å; I78-L80 VanDerWaalsContact C-N 3.33Å; I78-L80 PolarHBondContact O-N 2.92Å; L80-A83 PolarHBondContact O-N 3.4Å; L80-G84 PolarHBondContact O-N 3.39Å; L80-I85 HydrophobicContact CB-CB 4.32Å; L80-I85 HydrophobicContact CB-CD1 4.12Å; L80-I85 HydrophobicContact CB-CG2 4.13Å; L80-I85 HydrophobicContact CD1-CD1 4.12Å; L80-I85 HydrophobicContact CD2-CD1 4.2Å; L80-I85 HydrophobicContact CG-CD1 4.38Å; L80-I85 VanDerWaalsContact O-CB 3.25Å; L80-I85 WeakPolarHBondContact O-CB 3.49Å; L80-I85 WeakPolarHBondContact O-CG2 3.32Å; L80-I85 PolarHBondContact O-N 3.47Å; L80-I85 VanDerWaalsContact O-N 3.1Å
81	F	92.8	Very high	93.1	Very high	125 Å²	125	66.6 Å²	66.6	55%	0.548	35%	0.352	S	S	.	.	H	α-helix	trans	-60.7	-48.7	174.3	-84	-68.2	0	0	0	111.8	L77 I78 G79 A83 G84	L77-F81 HydrophobicContact CD1-CD2 4.35Å; L77-F81 HydrophobicContact CD1-CE2 3.86Å; L77-F81 HydrophobicContact CD2-CE2 4.28Å; L77-F81 HydrophobicContact CG-CD2 4.07Å; L77-F81 HydrophobicContact CG-CE2 3.74Å; L77-F81 WeakPolarHBondContact O-CD2 3.3Å; L77-F81 PolarHBondContact O-N 2.9Å; I78-F81 WeakPolarHBondContact O-CB 3.5Å; I78-F81 PolarHBondContact O-N 3.39Å; I78-F81 VanDerWaalsContact O-N 3.14Å; G79-F81 VanDerWaalsContact C-N 3.34Å; G79-F81 PolarHBondContact O-N 3.12Å; F81-A83 VanDerWaalsContact C-N 3.33Å; F81-A83 PolarHBondContact O-N 3.37Å; F81-G84 PolarHBondContact O-N 2.88Å
82	F	93.6	Very high	92.9	Very high	179 Å²	179	65.9 Å²	65.9	79%	0.785	35%	0.348	S	S	*	.	H	α-helix	trans	-65.3	-33.8	177	-78.2	-70.3	0	0	0	113.1	I78 G79 G84	I78-F82 HydrophobicContact CG2-CD2 3.72Å; I78-F82 HydrophobicContact CG2-CE2 3.57Å; I78-F82 VanDerWaalsContact O-CD2 3.29Å; I78-F82 WeakPolarHBondContact O-CD2 3.29Å; I78-F82 PolarHBondContact O-N 3.48Å; G79-F82 PolarHBondContact O-N 3.4Å; F82-G84 PolarHBondContact O-N 2.85Å
83	A	92.5	Very high	92.6	Very high	54 Å²	54	63 Å²	63	45%	0.446	34%	0.338	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.3	1.7	173	0	0	0	0	0	113.8	G79 L80 F81	G79-A83 WeakPolarHBondContact O-CB 3.36Å; G79-A83 PolarHBondContact O-N 2.88Å; L80-A83 PolarHBondContact O-N 3.4Å; F81-A83 VanDerWaalsContact C-N 3.33Å; F81-A83 PolarHBondContact O-N 3.37Å
84	G	91.2	Very high	92.5	Very high	25 Å²	25	65.8 Å²	65.8	26%	0.258	35%	0.352	S	S	.	.	T	Hydrogen-bonded Turn	trans	73.1	30.1	176.2	0	0	0	0	0	112.9	L80 F81 F82 H86 K87 R88	L80-G84 PolarHBondContact O-N 3.39Å; F81-G84 PolarHBondContact O-N 2.88Å; F82-G84 PolarHBondContact O-N 2.85Å; G84-H86 PolarHBondContact O-N 2.84Å; G84-H86 VanDerWaalsContact O-N 3.1Å; G84-K87 PolarHBondContact O-N 3.05Å; G84-R88 PolarHBondContact O-N 2.94Å
85	I	92.5	Very high	92.3	Very high	3 Å²	3	66.1 Å²	66.1	2%	0.015	35%	0.351	C	S	.	.	H	α-helix	trans	-52.5	-36.5	-179.1	-167.2	167.2	0	0	0	111.9	W31 L35 L80 K87 R88 V89	W31-I85 HydrophobicContact CB-CD1 4.47Å; W31-I85 HydrophobicContact CB-CG1 4.29Å; W31-I85 HydrophobicContact CD2-CG1 4.4Å; W31-I85 HydrophobicContact CE3-CD1 3.72Å; W31-I85 HydrophobicContact CE3-CG1 3.9Å; W31-I85 HydrophobicContact CZ3-CD1 4.43Å; L35-I85 HydrophobicContact CB-CD1 4.04Å; L35-I85 HydrophobicContact CD1-CD1 4.26Å; L80-I85 HydrophobicContact CB-CB 4.32Å; L80-I85 HydrophobicContact CB-CD1 4.12Å; L80-I85 HydrophobicContact CB-CG2 4.13Å; L80-I85 HydrophobicContact CD1-CD1 4.12Å; L80-I85 HydrophobicContact CD2-CD1 4.2Å; L80-I85 HydrophobicContact CG-CD1 4.38Å; L80-I85 VanDerWaalsContact O-CB 3.25Å; L80-I85 WeakPolarHBondContact O-CB 3.49Å; L80-I85 WeakPolarHBondContact O-CG2 3.32Å; L80-I85 PolarHBondContact O-N 3.47Å; L80-I85 VanDerWaalsContact O-N 3.1Å; I85-K87 VanDerWaalsContact C-N 3.35Å; I85-K87 PolarHBondContact O-N 3.35Å; I85-R88 WeakPolarHBondContact O-CA 3.3Å; I85-R88 WeakPolarHBondContact O-CB 3.4Å; I85-R88 PolarHBondContact O-N 3.17Å; I85-V89 HydrophobicContact CG1-CG1 4.01Å; I85-V89 WeakPolarHBondContact O-CG2 3.3Å; I85-V89 PolarHBondContact O-N 3.4Å
86	H	90.7	Very high	92.1	Very high	115 Å²	115	60.9 Å²	60.9	53%	0.532	32%	0.324	S	S	.	.	H	α-helix	trans	-53	-52.8	177.6	-173.5	-92.8	0	0	0	110.8	G84 R88 V89 V90	G84-H86 PolarHBondContact O-N 2.84Å; G84-H86 VanDerWaalsContact O-N 3.1Å; H86-R88 VanDerWaalsContact C-N 3.26Å; H86-R88 PolarHBondContact O-N 3Å; H86-V89 VanDerWaalsContact O-CG2 3.29Å; H86-V89 WeakPolarHBondContact O-CG2 3.4Å; H86-V89 PolarHBondContact O-N 3.35Å; H86-V90 VanDerWaalsContact O-CG2 3.28Å; H86-V90 WeakPolarHBondContact O-CG2 3.41Å; H86-V90 PolarHBondContact O-N 2.91Å; H86-V90 VanDerWaalsContact O-N 3.11Å
87	K	90.4	Very high	92.1	Very high	153 Å²	153	60.2 Å²	60.2	67%	0.665	33%	0.325	S	S	*	.	H	α-helix	trans	-59.2	-37.5	178.1	-61.6	-66.8	-175	179	0	111.8	G84 I85 A91	G84-K87 PolarHBondContact O-N 3.05Å; I85-K87 VanDerWaalsContact C-N 3.35Å; I85-K87 PolarHBondContact O-N 3.35Å; K87-A91 VanDerWaalsContact O-CB 3.3Å; K87-A91 WeakPolarHBondContact O-CB 3.31Å; K87-A91 PolarHBondContact O-N 3.26Å
88	R	90.9	Very high	92	Very high	126 Å²	126	67 Å²	67	48%	0.475	35%	0.348	S	S	.	.	H	α-helix	trans	-69.8	-37.6	179.9	-59.6	-179.6	-177.1	-84.3	2.5	112.9	T28 W31 G84 I85 H86	T28-R88 PolarHBondContact OG1-O 3.49Å; W31-R88 HydrophobicContact CG-CB 4.21Å; G84-R88 PolarHBondContact O-N 2.94Å; I85-R88 WeakPolarHBondContact O-CA 3.3Å; I85-R88 WeakPolarHBondContact O-CB 3.4Å; I85-R88 PolarHBondContact O-N 3.17Å; H86-R88 VanDerWaalsContact C-N 3.26Å; H86-R88 PolarHBondContact O-N 3Å
89	V	92.4	Very high	92	Very high	15 Å²	15	63.9 Å²	63.9	9%	0.091	33%	0.333	C	S	.	.	H	α-helix	trans	-81.5	-24.1	-178.7	-61.2	0	0	0	0	113.7	T28 W31 R32 I85 H86	T28-V89 WeakPolarHBondContact CG2-O 3.5Å; W31-V89 HydrophobicContact CB-CG1 3.61Å; R32-V89 HydrophobicContact CG-CB 4.08Å; R32-V89 HydrophobicContact CG-CG1 3.93Å; R32-V89 PolarHBondContact NH2-O 3.45Å; I85-V89 HydrophobicContact CG1-CG1 4.01Å; I85-V89 WeakPolarHBondContact O-CG2 3.3Å; I85-V89 PolarHBondContact O-N 3.4Å; H86-V89 VanDerWaalsContact O-CG2 3.29Å; H86-V89 WeakPolarHBondContact O-CG2 3.4Å; H86-V89 PolarHBondContact O-N 3.35Å
90	V	91	Very high	91.9	Very high	31 Å²	31	65.3 Å²	65.3	19%	0.188	33%	0.327	C	S	.	.	H	α-helix	trans	-99.3	-9.6	178.4	-52.5	0	0	0	0	114.3	H86 S93 I94	H86-V90 VanDerWaalsContact O-CG2 3.28Å; H86-V90 WeakPolarHBondContact O-CG2 3.41Å; H86-V90 PolarHBondContact O-N 2.91Å; H86-V90 VanDerWaalsContact O-N 3.11Å; V90-S93 PolarHBondContact O-N 2.71Å; V90-S93 PolarHBondContact O-OG 3.45Å; V90-I94 HydrophobicContact CB-CD1 4.23Å; V90-I94 HydrophobicContact CB-CG1 4.43Å; V90-I94 HydrophobicContact CG2-CD1 3.45Å; V90-I94 VanDerWaalsContact CG2-CD1 3.45Å; V90-I94 HydrophobicContact CG2-CG1 4.17Å; V90-I94 WeakPolarHBondContact O-CG1 3.48Å; V90-I94 PolarHBondContact O-N 2.86Å
91	A	89.6	Confident	92	Very high	31 Å²	31	68.8 Å²	68.8	26%	0.256	35%	0.349	S	S	.	.	H	α-helix	trans	-53.3	-49.7	-177.3	0	0	0	0	0	113.4	K87 S93 I94 I95	K87-A91 VanDerWaalsContact O-CB 3.3Å; K87-A91 WeakPolarHBondContact O-CB 3.31Å; K87-A91 PolarHBondContact O-N 3.26Å; A91-S93 PolarHBondContact O-N 3.31Å; A91-I94 PolarHBondContact O-N 3.38Å; A91-I95 WeakPolarHBondContact O-CD1 3.37Å; A91-I95 WeakPolarHBondContact O-CG1 3.41Å; A91-I95 PolarHBondContact O-N 2.84Å; A91-I95 VanDerWaalsContact O-N 3.1Å
92	P	88.7	Confident	92	Very high	15 Å²	15	67 Å²	67	10%	0.097	35%	0.349	C	S	.	.	H	α-helix	trans	-61.5	-41.5	179.9	-21.4	32.6	0	0	0	112.9	L24 T28 I95 A96	L24-P92 HydrophobicContact CB-CG 4.06Å; T28-P92 HydrophobicContact CG2-CG 3.94Å; T28-P92 WeakPolarHBondContact OG1-CD 3.42Å; T28-P92 WeakPolarHBondContact OG1-CG 3.29Å; P92-I95 PolarHBondContact O-N 3.44Å; P92-A96 WeakPolarHBondContact O-CB 3.35Å; P92-A96 PolarHBondContact O-N 2.87Å
93	S	89.2	Confident	91.9	Very high	48 Å²	48	59 Å²	59	34%	0.336	31%	0.314	S	S	.	.	H	α-helix	trans	-70.2	-34.3	-178.8	56.8	0	0	0	0	112.2	V90 A91 A97	V90-S93 PolarHBondContact O-N 2.71Å; V90-S93 PolarHBondContact O-OG 3.45Å; A91-S93 PolarHBondContact O-N 3.31Å; S93-A97 WeakPolarHBondContact O-CB 3.08Å; S93-A97 PolarHBondContact O-N 2.8Å
94	I	92	Very high	91.9	Very high	67 Å²	67	58.7 Å²	58.7	34%	0.344	31%	0.311	S	S	.	.	H	α-helix	trans	-64	-44.6	173.4	-69.5	173.5	0	0	0	110.6	V90 A91 A97 R98	V90-I94 HydrophobicContact CB-CD1 4.23Å; V90-I94 HydrophobicContact CB-CG1 4.43Å; V90-I94 HydrophobicContact CG2-CD1 3.45Å; V90-I94 VanDerWaalsContact CG2-CD1 3.45Å; V90-I94 HydrophobicContact CG2-CG1 4.17Å; V90-I94 WeakPolarHBondContact O-CG1 3.48Å; V90-I94 PolarHBondContact O-N 2.86Å; A91-I94 PolarHBondContact O-N 3.38Å; I94-A97 PolarHBondContact O-N 3.37Å; I94-R98 VanDerWaalsContact O-CG 3.3Å; I94-R98 WeakPolarHBondContact O-CG 3.48Å; I94-R98 PolarHBondContact O-N 2.84Å
95	I	91.5	Very high	91.9	Very high	37 Å²	37	64.6 Å²	64.6	19%	0.19	33%	0.332	C	S	.	.	H	α-helix	trans	-63.3	-51.2	179.2	-66.8	153.3	0	0	0	110.1	L17 Y20 L24 A91 P92 A97 R98 C99	L17-I95 HydrophobicContact CD1-CG2 4.49Å; Y20-I95 HydrophobicContact CD1-CD1 4.25Å; Y20-I95 HydrophobicContact CD1-CG2 4.29Å; Y20-I95 HydrophobicContact CE1-CD1 3.48Å; Y20-I95 VanDerWaalsContact CE1-CD1 3.48Å; Y20-I95 HydrophobicContact CE1-CG1 4.29Å; Y20-I95 HydrophobicContact CE1-CG2 4.27Å; L24-I95 HydrophobicContact CD1-CD1 3.44Å; L24-I95 VanDerWaalsContact CD1-CD1 3.44Å; A91-I95 WeakPolarHBondContact O-CD1 3.37Å; A91-I95 WeakPolarHBondContact O-CG1 3.41Å; A91-I95 PolarHBondContact O-N 2.84Å; A91-I95 VanDerWaalsContact O-N 3.1Å; P92-I95 PolarHBondContact O-N 3.44Å; I95-A97 VanDerWaalsContact C-N 3.31Å; I95-A97 PolarHBondContact O-N 2.76Å; I95-R98 PolarHBondContact O-N 3.26Å; I95-C99 PolarHBondContact O-N 3.24Å; I95-C99 PolarHBondContact O-SG 2.91Å; I95-C99 VanDerWaalsContact O-SG 3.4Å
96	A	91.6	Very high	91.7	Very high	1 Å²	1	71.5 Å²	71.5	1%	0.008	36%	0.359	C	S	.	.	H	α-helix	trans	-58.3	-42.6	178	0	0	0	0	0	111.8	P92 R98 C99 R100	P92-A96 WeakPolarHBondContact O-CB 3.35Å; P92-A96 PolarHBondContact O-N 2.87Å; A96-R98 PolarHBondContact O-N 3.26Å; A96-C99 PolarHBondContact O-N 3.05Å; A96-R100 VanDerWaalsContact O-CG 3.3Å; A96-R100 WeakPolarHBondContact O-CG 3.4Å; A96-R100 PolarHBondContact O-N 2.69Å
97	A	93.8	Very high	91.7	Very high	46 Å²	46	69.1 Å²	69.1	38%	0.38	35%	0.35	S	S	.	.	H	α-helix	trans	-61.8	-43.8	176.5	0	0	0	0	0	112.6	S93 I94 I95 R100 T101	S93-A97 WeakPolarHBondContact O-CB 3.08Å; S93-A97 PolarHBondContact O-N 2.8Å; I94-A97 PolarHBondContact O-N 3.37Å; I95-A97 VanDerWaalsContact C-N 3.31Å; I95-A97 PolarHBondContact O-N 2.76Å; A97-R100 WeakPolarHBondContact O-CB 3.35Å; A97-R100 PolarHBondContact O-N 2.97Å; A97-T101 PolarHBondContact O-N 2.85Å; A97-T101 PolarHBondContact O-OG1 3.26Å
98	R	94.1	Very high	91.8	Very high	180 Å²	180	62.8 Å²	62.8	68%	0.679	32%	0.323	S	S	*	.	H	α-helix	trans	-63.5	-42.6	176.4	-72.1	174.5	-179.5	-164.7	-0.9	111.9	I94 I95 A96 R100 T101 V102	I94-R98 VanDerWaalsContact O-CG 3.3Å; I94-R98 WeakPolarHBondContact O-CG 3.48Å; I94-R98 PolarHBondContact O-N 2.84Å; I95-R98 PolarHBondContact O-N 3.26Å; A96-R98 PolarHBondContact O-N 3.26Å; R98-R100 VanDerWaalsContact C-N 3.32Å; R98-R100 PolarHBondContact O-N 3.2Å; R98-T101 WeakPolarHBondContact O-CB 3.17Å; R98-T101 PolarHBondContact O-N 2.9Å; R98-V102 PolarHBondContact O-N 2.74Å
99	C	93.9	Very high	92	Very high	25 Å²	25	57.8 Å²	57.8	17%	0.169	31%	0.307	C	S	.	.	H	α-helix	trans	-59.8	-43.9	174	-69.2	0	0	0	0	111	L17 I95 A96 T101 V102 L103	L17-C99 HydrophobicContact CD2-CB 4.37Å; I95-C99 PolarHBondContact O-N 3.24Å; I95-C99 PolarHBondContact O-SG 2.91Å; I95-C99 VanDerWaalsContact O-SG 3.4Å; A96-C99 PolarHBondContact O-N 3.05Å; C99-T101 VanDerWaalsContact C-N 3.31Å; C99-T101 PolarHBondContact O-N 3.03Å; C99-V102 PolarHBondContact O-N 2.93Å; C99-L103 HydrophobicContact CB-CD1 4.5Å; C99-L103 VanDerWaalsContact O-CB 3.3Å; C99-L103 WeakPolarHBondContact O-CB 3.27Å; C99-L103 WeakPolarHBondContact O-CG 3.48Å; C99-L103 PolarHBondContact O-N 2.95Å
100	R	94.1	Very high	92	Very high	69 Å²	69	57.1 Å²	57.1	26%	0.26	30%	0.304	S	S	.	.	H	α-helix	trans	-59.9	-38.7	175.8	-71.2	174.5	-166.9	125.2	8.8	113	A96 A97 R98 L103 A104 C110 D111 D112	A96-R100 VanDerWaalsContact O-CG 3.3Å; A96-R100 WeakPolarHBondContact O-CG 3.4Å; A96-R100 PolarHBondContact O-N 2.69Å; A97-R100 WeakPolarHBondContact O-CB 3.35Å; A97-R100 PolarHBondContact O-N 2.97Å; R98-R100 VanDerWaalsContact C-N 3.32Å; R98-R100 PolarHBondContact O-N 3.2Å; R100-L103 PolarHBondContact O-N 3.44Å; R100-A104 VanDerWaalsContact O-CB 3.27Å; R100-A104 WeakPolarHBondContact O-CB 3.46Å; R100-A104 PolarHBondContact O-N 3.37Å; R100-C110 PolarHBondContact NE-O 3.48Å; R100-C110 PolarHBondContact NH2-O 3.25Å; R100-D111 PolarHBondContact NH2-O 3.46Å; R100-D112 IonicContact CZ-OD1 3.54Å; R100-D112 IonicContact NH1-OD1 3.45Å; R100-D112 PolarHBondContact NH1-OD1 3.16Å; R100-D112 IonicContact NH2-OD1 2.71Å; R100-D112 PolarHBondContact NH2-OD1 2.91Å
101	T	94.6	Very high	92.1	Very high	100 Å²	100	57.9 Å²	57.9	61%	0.613	31%	0.307	S	S	*	.	H	α-helix	trans	-59.9	-48.1	176.7	-57.3	0	0	0	0	111.2	A97 R98 C99 A104	A97-T101 PolarHBondContact O-N 2.85Å; A97-T101 PolarHBondContact O-OG1 3.26Å; R98-T101 WeakPolarHBondContact O-CB 3.17Å; R98-T101 PolarHBondContact O-N 2.9Å; C99-T101 VanDerWaalsContact C-N 3.31Å; C99-T101 PolarHBondContact O-N 3.03Å; T101-A104 PolarHBondContact O-N 3.45Å
102	V	93.2	Very high	92.1	Very high	88 Å²	88	61.3 Å²	61.3	53%	0.533	32%	0.321	S	S	.	.	H	α-helix	trans	-68.3	-43.1	178.6	178.9	0	0	0	0	111.3	R98 C99 A104 E105 Y106	R98-V102 PolarHBondContact O-N 2.74Å; C99-V102 PolarHBondContact O-N 2.93Å; V102-A104 VanDerWaalsContact C-N 3.26Å; V102-A104 PolarHBondContact O-N 3.28Å; V102-E105 PolarHBondContact O-N 3.32Å; V102-Y106 WeakPolarHBondContact O-CD2 3.3Å
103	L	92.7	Very high	92.1	Very high	11 Å²	11	63.9 Å²	63.9	6%	0.058	34%	0.336	C	S	.	.	H	α-helix	trans	-66.2	-27.4	179.7	-70.9	172.4	0	0	0	113.1	F13 C99 R100 E105 Y106 M108 C110 L116	F13-L103 HydrophobicContact CE1-CD1 4.42Å; F13-L103 HydrophobicContact CE1-CD2 4.21Å; C99-L103 HydrophobicContact CB-CD1 4.5Å; C99-L103 VanDerWaalsContact O-CB 3.3Å; C99-L103 WeakPolarHBondContact O-CB 3.27Å; C99-L103 WeakPolarHBondContact O-CG 3.48Å; C99-L103 PolarHBondContact O-N 2.95Å; R100-L103 PolarHBondContact O-N 3.44Å; L103-E105 PolarHBondContact O-N 3.36Å; L103-Y106 PolarHBondContact O-N 3.31Å; L103-M108 CarbonylContact C-O 3.59Å; L103-M108 VanDerWaalsContact C-O 3.24Å; L103-M108 HydrophobicContact CB-CB 3.99Å; L103-M108 HydrophobicContact CD2-CB 4.18Å; L103-M108 HydrophobicContact CD2-CE 3.96Å; L103-M108 CarbonylContact O-C 3.24Å; L103-M108 WeakPolarHBondContact O-CA 3.24Å; L103-M108 PolarHBondContact O-N 3.03Å; L103-M108 VanDerWaalsContact O-O 3.12Å; L103-C110 HydrophobicContact CD1-CB 3.98Å; L103-L116 HydrophobicContact CD1-CD1 3.42Å; L103-L116 VanDerWaalsContact CD1-CD1 3.42Å; L103-L116 HydrophobicContact CD2-CD1 3.74Å; L103-L116 HydrophobicContact CG-CD1 4.2Å
104	A	91.8	Very high	92.2	Very high	47 Å²	47	61.6 Å²	61.6	39%	0.388	32%	0.32	S	S	.	.	H	α-helix	trans	-61.3	-32.6	179.2	0	0	0	0	0	112.4	R100 T101 V102 Y106 N107 M108	R100-A104 VanDerWaalsContact O-CB 3.27Å; R100-A104 WeakPolarHBondContact O-CB 3.46Å; R100-A104 PolarHBondContact O-N 3.37Å; T101-A104 PolarHBondContact O-N 3.45Å; V102-A104 VanDerWaalsContact C-N 3.26Å; V102-A104 PolarHBondContact O-N 3.28Å; A104-Y106 PolarHBondContact O-N 3.47Å; A104-N107 PolarHBondContact O-N 3.33Å; A104-N107 VanDerWaalsContact O-N 3.16Å; A104-M108 PolarHBondContact N-O 3.01Å
105	E	90.4	Very high	92.2	Very high	148 Å²	148	64 Å²	64	69%	0.692	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.6	-26.7	175.1	-62	-178.3	179.3	0	0	112.3	V102 L103	V102-E105 PolarHBondContact O-N 3.32Å; L103-E105 PolarHBondContact O-N 3.36Å
106	Y	89.5	Confident	92.3	Very high	148 Å²	148	63 Å²	63	58%	0.58	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.2	16.5	-178.9	-59.8	-82.7	0	0	0	113.4	V102 L103 A104 M108	V102-Y106 WeakPolarHBondContact O-CD2 3.3Å; L103-Y106 PolarHBondContact O-N 3.31Å; A104-Y106 PolarHBondContact O-N 3.47Å; Y106-M108 VanDerWaalsContact CB-CE 3.41Å; Y106-M108 HydrophobicContact CG-CE 4.08Å; Y106-M108 PolarHBondContact O-N 3.22Å
107	N	90.5	Very high	92.3	Very high	65 Å²	65	66.9 Å²	66.9	35%	0.348	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	54	38.2	-171	-60.9	-68	0	0	0	112.2	A104 K119	A104-N107 PolarHBondContact O-N 3.33Å; A104-N107 VanDerWaalsContact O-N 3.16Å; N107-K119 HydrophobicContact CB-CB 4.43Å; N107-K119 WeakPolarHBondContact O-CA 3.29Å; N107-K119 VanDerWaalsContact O-CB 3.3Å; N107-K119 WeakPolarHBondContact O-CB 3.41Å; N107-K119 PolarHBondContact O-N 3.37Å
108	M	92.4	Very high	92.1	Very high	21 Å²	21	71 Å²	71	10%	0.103	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	169	175.3	-64	-173.8	-72	0	0	110.4	L10 L103 A104 Y106 L116 I117 L118	L10-M108 HydrophobicContact CD2-CE 3.81Å; L10-M108 HydrophobicContact CD2-SD 3.93Å; L103-M108 CarbonylContact C-O 3.59Å; L103-M108 VanDerWaalsContact C-O 3.24Å; L103-M108 HydrophobicContact CB-CB 3.99Å; L103-M108 HydrophobicContact CD2-CB 4.18Å; L103-M108 HydrophobicContact CD2-CE 3.96Å; L103-M108 CarbonylContact O-C 3.24Å; L103-M108 WeakPolarHBondContact O-CA 3.24Å; L103-M108 PolarHBondContact O-N 3.03Å; L103-M108 VanDerWaalsContact O-O 3.12Å; A104-M108 PolarHBondContact N-O 3.01Å; Y106-M108 VanDerWaalsContact CB-CE 3.41Å; Y106-M108 HydrophobicContact CG-CE 4.08Å; Y106-M108 PolarHBondContact O-N 3.22Å; M108-L116 HydrophobicContact SD-CD2 3.7Å; M108-L116 HydrophobicContact SD-CG 4.33Å; M108-I117 CarbonylContact C-O 3.51Å; M108-I117 VanDerWaalsContact CA-O 3.31Å; M108-I117 WeakPolarHBondContact CA-O 3.42Å; M108-L118 HydrophobicContact CG-CG 4.42Å
109	S	94.4	Very high	91.8	Very high	20 Å²	20	67.4 Å²	67.4	14%	0.14	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.5	173.4	171	-174	0	0	0	0	108	L116 I117	S109-L116 CarbonylContact O-C 3.45Å; S109-L116 WeakPolarHBondContact O-CD1 3.3Å; S109-I117 PolarHBondContact N-O 3.12Å; S109-I117 PolarHBondContact O-N 3.12Å
110	C	93.6	Very high	91.2	Very high	2 Å²	2	71.7 Å²	71.7	1%	0.014	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	156.4	165	67.7	0	0	0	0	110.7	L17 R100 L103 K115	L17-C110 HydrophobicContact CD2-CB 4.07Å; R100-C110 PolarHBondContact NE-O 3.48Å; R100-C110 PolarHBondContact NH2-O 3.25Å; L103-C110 HydrophobicContact CD1-CB 3.98Å; C110-K115 CarbonylContact C-O 3.49Å; C110-K115 WeakPolarHBondContact CA-O 3.07Å; C110-K115 WeakPolarHBondContact CB-O 3.31Å
111	D	92.6	Very high	90.2	Very high	47 Å²	47	78.5 Å²	78.5	25%	0.251	40%	0.4	S	S	.	.			trans	-80	-178.7	168.8	71	12.7	0	0	0	111.4	R100 T113 G114 K115 I117	R100-D111 PolarHBondContact NH2-O 3.46Å; D111-T113 PolarHBondContact O-N 2.79Å; D111-T113 VanDerWaalsContact OD1-CA 3.3Å; D111-T113 WeakPolarHBondContact OD1-CA 3.47Å; D111-T113 WeakPolarHBondContact OD1-CB 3.41Å; D111-T113 PolarHBondContact OD1-N 2.76Å; D111-T113 PolarHBondContact OD1-OG1 3.4Å; D111-T113 PolarHBondContact OD2-OG1 2.77Å; D111-T113 VanDerWaalsContact OD2-OG1 3.05Å; D111-G114 PolarHBondContact O-N 3.3Å; D111-G114 PolarHBondContact OD1-N 3.04Å; D111-K115 PolarHBondContact N-O 3.11Å; D111-K115 WeakPolarHBondContact OD1-CB 3.44Å; D111-K115 PolarHBondContact OD1-N 3.23Å; D111-K115 WeakPolarHBondContact OD2-CB 3.45Å; D111-I117 HydrophobicContact CB-CD1 4.18Å
112	D	89.4	Confident	89	Confident	103 Å²	103	78.4 Å²	78.4	55%	0.551	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.5	-5.6	178.1	-70	-36.7	0	0	0	113.4	I21 R100	I21-D112 VanDerWaalsContact CG2-O 3.29Å; I21-D112 WeakPolarHBondContact CG2-O 3.27Å; R100-D112 IonicContact CZ-OD1 3.54Å; R100-D112 IonicContact NH1-OD1 3.45Å; R100-D112 PolarHBondContact NH1-OD1 3.16Å; R100-D112 IonicContact NH2-OD1 2.71Å; R100-D112 PolarHBondContact NH2-OD1 2.91Å
113	T	89.9	Confident	87.9	Confident	69 Å²	69	82.9 Å²	82.9	42%	0.423	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.8	-14.7	173.8	77.1	0	0	0	0	112.3	T18 D111	T18-T113 WeakPolarHBondContact CA-O 3.29Å; D111-T113 PolarHBondContact O-N 2.79Å; D111-T113 VanDerWaalsContact OD1-CA 3.3Å; D111-T113 WeakPolarHBondContact OD1-CA 3.47Å; D111-T113 WeakPolarHBondContact OD1-CB 3.41Å; D111-T113 PolarHBondContact OD1-N 2.76Å; D111-T113 PolarHBondContact OD1-OG1 3.4Å; D111-T113 PolarHBondContact OD2-OG1 2.77Å; D111-T113 VanDerWaalsContact OD2-OG1 3.05Å
114	G	90.4	Very high	86.5	Confident	0 Å²	0	89.1 Å²	89.1	0%	0	45%	0.454	C	S	.	.	S	Bend	trans	101	1.1	-177.4	0	0	0	0	0	114.5	D111	D111-G114 PolarHBondContact O-N 3.3Å; D111-G114 PolarHBondContact OD1-N 3.04Å
115	K	92.5	Very high	84.5	Confident	117 Å²	117	99 Å²	99	51%	0.509	49%	0.493	S	S	.	.			trans	-69.9	136	177.6	-171.5	175	-176.5	176.9	0	110.6	E14 C110 D111	E14-K115 WeakPolarHBondContact OE1-CG 3.28Å; C110-K115 CarbonylContact C-O 3.49Å; C110-K115 WeakPolarHBondContact CA-O 3.07Å; C110-K115 WeakPolarHBondContact CB-O 3.31Å; D111-K115 PolarHBondContact N-O 3.11Å; D111-K115 WeakPolarHBondContact OD1-CB 3.44Å; D111-K115 PolarHBondContact OD1-N 3.23Å; D111-K115 WeakPolarHBondContact OD2-CB 3.45Å
116	L	93.6	Very high	84.2	Confident	16 Å²	16	96.6 Å²	96.6	8%	0.084	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	140.3	-180	-155.1	69.7	0	0	0	111.4	L10 F13 E14 L103 M108 S109	L10-L116 HydrophobicContact CB-CD2 4.43Å; L10-L116 HydrophobicContact CD2-CD2 3.93Å; F13-L116 HydrophobicContact CE1-CD1 4.38Å; E14-L116 HydrophobicContact CB-CB 4.38Å; E14-L116 HydrophobicContact CG-CB 4.24Å; L103-L116 HydrophobicContact CD1-CD1 3.42Å; L103-L116 VanDerWaalsContact CD1-CD1 3.42Å; L103-L116 HydrophobicContact CD2-CD1 3.74Å; L103-L116 HydrophobicContact CG-CD1 4.2Å; M108-L116 HydrophobicContact SD-CD2 3.7Å; M108-L116 HydrophobicContact SD-CG 4.33Å; S109-L116 CarbonylContact O-C 3.45Å; S109-L116 WeakPolarHBondContact O-CD1 3.3Å
117	I	91.6	Very high	84	Confident	82 Å²	82	93.9 Å²	93.9	42%	0.421	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	118.8	179.7	-59.7	169.5	0	0	0	107.3	M108 S109 D111	M108-I117 CarbonylContact C-O 3.51Å; M108-I117 VanDerWaalsContact CA-O 3.31Å; M108-I117 WeakPolarHBondContact CA-O 3.42Å; S109-I117 PolarHBondContact N-O 3.12Å; S109-I117 PolarHBondContact O-N 3.12Å; D111-I117 HydrophobicContact CB-CD1 4.18Å
118	L	89.7	Confident	83.6	Confident	133 Å²	133	95.5 Å²	95.5	70%	0.696	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.2	126.9	172.9	-67.7	88	0	0	0	109.1	M108	M108-L118 HydrophobicContact CG-CG 4.42Å
119	K	87.1	Confident	83.1	Confident	105 Å²	105	99.9 Å²	99.9	46%	0.457	51%	0.507	S	S	.	.	P	Polyproline II helix	trans	-84.7	145.1	172.1	-59.8	-174.9	-178.4	176.7	0	109.2	N107 R121	N107-K119 HydrophobicContact CB-CB 4.43Å; N107-K119 WeakPolarHBondContact O-CA 3.29Å; N107-K119 VanDerWaalsContact O-CB 3.3Å; N107-K119 WeakPolarHBondContact O-CB 3.41Å; N107-K119 PolarHBondContact O-N 3.37Å; K119-R121 PolarHBondContact O-N 3.49Å
120	P	81	Confident	82.4	Confident	114 Å²	114	104.9 Å²	104.9	74%	0.74	53%	0.53	S	S	*	.	P	Polyproline II helix	trans	-55.8	140.9	171.1	-19.8	30.9	0	0	0	110.2
121	R	73.6	Confident	81.6	Confident	213 Å²	213	111.7 Å²	111.7	80%	0.804	57%	0.565	S	S	*	*	P	Polyproline II helix	trans	-62	134.6	168.8	-71.5	-172.7	-169.1	-167.5	3.1	108.1	K119 H123	K119-R121 PolarHBondContact O-N 3.49Å; R121-H123 PolarHBondContact O-N 3.15Å; R121-H123 VanDerWaalsContact O-N 3.15Å
122	P	68.7	Low	80.8	Confident	98 Å²	98	116.4 Å²	116.4	64%	0.636	59%	0.587	S	S	*	*	P	Polyproline II helix	trans	-58.8	123.4	169.4	11.9	-13.2	0	0	0	108.2	V124	P122-V124 PolarHBondContact O-N 3.08Å; P122-V124 VanDerWaalsContact O-N 3.08Å
123	H	70.3	Confident	80.2	Confident	181 Å²	181	117.4 Å²	117.4	84%	0.838	59%	0.59	S	S	*	*			trans	-60.1	114.1	169.4	-71.6	-83	0	0	0	106.7	R121 Q125	R121-H123 PolarHBondContact O-N 3.15Å; R121-H123 VanDerWaalsContact O-N 3.15Å; H123-Q125 PolarHBondContact O-N 3.08Å; H123-Q125 VanDerWaalsContact O-N 3.08Å
124	V	62.5	Low	79.4	Confident	143 Å²	143	121.4 Å²	121.4	87%	0.867	60%	0.604	S	S	*	*			trans	-63	111.5	166	-178.1	0	0	0	0	105.2	P122	P122-V124 PolarHBondContact O-N 3.08Å; P122-V124 VanDerWaalsContact O-N 3.08Å
125	Q	51.6	Low	78.4	Confident	255 Å²	255	132.5 Å²	132.5	100%	1.192	66%	0.658	S	S	*	*			trans	-66.6	0	168	-95	-178.9	-94.2	0	0	110.3	H123	H123-Q125 PolarHBondContact O-N 3.08Å; H123-Q125 VanDerWaalsContact O-N 3.08Å

Retrieved 125 of 125 residues in 22.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).