A0A096NIR8_PAPAN Loading...

C-C motif chemokine

Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes. Acts by binding to CCR4 at T-cell surface. Mediates GM-CSF/CSF2-driven pain and inflammation. In the brain, required to maintain the typical, highly branched morphology of hippocampal microglia under homeostatic conditions. May be important for the appropriate adaptation of microglial morphology and synaptic plasticity to acute lipopolysaccharide (LPS)-induced neuroinflammation. Plays a role in wound healing, mainly by inducing fibroblast migration into the wound.

AlphaFold DB , UniProt , Accession A0A096NIR8, Species PAPAN (Papio anubis, Olive baboon), Gene CCL17, Length 94 aa.

						>A0A096NIR8_PAPAN|A0A096NIR8|CCL17
MAPLKMLALVILLLGASLQHIHAARGTNVGRECCLKYFKGAIPLRKLKTWYQTPEDCSRDAIVFVTVQNKAICSDPNDKKVKKALKYLQSLQRS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.8	Low	74.4	Confident	242 Å²	242	116.9 Å²	116.9	100%	1.192	64%	0.638	S	S	*	*				0	71.3	0	-59.5	162.9	-160.5	0	0	109.2
2	A	57.7	Low	75.1	Confident	66 Å²	66	118 Å²	118	55%	0.545	64%	0.642	S	S	.	*			trans	-136.4	-3.4	179.9	0	0	0	0	0	116.2	M6	A2-M6 WeakPolarHBondContact O-CG 3.38Å
3	P	67.2	Low	75.4	Confident	106 Å²	106	118.5 Å²	118.5	69%	0.688	64%	0.643	S	S	*	*	H	α-helix	trans	-78.2	-34.6	-173.7	31.5	-34.1	0	0	0	112.7	L7	P3-L7 VanDerWaalsContact O-CB 3.32Å; P3-L7 WeakPolarHBondContact O-CB 3.11Å; P3-L7 PolarHBondContact O-N 3.43Å
4	L	72.6	Confident	75.5	Confident	139 Å²	139	117.5 Å²	117.5	73%	0.728	64%	0.636	S	S	*	*	H	α-helix	trans	-72.7	-39.4	-171.8	-159.3	75.6	0	0	0	112.8	L7 A8	L4-L7 PolarHBondContact O-N 2.97Å; L4-A8 WeakPolarHBondContact O-CB 3.33Å; L4-A8 PolarHBondContact O-N 3.14Å
5	K	76	Confident	75.5	Confident	172 Å²	172	112.3 Å²	112.3	75%	0.748	62%	0.621	S	S	*	*	H	α-helix	trans	-68.6	-40.1	178.6	-67.4	-173.5	175.9	-175.9	0	111.7	A8 L9	K5-A8 PolarHBondContact O-N 3.09Å; K5-L9 WeakPolarHBondContact O-CG 3.39Å; K5-L9 PolarHBondContact O-N 3.02Å; K5-L9 VanDerWaalsContact O-N 3.11Å
6	M	78.1	Confident	75.2	Confident	122 Å²	122	108.4 Å²	108.4	60%	0.601	61%	0.607	S	S	*	*	H	α-helix	trans	-65.8	-42.5	175.3	-69.5	-64.3	-73.7	0	0	111.2	A2 A8 L9 V10	A2-M6 WeakPolarHBondContact O-CG 3.38Å; M6-A8 PolarHBondContact O-N 2.76Å; M6-L9 PolarHBondContact O-N 3.25Å; M6-V10 WeakPolarHBondContact O-CG2 3.33Å; M6-V10 PolarHBondContact O-N 3.33Å
7	L	81.5	Confident	74.7	Confident	103 Å²	103	106 Å²	106	54%	0.539	60%	0.6	S	S	.	*	H	α-helix	trans	-62.3	-42.6	176.6	-167.3	71.7	0	0	0	111.8	P3 L4 L9 V10 I11	P3-L7 VanDerWaalsContact O-CB 3.32Å; P3-L7 WeakPolarHBondContact O-CB 3.11Å; P3-L7 PolarHBondContact O-N 3.43Å; L4-L7 PolarHBondContact O-N 2.97Å; L7-L9 PolarHBondContact O-N 3.32Å; L7-V10 PolarHBondContact O-N 3.47Å; L7-I11 HydrophobicContact CG-CD1 4.06Å; L7-I11 VanDerWaalsContact O-CG1 3.28Å; L7-I11 WeakPolarHBondContact O-CG1 3.46Å; L7-I11 PolarHBondContact O-N 3.1Å
8	A	81.9	Confident	74	Confident	56 Å²	56	106.8 Å²	106.8	46%	0.463	60%	0.601	S	S	.	*	H	α-helix	trans	-62.8	-40.7	177.6	0	0	0	0	0	112.6	L4 K5 M6 I11 L12	L4-A8 WeakPolarHBondContact O-CB 3.33Å; L4-A8 PolarHBondContact O-N 3.14Å; K5-A8 PolarHBondContact O-N 3.09Å; M6-A8 PolarHBondContact O-N 2.76Å; A8-I11 PolarHBondContact O-N 3.4Å; A8-L12 WeakPolarHBondContact O-CB 3.47Å; A8-L12 PolarHBondContact O-N 3.01Å
9	L	82.8	Confident	73.3	Confident	97 Å²	97	109.7 Å²	109.7	51%	0.508	61%	0.609	S	S	.	*	H	α-helix	trans	-65.2	-42.3	176.8	-74.4	166	0	0	0	112	K5 M6 L7 L12 L13	K5-L9 WeakPolarHBondContact O-CG 3.39Å; K5-L9 PolarHBondContact O-N 3.02Å; K5-L9 VanDerWaalsContact O-N 3.11Å; M6-L9 PolarHBondContact O-N 3.25Å; L7-L9 PolarHBondContact O-N 3.32Å; L9-L12 PolarHBondContact O-N 3.12Å; L9-L13 WeakPolarHBondContact O-CB 3.47Å; L9-L13 WeakPolarHBondContact O-CD1 3.32Å; L9-L13 VanDerWaalsContact O-CG 3.31Å; L9-L13 WeakPolarHBondContact O-CG 3.32Å; L9-L13 PolarHBondContact O-N 3.34Å
10	V	84.1	Confident	72.4	Confident	75 Å²	75	111.6 Å²	111.6	46%	0.455	61%	0.613	S	S	.	*	H	α-helix	trans	-62.8	-45	177.5	170.1	0	0	0	0	110.7	M6 L7 L12 L13 L14	M6-V10 WeakPolarHBondContact O-CG2 3.33Å; M6-V10 PolarHBondContact O-N 3.33Å; L7-V10 PolarHBondContact O-N 3.47Å; V10-L12 VanDerWaalsContact C-N 3.35Å; V10-L12 PolarHBondContact O-N 3.07Å; V10-L13 PolarHBondContact O-N 2.96Å; V10-L14 HydrophobicContact CG1-CD1 3.59Å; V10-L14 WeakPolarHBondContact O-CB 3.46Å; V10-L14 WeakPolarHBondContact O-CD1 3.33Å; V10-L14 PolarHBondContact O-N 2.96Å
11	I	83.2	Confident	71.8	Confident	108 Å²	108	112.4 Å²	112.4	55%	0.554	62%	0.616	S	S	*	*	H	α-helix	trans	-62.2	-42.1	177.3	-67.8	165.7	0	0	0	111.3	L7 A8 L14 G15	L7-I11 HydrophobicContact CG-CD1 4.06Å; L7-I11 VanDerWaalsContact O-CG1 3.28Å; L7-I11 WeakPolarHBondContact O-CG1 3.46Å; L7-I11 PolarHBondContact O-N 3.1Å; A8-I11 PolarHBondContact O-N 3.4Å; I11-L14 PolarHBondContact O-N 2.67Å; I11-G15 PolarHBondContact O-N 3.1Å
12	L	82.4	Confident	72.1	Confident	130 Å²	130	108.7 Å²	108.7	68%	0.681	60%	0.595	S	S	*	*	H	α-helix	trans	-64.4	-43.1	179	-167.4	76.6	0	0	0	111.7	A8 L9 V10 G15 A16	A8-L12 WeakPolarHBondContact O-CB 3.47Å; A8-L12 PolarHBondContact O-N 3.01Å; L9-L12 PolarHBondContact O-N 3.12Å; V10-L12 VanDerWaalsContact C-N 3.35Å; V10-L12 PolarHBondContact O-N 3.07Å; L12-G15 PolarHBondContact O-N 3.45Å; L12-A16 WeakPolarHBondContact O-CB 3.39Å; L12-A16 PolarHBondContact O-N 2.87Å
13	L	78.7	Confident	72.2	Confident	125 Å²	125	109 Å²	109	65%	0.654	60%	0.597	S	S	*	*	H	α-helix	trans	-65.5	-43.6	177.9	-74.7	163.3	0	0	0	111.9	L9 V10 A16 S17	L9-L13 WeakPolarHBondContact O-CB 3.47Å; L9-L13 WeakPolarHBondContact O-CD1 3.32Å; L9-L13 VanDerWaalsContact O-CG 3.31Å; L9-L13 WeakPolarHBondContact O-CG 3.32Å; L9-L13 PolarHBondContact O-N 3.34Å; V10-L13 PolarHBondContact O-N 2.96Å; L13-A16 PolarHBondContact O-N 3.47Å; L13-S17 PolarHBondContact O-N 3.16Å; L13-S17 VanDerWaalsContact O-N 3.08Å
14	L	76.4	Confident	71.9	Confident	104 Å²	104	108.9 Å²	108.9	55%	0.545	61%	0.605	S	S	.	*	H	α-helix	trans	-63.7	-43.3	175.1	-85.6	147.3	0	0	0	111.7	V10 I11 A16 S17 L18	V10-L14 HydrophobicContact CG1-CD1 3.59Å; V10-L14 WeakPolarHBondContact O-CB 3.46Å; V10-L14 WeakPolarHBondContact O-CD1 3.33Å; V10-L14 PolarHBondContact O-N 2.96Å; I11-L14 PolarHBondContact O-N 2.67Å; L14-A16 PolarHBondContact O-N 3.43Å; L14-S17 PolarHBondContact O-N 2.9Å; L14-S17 PolarHBondContact O-OG 3.02Å; L14-L18 PolarHBondContact O-N 2.83Å
15	G	76.6	Confident	71.1	Confident	40 Å²	40	112.3 Å²	112.3	41%	0.412	61%	0.609	S	S	.	*	H	α-helix	trans	-61.5	-42.4	176.3	0	0	0	0	0	113.2	I11 L12 L18	I11-G15 PolarHBondContact O-N 3.1Å; L12-G15 PolarHBondContact O-N 3.45Å; G15-L18 PolarHBondContact O-N 2.87Å
16	A	70.7	Confident	70.2	Confident	49 Å²	49	106.7 Å²	106.7	41%	0.405	60%	0.6	S	S	.	*	H	α-helix	trans	-66.5	-35.4	176.7	0	0	0	0	0	112.5	L12 L13 L14 L18 Q19	L12-A16 WeakPolarHBondContact O-CB 3.39Å; L12-A16 PolarHBondContact O-N 2.87Å; L13-A16 PolarHBondContact O-N 3.47Å; L14-A16 PolarHBondContact O-N 3.43Å; A16-L18 VanDerWaalsContact C-N 3.3Å; A16-L18 PolarHBondContact O-N 3.42Å; A16-Q19 PolarHBondContact O-N 3.15Å
17	S	66.8	Low	69.2	Low	68 Å²	68	104.9 Å²	104.9	48%	0.476	60%	0.595	S	S	.	*	H	α-helix	trans	-68.1	-27.7	178.3	72.9	0	0	0	0	113.6	L13 L14 Q19	L13-S17 PolarHBondContact O-N 3.16Å; L13-S17 VanDerWaalsContact O-N 3.08Å; L14-S17 PolarHBondContact O-N 2.9Å; L14-S17 PolarHBondContact O-OG 3.02Å; S17-Q19 VanDerWaalsContact C-N 3.28Å; S17-Q19 PolarHBondContact O-N 3.31Å
18	L	62.4	Low	68.2	Low	121 Å²	121	105.1 Å²	105.1	63%	0.634	60%	0.597	S	S	*	*	H	α-helix	trans	-71	-21.8	178.4	-117.5	71.8	0	0	0	113.2	L14 G15 A16 H20	L14-L18 PolarHBondContact O-N 2.83Å; G15-L18 PolarHBondContact O-N 2.87Å; A16-L18 VanDerWaalsContact C-N 3.3Å; A16-L18 PolarHBondContact O-N 3.42Å; L18-H20 PolarHBondContact O-N 3.22Å
19	Q	60.6	Low	67.4	Low	161 Å²	161	109 Å²	109	75%	0.752	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-13	-178.6	-60.2	-174.5	-59.7	0	0	113.4	A16 S17	A16-Q19 PolarHBondContact O-N 3.15Å; S17-Q19 VanDerWaalsContact C-N 3.28Å; S17-Q19 PolarHBondContact O-N 3.31Å
20	H	55.6	Low	66.7	Low	148 Å²	148	108.4 Å²	108.4	69%	0.685	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.1	5.4	-179.5	-83.1	-72.8	0	0	0	114.6	L18 H22	L18-H20 PolarHBondContact O-N 3.22Å; H20-H22 PolarHBondContact O-N 3.21Å
21	I	59.6	Low	66.4	Low	129 Å²	129	109.8 Å²	109.8	66%	0.662	63%	0.629	S	S	*	*			trans	-76	78	170.9	-51.6	179	0	0	0	108.1	A23	I21-A23 PolarHBondContact O-N 3.18Å
22	H	59	Low	66.6	Low	163 Å²	163	109.3 Å²	109.3	76%	0.755	62%	0.624	S	S	*	*			trans	-64.3	94.3	157.2	-68.6	104.9	0	0	0	106.4	H20 A24	H20-H22 PolarHBondContact O-N 3.21Å; H22-A24 PolarHBondContact O-N 3.38Å
23	A	60.2	Low	67.2	Low	73 Å²	73	105.6 Å²	105.6	60%	0.603	61%	0.609	S	S	*	*			trans	-55	116.1	163.6	0	0	0	0	0	106.5	I21 R25	I21-A23 PolarHBondContact O-N 3.18Å; A23-R25 PolarHBondContact O-N 3.23Å
24	A	60.2	Low	68	Low	103 Å²	103	99.8 Å²	99.8	85%	0.851	58%	0.578	S	S	*	*			trans	-62.4	82.9	161.4	0	0	0	0	0	106.1	H22 G26	H22-A24 PolarHBondContact O-N 3.38Å; A24-G26 PolarHBondContact O-N 3.17Å
25	R	56.9	Low	68.9	Low	212 Å²	212	101.8 Å²	101.8	80%	0.8	59%	0.589	S	S	*	*			trans	-54.8	119.9	168.6	-74	-178.2	172.7	163.1	-1.4	104.2	A23 T27	A23-R25 PolarHBondContact O-N 3.23Å; R25-T27 HydrophobicContact CB-CG2 4.43Å; R25-T27 PolarHBondContact O-N 3.41Å
26	G	56.5	Low	69.8	Low	54 Å²	54	107.9 Å²	107.9	56%	0.557	60%	0.604	S	S	*	*			trans	-63.4	81.8	171.8	0	0	0	0	0	108.5	A24 N28 V29	A24-G26 PolarHBondContact O-N 3.17Å; G26-N28 PolarHBondContact O-N 3.36Å; G26-V29 PolarHBondContact O-N 3.5Å
27	T	57.7	Low	71.1	Confident	84 Å²	84	108.5 Å²	108.5	52%	0.515	60%	0.596	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.8	-3.9	178.7	55	0	0	0	0	112.3	R25 R31	R25-T27 HydrophobicContact CB-CG2 4.43Å; R25-T27 PolarHBondContact O-N 3.41Å; T27-R31 PolarHBondContact O-NE 2.97Å; T27-R31 PolarHBondContact OG1-NH1 3.08Å
28	N	60.6	Low	72.6	Confident	107 Å²	107	110.3 Å²	110.3	57%	0.572	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.8	-3.6	-176.4	-59.4	-35.2	0	0	0	113.4	G26 G30 R31	G26-N28 PolarHBondContact O-N 3.36Å; N28-G30 PolarHBondContact O-N 2.79Å; N28-R31 PolarHBondContact O-N 2.66Å
29	V	64.9	Low	74.1	Confident	139 Å²	139	114.8 Å²	114.8	84%	0.842	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.1	110.2	176.7	-178.5	0	0	0	0	108.8	G26	G26-V29 PolarHBondContact O-N 3.5Å
30	G	67.8	Low	75.6	Confident	83 Å²	83	109 Å²	109	86%	0.856	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	88.7	4.4	179.1	0	0	0	0	0	115.8	N28	N28-G30 PolarHBondContact O-N 2.79Å
31	R	77.5	Confident	77.5	Confident	105 Å²	105	106.1 Å²	106.1	40%	0.396	60%	0.596	S	S	.	*			trans	-80.7	126.7	171.9	-80.8	-174.1	-174.7	153.1	0.5	110.9	T27 N28 P54 D56	T27-R31 PolarHBondContact O-NE 2.97Å; T27-R31 PolarHBondContact OG1-NH1 3.08Å; N28-R31 PolarHBondContact O-N 2.66Å; R31-P54 HydrophobicContact CG-CG 4.38Å; R31-D56 WeakPolarHBondContact CD-OD2 3.3Å; R31-D56 IonicContact CZ-OD1 3.53Å; R31-D56 IonicContact CZ-OD2 3.25Å; R31-D56 VanDerWaalsContact CZ-OD2 3.25Å; R31-D56 IonicContact NE-OD1 3.62Å; R31-D56 IonicContact NE-OD2 3.45Å; R31-D56 PolarHBondContact NE-OD2 2.81Å; R31-D56 IonicContact NH1-OD1 3.55Å; R31-D56 IonicContact NH1-OD2 2.61Å; R31-D56 PolarHBondContact NH1-OD2 3.01Å
32	E	88.3	Confident	79.2	Confident	97 Å²	97	101.5 Å²	101.5	45%	0.453	57%	0.572	S	S	.	*			trans	-97.1	113.8	173.4	-170.4	-178.2	-174.1	0	0	109.8	Y51	E32-Y51 VanDerWaalsContact CD-OH 3.31Å; E32-Y51 PolarHBondContact OE2-OH 3.33Å
33	C	94.4	Very high	80.9	Confident	53 Å²	53	96 Å²	96	36%	0.358	55%	0.55	S	S	.	*			trans	-113.3	148	173.5	-66.9	0	0	0	0	111.1	C57	C33-C57 VanDerWaalsContact CA-SG 3.52Å; C33-C57 HydrophobicContact CB-CB 3.85Å; C33-C57 WeakPolarHBondContact CB-SG 3.45Å; C33-C57 WeakPolarHBondContact SG-CB 3.34Å; C33-C57 CovalentContact SG-SG 2.05Å; C33-C57 PolarHBondContact SG-SG 2.04Å
34	C	96.4	Very high	82.6	Confident	2 Å²	2	95.2 Å²	95.2	1%	0.014	54%	0.536	C	S	.	.			trans	-88.1	112.7	175.7	-73.4	0	0	0	0	111.6	A61 C73	C34-A61 HydrophobicContact CB-CB 3.67Å; C34-C73 VanDerWaalsContact CA-SG 3.6Å; C34-C73 HydrophobicContact CB-CB 3.63Å; C34-C73 WeakPolarHBondContact CB-SG 3.4Å; C34-C73 VanDerWaalsContact SG-CA 3.58Å; C34-C73 WeakPolarHBondContact SG-CB 3.35Å; C34-C73 CovalentContact SG-SG 2.04Å; C34-C73 PolarHBondContact SG-SG 2.7Å
35	L	94.6	Very high	84.2	Confident	146 Å²	146	101.5 Å²	101.5	76%	0.764	54%	0.538	S	S	*	.	S	Bend	trans	-74.7	-31.9	175.4	-60.1	180	0	0	0	112.8	R59	L35-R59 PolarHBondContact O-NE 2.61Å
36	K	96.1	Very high	86.1	Confident	168 Å²	168	97.1 Å²	97.1	73%	0.73	52%	0.524	S	S	*	.	S	Bend	trans	-146.2	148	-179.5	62.8	-175.9	176.4	-175.5	0	111	C73	K36-C73 VanDerWaalsContact O-CB 3.3Å; K36-C73 WeakPolarHBondContact O-CB 3.32Å
37	Y	97.8	Very high	88	Confident	63 Å²	63	95.1 Å²	95.1	25%	0.247	50%	0.501	C	S	.	.			trans	-78.8	145.8	170.4	-55.4	-47.6	0	0	0	111.3	D60 A61 D75	Y37-D60 WeakPolarHBondContact CE1-O 3.44Å; Y37-D60 PolarHBondContact OH-O 3.47Å; Y37-A61 HydrophobicContact CE1-CB 3.98Å; Y37-D75 HydrophobicContact CD1-CB 4.36Å; Y37-D75 HydrophobicContact CD2-CB 3.73Å; Y37-D75 HydrophobicContact CE1-CB 4.35Å; Y37-D75 HydrophobicContact CE2-CB 3.72Å; Y37-D75 HydrophobicContact CG-CB 4.07Å
38	F	96.6	Very high	89.8	Confident	106 Å²	106	97.3 Å²	97.3	47%	0.465	50%	0.503	S	S	.	.			trans	-67.5	127.9	170.8	179.1	-111.3	0	0	0	109.9	G40 I72 C73	F38-G40 WeakPolarHBondContact CD1-O 3.48Å; F38-G40 WeakPolarHBondContact CE1-O 3.47Å; F38-G40 VanDerWaalsContact CZ-CA 3.49Å; F38-I72 HydrophobicContact CB-CG2 3.61Å; F38-I72 HydrophobicContact CD1-CG2 3.58Å; F38-I72 HydrophobicContact CE1-CG2 4.35Å; F38-I72 HydrophobicContact CG-CG2 3.68Å; F38-C73 WeakPolarHBondContact CB-O 3.12Å; F38-C73 PolarHBondContact N-O 3.04Å
39	K	94.8	Very high	91.6	Very high	214 Å²	214	95 Å²	95	93%	0.93	49%	0.493	S	S	*	.			trans	-92.8	-5.3	-178.1	-63.9	-174.9	177.8	-177	0	113.9
40	G	93.1	Very high	93.1	Very high	39 Å²	39	92 Å²	92	40%	0.402	47%	0.466	S	S	.	.	S	Bend	trans	-85.9	178.4	-178.3	0	0	0	0	0	113.5	F38	F38-G40 WeakPolarHBondContact CD1-O 3.48Å; F38-G40 WeakPolarHBondContact CE1-O 3.47Å; F38-G40 VanDerWaalsContact CZ-CA 3.49Å
41	A	93.8	Very high	94.5	Very high	89 Å²	89	91.6 Å²	91.6	74%	0.736	44%	0.44	S	S	*	.			trans	-73	132.5	174.7	0	0	0	0	0	111.3	P43	A41-P43 WeakPolarHBondContact O-CD 3.31Å
42	I	95.5	Very high	95.4	Very high	31 Å²	31	91.8 Å²	91.8	16%	0.159	45%	0.445	C	S	.	.			trans	-72.2	117.5	177.6	-58.1	170.9	0	0	0	109	L44 L47 F64 K80 V81 A84	I42-L44 PolarHBondContact O-N 3.13Å; I42-L47 HydrophobicContact CG2-CD1 3.86Å; I42-L47 HydrophobicContact CG2-CD2 4.22Å; I42-L47 HydrophobicContact CG2-CG 4.45Å; I42-F64 HydrophobicContact CD1-CD2 4.48Å; I42-F64 HydrophobicContact CD1-CE2 3.97Å; I42-F64 HydrophobicContact CG2-CD2 4.23Å; I42-F64 HydrophobicContact CG2-CE2 4.41Å; I42-K80 HydrophobicContact CD1-CB 4.44Å; I42-V81 HydrophobicContact CD1-CB 4.5Å; I42-V81 HydrophobicContact CD1-CG2 3.65Å; I42-A84 HydrophobicContact CG2-CB 4.13Å
43	P	95.3	Very high	95.7	Very high	47 Å²	47	87.4 Å²	87.4	31%	0.305	43%	0.425	S	S	.	.			trans	-81.6	81	-175.3	33.6	-35	0	0	0	111	A41 R45 K46 L47 I72	A41-P43 WeakPolarHBondContact O-CD 3.31Å; P43-R45 VanDerWaalsContact C-N 3.33Å; P43-R45 PolarHBondContact O-N 3.43Å; P43-R45 VanDerWaalsContact O-N 3.15Å; P43-K46 HydrophobicContact CB-CB 4.18Å; P43-K46 HydrophobicContact CB-CD 4.24Å; P43-K46 HydrophobicContact CB-CG 4.33Å; P43-K46 HydrophobicContact CG-CB 4.31Å; P43-K46 PolarHBondContact O-N 2.87Å; P43-L47 PolarHBondContact O-N 3.03Å; P43-I72 HydrophobicContact CG-CD1 4.17Å
44	L	95.2	Very high	95.7	Very high	58 Å²	58	87 Å²	87	30%	0.304	42%	0.422	S	S	.	.	G	3₁₀ helix	trans	-45.3	-49.5	-173	-68.2	178.3	0	0	0	114.4	I42 K46 L47 A84 Y87	I42-L44 PolarHBondContact O-N 3.13Å; L44-K46 PolarHBondContact O-N 2.81Å; L44-K46 VanDerWaalsContact O-N 3.16Å; L44-L47 HydrophobicContact CD2-CD1 4.2Å; L44-L47 WeakPolarHBondContact O-CB 3.43Å; L44-L47 WeakPolarHBondContact O-CG 3.29Å; L44-L47 PolarHBondContact O-N 2.86Å; L44-L47 VanDerWaalsContact O-N 3.14Å; L44-A84 HydrophobicContact CD2-CB 3.44Å; L44-A84 VanDerWaalsContact CD2-CB 3.44Å; L44-Y87 HydrophobicContact CB-CD1 4.33Å; L44-Y87 HydrophobicContact CB-CE1 4.36Å; L44-Y87 HydrophobicContact CD2-CD1 4.39Å; L44-Y87 VanDerWaalsContact O-CE1 3.31Å; L44-Y87 WeakPolarHBondContact O-CE1 3.32Å
45	R	94.3	Very high	95.4	Very high	234 Å²	234	95.5 Å²	95.5	88%	0.883	46%	0.461	S	S	*	.	G	3₁₀ helix	trans	-66.1	-16.1	-178.5	-65.4	-175.8	179.7	172	-0.7	114.4	P43	P43-R45 VanDerWaalsContact C-N 3.33Å; P43-R45 PolarHBondContact O-N 3.43Å; P43-R45 VanDerWaalsContact O-N 3.15Å
46	K	96.1	Very high	95.2	Very high	120 Å²	120	92.3 Å²	92.3	52%	0.522	45%	0.445	S	S	.	.	G	3₁₀ helix	trans	-99.9	-2.6	179.5	-60.8	-173.8	179	-178.2	0	112.2	P43 L44 T66 V67	P43-K46 HydrophobicContact CB-CB 4.18Å; P43-K46 HydrophobicContact CB-CD 4.24Å; P43-K46 HydrophobicContact CB-CG 4.33Å; P43-K46 HydrophobicContact CG-CB 4.31Å; P43-K46 PolarHBondContact O-N 2.87Å; L44-K46 PolarHBondContact O-N 2.81Å; L44-K46 VanDerWaalsContact O-N 3.16Å; K46-T66 CarbonylContact O-C 3.44Å; K46-T66 WeakPolarHBondContact O-CA 3.12Å; K46-T66 VanDerWaalsContact O-CB 3.29Å; K46-T66 WeakPolarHBondContact O-CB 3.43Å; K46-V67 PolarHBondContact O-N 3.14Å
47	L	97.1	Very high	95	Very high	12 Å²	12	84.8 Å²	84.8	6%	0.063	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.1	138	179.1	-57.9	-172.4	0	0	0	110.2	I42 P43 L44 F64 T66 A84 L88	I42-L47 HydrophobicContact CG2-CD1 3.86Å; I42-L47 HydrophobicContact CG2-CD2 4.22Å; I42-L47 HydrophobicContact CG2-CG 4.45Å; P43-L47 PolarHBondContact O-N 3.03Å; L44-L47 HydrophobicContact CD2-CD1 4.2Å; L44-L47 WeakPolarHBondContact O-CB 3.43Å; L44-L47 WeakPolarHBondContact O-CG 3.29Å; L44-L47 PolarHBondContact O-N 2.86Å; L44-L47 VanDerWaalsContact O-N 3.14Å; L47-F64 HydrophobicContact CD1-CD1 3.9Å; L47-F64 HydrophobicContact CD1-CE1 4.33Å; L47-F64 HydrophobicContact CD1-CG 4.15Å; L47-F64 HydrophobicContact CD2-CB 3.83Å; L47-F64 HydrophobicContact CD2-CG 4.32Å; L47-T66 HydrophobicContact CD2-CG2 4.28Å; L47-A84 HydrophobicContact CD1-CB 4.03Å; L47-L88 HydrophobicContact CB-CD1 4.1Å; L47-L88 HydrophobicContact CB-CD2 3.79Å; L47-L88 HydrophobicContact CB-CG 4.23Å; L47-L88 HydrophobicContact CD1-CD1 4.05Å; L47-L88 HydrophobicContact CD1-CG 4.38Å
48	K	96.4	Very high	94.7	Very high	131 Å²	131	87.2 Å²	87.2	57%	0.57	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.1	-47.8	178.1	179.4	-177.4	176.5	-177.1	0	111.2	V65 V67	K48-V65 WeakPolarHBondContact CB-O 3.29Å; K48-V65 PolarHBondContact N-O 3.13Å; K48-V67 HydrophobicContact CB-CG1 4.12Å
49	T	97	Very high	94.6	Very high	57 Å²	57	87.9 Å²	87.9	35%	0.35	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.9	177.4	-178.9	-170.1	0	0	0	0	110.7	V65	T49-V65 HydrophobicContact CG2-CB 3.75Å; T49-V65 HydrophobicContact CG2-CG1 4.47Å; T49-V65 HydrophobicContact CG2-CG2 4.03Å; T49-V65 PolarHBondContact N-O 3.27Å; T49-V65 PolarHBondContact O-N 3.5Å
50	W	97.4	Very high	94.6	Very high	76 Å²	76	82 Å²	82	29%	0.288	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.7	157.1	174.5	68.7	-85.1	0	0	0	110.9	I62 V63 F64 L85 L88	W50-I62 HydrophobicContact CB-CG2 4.34Å; W50-I62 HydrophobicContact CE3-CD1 4.22Å; W50-I62 HydrophobicContact CE3-CG2 4.2Å; W50-I62 HydrophobicContact CZ3-CD1 4.12Å; W50-V63 CarbonylContact C-O 3.57Å; W50-V63 WeakPolarHBondContact CA-O 3.48Å; W50-F64 HydrophobicContact CB-CD1 3.72Å; W50-F64 HydrophobicContact CB-CE1 3.99Å; W50-L85 HydrophobicContact CB-CD2 4.32Å; W50-L85 HydrophobicContact CD2-CD2 3.21Å; W50-L85 VanDerWaalsContact CE2-CD2 3.42Å; W50-L85 HydrophobicContact CE3-CD2 3.55Å; W50-L85 HydrophobicContact CG-CD2 3.56Å; W50-L85 HydrophobicContact CH2-CD2 4.21Å; W50-L85 HydrophobicContact CZ2-CD2 3.93Å; W50-L85 HydrophobicContact CZ3-CD2 4.03Å; W50-L88 HydrophobicContact CB-CD1 4.11Å; W50-L88 HydrophobicContact CG-CD1 4.3Å
51	Y	96.3	Very high	94.9	Very high	76 Å²	76	80.1 Å²	80.1	30%	0.298	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.8	163	167.3	59.7	-82	0	0	0	110.1	E32 V63 V65	E32-Y51 VanDerWaalsContact CD-OH 3.31Å; E32-Y51 PolarHBondContact OE2-OH 3.33Å; Y51-V63 HydrophobicContact CD1-CB 4.11Å; Y51-V63 HydrophobicContact CD1-CG1 4.49Å; Y51-V63 HydrophobicContact CD2-CB 4.21Å; Y51-V63 HydrophobicContact CD2-CG2 4.39Å; Y51-V63 HydrophobicContact CE1-CB 3.65Å; Y51-V63 HydrophobicContact CE1-CG1 3.64Å; Y51-V63 HydrophobicContact CE2-CB 3.79Å; Y51-V63 HydrophobicContact CE2-CG1 4.33Å; Y51-V63 HydrophobicContact CE2-CG2 3.8Å; Y51-V63 HydrophobicContact CG-CB 4.37Å; Y51-V63 VanDerWaalsContact CZ-CB 3.49Å; Y51-V63 PolarHBondContact N-O 3.49Å; Y51-V63 PolarHBondContact O-N 2.86Å; Y51-V63 WeakPolarHBondContact OH-CG1 3.46Å; Y51-V65 HydrophobicContact CD1-CG2 4.1Å; Y51-V65 HydrophobicContact CE1-CG2 3.64Å
52	Q	96.4	Very high	95.1	Very high	108 Å²	108	76.3 Å²	76.3	51%	0.505	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	141.1	172.1	-171.6	173.4	-14.2	0	0	109.4	A61 I62	Q52-A61 WeakPolarHBondContact CA-O 3.37Å; Q52-I62 HydrophobicContact CB-CD1 4.09Å; Q52-I62 HydrophobicContact CG-CD1 4.18Å
53	T	95.8	Very high	95.2	Very high	5 Å²	5	74.9 Å²	74.9	3%	0.031	36%	0.358	C	S	.	.	P	Polyproline II helix	trans	-65.2	153.7	172.1	50.9	0	0	0	0	111	A61 V63	T53-A61 HydrophobicContact CG2-CB 3.86Å; T53-A61 PolarHBondContact N-O 2.92Å; T53-A61 PolarHBondContact OG1-N 2.87Å; T53-A61 VanDerWaalsContact OG1-N 3.08Å; T53-A61 PolarHBondContact OG1-O 3.04Å; T53-V63 HydrophobicContact CG2-CG2 3.87Å
54	P	93	Very high	95.3	Very high	46 Å²	46	72.6 Å²	72.6	30%	0.299	34%	0.344	S	S	.	.	P	Polyproline II helix	trans	-52.9	146.9	173.1	-26	34.7	0	0	0	113.2	R31 D56 C57	R31-P54 HydrophobicContact CG-CG 4.38Å; P54-D56 WeakPolarHBondContact CB-OD1 3.44Å; P54-D56 PolarHBondContact O-N 2.98Å; P54-C57 VanDerWaalsContact O-CB 3.3Å; P54-C57 WeakPolarHBondContact O-CB 2.96Å; P54-C57 PolarHBondContact O-N 3.22Å; P54-C57 VanDerWaalsContact O-N 3.11Å; P54-C57 PolarHBondContact O-SG 3.1Å
55	E	90.8	Very high	95.4	Very high	179 Å²	179	71 Å²	71	84%	0.836	34%	0.336	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	-22	-179	-63.6	-178.3	175.9	0	0	113.3	C57	E55-C57 PolarHBondContact O-N 2.8Å
56	D	89.6	Confident	95.6	Very high	79 Å²	79	60.3 Å²	60.3	42%	0.422	30%	0.297	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.6	-7	176.2	61.9	-73	0	0	0	113.4	R31 P54	R31-D56 WeakPolarHBondContact CD-OD2 3.3Å; R31-D56 IonicContact CZ-OD1 3.53Å; R31-D56 IonicContact CZ-OD2 3.25Å; R31-D56 VanDerWaalsContact CZ-OD2 3.25Å; R31-D56 IonicContact NE-OD1 3.62Å; R31-D56 IonicContact NE-OD2 3.45Å; R31-D56 PolarHBondContact NE-OD2 2.81Å; R31-D56 IonicContact NH1-OD1 3.55Å; R31-D56 IonicContact NH1-OD2 2.61Å; R31-D56 PolarHBondContact NH1-OD2 3.01Å; P54-D56 WeakPolarHBondContact CB-OD1 3.44Å; P54-D56 PolarHBondContact O-N 2.98Å
57	C	92.3	Very high	95.6	Very high	10 Å²	10	58.9 Å²	58.9	7%	0.068	30%	0.298	C	S	.	.	S	Bend	trans	-67.3	141.7	170.8	-66.6	0	0	0	0	110.2	C33 P54 E55 R59	C33-C57 VanDerWaalsContact CA-SG 3.52Å; C33-C57 HydrophobicContact CB-CB 3.85Å; C33-C57 WeakPolarHBondContact CB-SG 3.45Å; C33-C57 WeakPolarHBondContact SG-CB 3.34Å; C33-C57 CovalentContact SG-SG 2.05Å; C33-C57 PolarHBondContact SG-SG 2.04Å; P54-C57 VanDerWaalsContact O-CB 3.3Å; P54-C57 WeakPolarHBondContact O-CB 2.96Å; P54-C57 PolarHBondContact O-N 3.22Å; P54-C57 VanDerWaalsContact O-N 3.11Å; P54-C57 PolarHBondContact O-SG 3.1Å; E55-C57 PolarHBondContact O-N 2.8Å; C57-R59 PolarHBondContact O-N 2.97Å
58	S	92.2	Very high	95.6	Very high	114 Å²	114	64.2 Å²	64.2	80%	0.797	32%	0.323	S	S	*	.	S	Bend	trans	-60.9	-13.6	176.6	58.5	0	0	0	0	114.7
59	R	93.5	Very high	95.6	Very high	120 Å²	120	63.6 Å²	63.6	45%	0.453	33%	0.326	S	S	.	.	S	Bend	trans	-138.3	126.8	-179.4	-65.7	178.4	178.7	-86.1	-4.2	109.2	L35 C57 A61	L35-R59 PolarHBondContact O-NE 2.61Å; C57-R59 PolarHBondContact O-N 2.97Å; R59-A61 PolarHBondContact O-N 3.26Å
60	D	96.3	Very high	95.6	Very high	90 Å²	90	66.9 Å²	66.9	48%	0.481	34%	0.335	S	S	.	.			trans	-66	131.3	166.3	-62.9	-30.3	0	0	0	109.6	Y37 P76	Y37-D60 WeakPolarHBondContact CE1-O 3.44Å; Y37-D60 PolarHBondContact OH-O 3.47Å; D60-P76 HydrophobicContact CB-CG 4.02Å; D60-P76 WeakPolarHBondContact O-CD 3.46Å
61	A	97.9	Very high	95.6	Very high	0 Å²	0	65.8 Å²	65.8	0%	0	34%	0.342	C	S	.	.			trans	-144.5	145.9	177	0	0	0	0	0	112.1	C34 Y37 Q52 T53 R59 S74	C34-A61 HydrophobicContact CB-CB 3.67Å; Y37-A61 HydrophobicContact CE1-CB 3.98Å; Q52-A61 WeakPolarHBondContact CA-O 3.37Å; T53-A61 HydrophobicContact CG2-CB 3.86Å; T53-A61 PolarHBondContact N-O 2.92Å; T53-A61 PolarHBondContact OG1-N 2.87Å; T53-A61 VanDerWaalsContact OG1-N 3.08Å; T53-A61 PolarHBondContact OG1-O 3.04Å; R59-A61 PolarHBondContact O-N 3.26Å; A61-S74 WeakPolarHBondContact CA-O 3.42Å
62	I	97.9	Very high	95.6	Very high	10 Å²	10	63 Å²	63	5%	0.051	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	122.9	161.3	-60.3	-62.3	0	0	0	107.2	W50 Q52 F64 S74 P76 V81 L85	W50-I62 HydrophobicContact CB-CG2 4.34Å; W50-I62 HydrophobicContact CE3-CD1 4.22Å; W50-I62 HydrophobicContact CE3-CG2 4.2Å; W50-I62 HydrophobicContact CZ3-CD1 4.12Å; Q52-I62 HydrophobicContact CB-CD1 4.09Å; Q52-I62 HydrophobicContact CG-CD1 4.18Å; I62-F64 HydrophobicContact CG2-CD1 4.46Å; I62-F64 HydrophobicContact CG2-CE1 4.01Å; I62-F64 HydrophobicContact CG2-CE2 4.2Å; I62-F64 HydrophobicContact CG2-CZ 3.86Å; I62-S74 PolarHBondContact N-O 3.02Å; I62-S74 WeakPolarHBondContact O-CA 3.3Å; I62-S74 WeakPolarHBondContact O-CB 3.39Å; I62-S74 PolarHBondContact O-N 3.42Å; I62-P76 HydrophobicContact CG1-CB 4.15Å; I62-P76 HydrophobicContact CG1-CG 4.19Å; I62-V81 HydrophobicContact CB-CG1 4.05Å; I62-V81 HydrophobicContact CG1-CG1 4.22Å; I62-V81 HydrophobicContact CG2-CG1 4.35Å; I62-L85 HydrophobicContact CG1-CD1 4.26Å; I62-L85 HydrophobicContact CG2-CD1 4.48Å; I62-L85 HydrophobicContact CG2-CD2 4.1Å; I62-L85 HydrophobicContact CG2-CG 4.41Å
63	V	98.1	Very high	95.7	Very high	0 Å²	0	59.1 Å²	59.1	0%	0	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	116	174.3	-174.1	0	0	0	0	108.6	W50 Y51 T53 A71 I72	W50-V63 CarbonylContact C-O 3.57Å; W50-V63 WeakPolarHBondContact CA-O 3.48Å; Y51-V63 HydrophobicContact CD1-CB 4.11Å; Y51-V63 HydrophobicContact CD1-CG1 4.49Å; Y51-V63 HydrophobicContact CD2-CB 4.21Å; Y51-V63 HydrophobicContact CD2-CG2 4.39Å; Y51-V63 HydrophobicContact CE1-CB 3.65Å; Y51-V63 HydrophobicContact CE1-CG1 3.64Å; Y51-V63 HydrophobicContact CE2-CB 3.79Å; Y51-V63 HydrophobicContact CE2-CG1 4.33Å; Y51-V63 HydrophobicContact CE2-CG2 3.8Å; Y51-V63 HydrophobicContact CG-CB 4.37Å; Y51-V63 VanDerWaalsContact CZ-CB 3.49Å; Y51-V63 PolarHBondContact N-O 3.49Å; Y51-V63 PolarHBondContact O-N 2.86Å; Y51-V63 WeakPolarHBondContact OH-CG1 3.46Å; T53-V63 HydrophobicContact CG2-CG2 3.87Å; V63-A71 HydrophobicContact CG1-CB 3.79Å; V63-I72 WeakPolarHBondContact CA-O 3.02Å
64	F	98.3	Very high	95.8	Very high	0 Å²	0	59.1 Å²	59.1	0%	0	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	134.3	167.7	-62.4	-69.2	0	0	0	110.1	I42 L47 W50 I62 A71 I72 S74 V81 A84 L85 L88	I42-F64 HydrophobicContact CD1-CD2 4.48Å; I42-F64 HydrophobicContact CD1-CE2 3.97Å; I42-F64 HydrophobicContact CG2-CD2 4.23Å; I42-F64 HydrophobicContact CG2-CE2 4.41Å; L47-F64 HydrophobicContact CD1-CD1 3.9Å; L47-F64 HydrophobicContact CD1-CE1 4.33Å; L47-F64 HydrophobicContact CD1-CG 4.15Å; L47-F64 HydrophobicContact CD2-CB 3.83Å; L47-F64 HydrophobicContact CD2-CG 4.32Å; W50-F64 HydrophobicContact CB-CD1 3.72Å; W50-F64 HydrophobicContact CB-CE1 3.99Å; I62-F64 HydrophobicContact CG2-CD1 4.46Å; I62-F64 HydrophobicContact CG2-CE1 4.01Å; I62-F64 HydrophobicContact CG2-CE2 4.2Å; I62-F64 HydrophobicContact CG2-CZ 3.86Å; F64-A71 CarbonylContact O-C 3.52Å; F64-A71 WeakPolarHBondContact O-CA 3.42Å; F64-I72 HydrophobicContact CB-CB 4.3Å; F64-I72 PolarHBondContact N-O 3.45Å; F64-I72 PolarHBondContact O-N 3.49Å; F64-S74 WeakPolarHBondContact CD2-OG 3.08Å; F64-V81 HydrophobicContact CE2-CB 4.4Å; F64-V81 HydrophobicContact CE2-CG1 3.88Å; F64-V81 HydrophobicContact CE2-CG2 4.3Å; F64-V81 HydrophobicContact CZ-CG1 3.84Å; F64-A84 HydrophobicContact CE1-CB 3.92Å; F64-A84 HydrophobicContact CE2-CB 4.13Å; F64-A84 HydrophobicContact CZ-CB 3.56Å; F64-L85 HydrophobicContact CE1-CD2 4.28Å; F64-L85 HydrophobicContact CE1-CG 4.19Å; F64-L85 HydrophobicContact CZ-CG 4.17Å; F64-L88 HydrophobicContact CD1-CD1 3.79Å; F64-L88 HydrophobicContact CE1-CD1 4.01Å
65	V	97.6	Very high	96.1	Very high	24 Å²	24	59.3 Å²	59.3	15%	0.145	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	125	173.2	-174.3	0	0	0	0	108.2	K48 T49 Y51	K48-V65 WeakPolarHBondContact CB-O 3.29Å; K48-V65 PolarHBondContact N-O 3.13Å; T49-V65 HydrophobicContact CG2-CB 3.75Å; T49-V65 HydrophobicContact CG2-CG1 4.47Å; T49-V65 HydrophobicContact CG2-CG2 4.03Å; T49-V65 PolarHBondContact N-O 3.27Å; T49-V65 PolarHBondContact O-N 3.5Å; Y51-V65 HydrophobicContact CD1-CG2 4.1Å; Y51-V65 HydrophobicContact CE1-CG2 3.64Å
66	T	97.4	Very high	96.4	Very high	10 Å²	10	52.1 Å²	52.1	6%	0.061	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	166	176.7	63.5	0	0	0	0	111.8	K46 L47 Q68 N69 K70 I72	K46-T66 CarbonylContact O-C 3.44Å; K46-T66 WeakPolarHBondContact O-CA 3.12Å; K46-T66 VanDerWaalsContact O-CB 3.29Å; K46-T66 WeakPolarHBondContact O-CB 3.43Å; L47-T66 HydrophobicContact CD2-CG2 4.28Å; T66-Q68 PolarHBondContact O-N 2.05Å; T66-Q68 VanDerWaalsContact O-N 3.13Å; T66-Q68 PolarHBondContact OG1-N 3.45Å; T66-N69 WeakPolarHBondContact O-CA 3.2Å; T66-N69 PolarHBondContact O-N 3.11Å; T66-K70 HydrophobicContact CG2-CB 4.48Å; T66-K70 PolarHBondContact N-O 3.25Å; T66-K70 WeakPolarHBondContact OG1-CB 3.44Å; T66-K70 PolarHBondContact OG1-N 3.45Å; T66-K70 PolarHBondContact OG1-O 3.04Å; T66-I72 HydrophobicContact CG2-CD1 3.8Å; T66-I72 HydrophobicContact CG2-CG1 4.44Å
67	V	96.9	Very high	96.7	Very high	90 Å²	90	54 Å²	54	55%	0.545	30%	0.295	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.2	-23	172	-63.4	0	0	0	0	113.3	K46 K48 N69	K46-V67 PolarHBondContact O-N 3.14Å; K48-V67 HydrophobicContact CB-CG1 4.12Å; V67-N69 VanDerWaalsContact C-N 3.26Å; V67-N69 PolarHBondContact O-N 2.61Å
68	Q	97.1	Very high	96.9	Very high	123 Å²	123	56.7 Å²	56.7	58%	0.575	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.6	15.1	173.4	-63.6	-178	-5.3	0	0	112.8	T66 K70	T66-Q68 PolarHBondContact O-N 2.05Å; T66-Q68 VanDerWaalsContact O-N 3.13Å; T66-Q68 PolarHBondContact OG1-N 3.45Å; Q68-K70 HydrophobicContact CB-CG 4.37Å; Q68-K70 PolarHBondContact O-N 3.43Å; Q68-K70 VanDerWaalsContact O-N 3.1Å
69	N	96.3	Very high	97.1	Very high	118 Å²	118	59.9 Å²	59.9	63%	0.631	31%	0.308	S	S	*	.			trans	56.6	22.2	-176.6	-61.6	-34.7	0	0	0	114.8	T66 V67	T66-N69 WeakPolarHBondContact O-CA 3.2Å; T66-N69 PolarHBondContact O-N 3.11Å; V67-N69 VanDerWaalsContact C-N 3.26Å; V67-N69 PolarHBondContact O-N 2.61Å
70	K	96.6	Very high	97.2	Very high	127 Å²	127	61.2 Å²	61.2	55%	0.552	32%	0.317	S	S	*	.			trans	-80.3	128.7	171.2	-58.7	179.6	176.9	171.3	0	110	T66 Q68	T66-K70 HydrophobicContact CG2-CB 4.48Å; T66-K70 PolarHBondContact N-O 3.25Å; T66-K70 WeakPolarHBondContact OG1-CB 3.44Å; T66-K70 PolarHBondContact OG1-N 3.45Å; T66-K70 PolarHBondContact OG1-O 3.04Å; Q68-K70 HydrophobicContact CB-CG 4.37Å; Q68-K70 PolarHBondContact O-N 3.43Å; Q68-K70 VanDerWaalsContact O-N 3.1Å
71	A	96.8	Very high	97.3	Very high	53 Å²	53	57 Å²	57	44%	0.438	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	137.3	173.8	0	0	0	0	0	111.3	V63 F64	V63-A71 HydrophobicContact CG1-CB 3.79Å; F64-A71 CarbonylContact O-C 3.52Å; F64-A71 WeakPolarHBondContact O-CA 3.42Å
72	I	97.7	Very high	97.2	Very high	16 Å²	16	61.9 Å²	61.9	8%	0.082	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	100.2	179.2	-54.7	177.1	0	0	0	108.6	F38 P43 V63 F64 T66 S74	F38-I72 HydrophobicContact CB-CG2 3.61Å; F38-I72 HydrophobicContact CD1-CG2 3.58Å; F38-I72 HydrophobicContact CE1-CG2 4.35Å; F38-I72 HydrophobicContact CG-CG2 3.68Å; P43-I72 HydrophobicContact CG-CD1 4.17Å; V63-I72 WeakPolarHBondContact CA-O 3.02Å; F64-I72 HydrophobicContact CB-CB 4.3Å; F64-I72 PolarHBondContact N-O 3.45Å; F64-I72 PolarHBondContact O-N 3.49Å; T66-I72 HydrophobicContact CG2-CD1 3.8Å; T66-I72 HydrophobicContact CG2-CG1 4.44Å; I72-S74 PolarHBondContact O-N 3.06Å; I72-S74 PolarHBondContact O-OG 2.83Å; I72-S74 VanDerWaalsContact O-OG 3.13Å
73	C	98	Very high	97.1	Very high	27 Å²	27	68.4 Å²	68.4	18%	0.182	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64	124.1	172.3	-74.1	0	0	0	0	111.1	C34 K36 F38	C34-C73 VanDerWaalsContact CA-SG 3.6Å; C34-C73 HydrophobicContact CB-CB 3.63Å; C34-C73 WeakPolarHBondContact CB-SG 3.4Å; C34-C73 VanDerWaalsContact SG-CA 3.58Å; C34-C73 WeakPolarHBondContact SG-CB 3.35Å; C34-C73 CovalentContact SG-SG 2.04Å; C34-C73 PolarHBondContact SG-SG 2.7Å; K36-C73 VanDerWaalsContact O-CB 3.3Å; K36-C73 WeakPolarHBondContact O-CB 3.32Å; F38-C73 WeakPolarHBondContact CB-O 3.12Å; F38-C73 PolarHBondContact N-O 3.04Å
74	S	98	Very high	97.1	Very high	5 Å²	5	68.4 Å²	68.4	4%	0.035	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	146.9	-174.2	-46.9	0	0	0	0	112.2	A61 I62 F64 I72 P76 V81	A61-S74 WeakPolarHBondContact CA-O 3.42Å; I62-S74 PolarHBondContact N-O 3.02Å; I62-S74 WeakPolarHBondContact O-CA 3.3Å; I62-S74 WeakPolarHBondContact O-CB 3.39Å; I62-S74 PolarHBondContact O-N 3.42Å; F64-S74 WeakPolarHBondContact CD2-OG 3.08Å; I72-S74 PolarHBondContact O-N 3.06Å; I72-S74 PolarHBondContact O-OG 2.83Å; I72-S74 VanDerWaalsContact O-OG 3.13Å; S74-P76 WeakPolarHBondContact O-CD 3.31Å; S74-V81 VanDerWaalsContact CB-CG2 3.49Å
75	D	97.9	Very high	97	Very high	50 Å²	50	69.6 Å²	69.6	27%	0.267	35%	0.35	S	S	.	.			trans	-71.6	119.9	177.9	-175.3	-16.4	0	0	0	110.5	Y37 N77 D78 V81	Y37-D75 HydrophobicContact CD1-CB 4.36Å; Y37-D75 HydrophobicContact CD2-CB 3.73Å; Y37-D75 HydrophobicContact CE1-CB 4.35Å; Y37-D75 HydrophobicContact CE2-CB 3.72Å; Y37-D75 HydrophobicContact CG-CB 4.07Å; D75-N77 PolarHBondContact O-N 2.89Å; D75-N77 VanDerWaalsContact O-N 3.1Å; D75-N77 WeakPolarHBondContact OD1-CB 3.45Å; D75-N77 PolarHBondContact OD1-N 2.71Å; D75-N77 PolarHBondContact OD1-ND2 3.4Å; D75-D78 HydrophobicContact CB-CB 4.25Å; D75-D78 PolarHBondContact O-N 3.35Å; D75-D78 VanDerWaalsContact O-N 3.14Å; D75-V81 WeakPolarHBondContact O-CB 3.14Å; D75-V81 VanDerWaalsContact O-CG2 3.32Å; D75-V81 WeakPolarHBondContact O-CG2 2.98Å
76	P	97.2	Very high	97	Very high	29 Å²	29	75.5 Å²	75.5	19%	0.188	37%	0.374	C	S	.	.	T	Hydrogen-bonded Turn	trans	-58.2	-23.9	178	-20.3	31.3	0	0	0	113.8	D60 I62 S74 K82	D60-P76 HydrophobicContact CB-CG 4.02Å; D60-P76 WeakPolarHBondContact O-CD 3.46Å; I62-P76 HydrophobicContact CG1-CB 4.15Å; I62-P76 HydrophobicContact CG1-CG 4.19Å; S74-P76 WeakPolarHBondContact O-CD 3.31Å; P76-K82 WeakPolarHBondContact O-CE 3.38Å
77	N	96.6	Very high	96.9	Very high	119 Å²	119	79 Å²	79	64%	0.636	39%	0.386	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	-16.9	-177.9	-63.2	-57	0	0	0	113.4	D75 K79	D75-N77 PolarHBondContact O-N 2.89Å; D75-N77 VanDerWaalsContact O-N 3.1Å; D75-N77 WeakPolarHBondContact OD1-CB 3.45Å; D75-N77 PolarHBondContact OD1-N 2.71Å; D75-N77 PolarHBondContact OD1-ND2 3.4Å; N77-K79 PolarHBondContact O-N 3.35Å
78	D	97.1	Very high	96.8	Very high	66 Å²	66	75 Å²	75	35%	0.353	36%	0.362	S	S	.	.			trans	-67.5	129.1	179.4	-173.6	-24.5	0	0	0	111.1	D75 K80 V81 K82	D75-D78 HydrophobicContact CB-CB 4.25Å; D75-D78 PolarHBondContact O-N 3.35Å; D75-D78 VanDerWaalsContact O-N 3.14Å; D78-K80 PolarHBondContact O-N 2.72Å; D78-K80 WeakPolarHBondContact OD1-CB 3.44Å; D78-K80 PolarHBondContact OD1-N 3.29Å; D78-V81 HydrophobicContact CB-CB 4.23Å; D78-V81 HydrophobicContact CB-CG2 3.84Å; D78-V81 WeakPolarHBondContact O-CB 3.35Å; D78-V81 PolarHBondContact O-N 3.08Å; D78-V81 VanDerWaalsContact O-N 3.09Å; D78-K82 PolarHBondContact O-N 3.3Å; D78-K82 VanDerWaalsContact O-N 3.07Å
79	K	96.3	Very high	96.7	Very high	180 Å²	180	72.9 Å²	72.9	78%	0.783	35%	0.352	S	S	*	.	H	α-helix	trans	-57.2	-34.6	177.1	-63.5	-177.3	-177.9	178.8	0	112.5	N77 K82 K83	N77-K79 PolarHBondContact O-N 3.35Å; K79-K82 PolarHBondContact O-N 3.48Å; K79-K83 PolarHBondContact O-N 3.45Å
80	K	95.3	Very high	96.7	Very high	149 Å²	149	70.4 Å²	70.4	65%	0.648	34%	0.344	S	S	*	.	H	α-helix	trans	-67.8	-37.7	177.4	-64.5	175.4	-176.2	170.5	0	111.5	I42 D78 K83 A84	I42-K80 HydrophobicContact CD1-CB 4.44Å; D78-K80 PolarHBondContact O-N 2.72Å; D78-K80 WeakPolarHBondContact OD1-CB 3.44Å; D78-K80 PolarHBondContact OD1-N 3.29Å; K80-K83 PolarHBondContact O-N 3.39Å; K80-A84 PolarHBondContact O-N 3.43Å
81	V	97.6	Very high	96.4	Very high	2 Å²	2	68.5 Å²	68.5	1%	0.012	34%	0.339	C	S	.	.	H	α-helix	trans	-65.5	-46.4	175.5	173.9	0	0	0	0	110.1	I42 I62 F64 S74 D75 D78 K83 A84 L85	I42-V81 HydrophobicContact CD1-CB 4.5Å; I42-V81 HydrophobicContact CD1-CG2 3.65Å; I62-V81 HydrophobicContact CB-CG1 4.05Å; I62-V81 HydrophobicContact CG1-CG1 4.22Å; I62-V81 HydrophobicContact CG2-CG1 4.35Å; F64-V81 HydrophobicContact CE2-CB 4.4Å; F64-V81 HydrophobicContact CE2-CG1 3.88Å; F64-V81 HydrophobicContact CE2-CG2 4.3Å; F64-V81 HydrophobicContact CZ-CG1 3.84Å; S74-V81 VanDerWaalsContact CB-CG2 3.49Å; D75-V81 WeakPolarHBondContact O-CB 3.14Å; D75-V81 VanDerWaalsContact O-CG2 3.32Å; D75-V81 WeakPolarHBondContact O-CG2 2.98Å; D78-V81 HydrophobicContact CB-CB 4.23Å; D78-V81 HydrophobicContact CB-CG2 3.84Å; D78-V81 WeakPolarHBondContact O-CB 3.35Å; D78-V81 PolarHBondContact O-N 3.08Å; D78-V81 VanDerWaalsContact O-N 3.09Å; V81-K83 VanDerWaalsContact C-N 3.28Å; V81-K83 PolarHBondContact O-N 3.41Å; V81-A84 WeakPolarHBondContact O-CB 3.41Å; V81-A84 PolarHBondContact O-N 2.89Å; V81-A84 VanDerWaalsContact O-N 3.1Å; V81-L85 HydrophobicContact CG1-CD1 4.3Å; V81-L85 PolarHBondContact O-N 3.5Å
82	K	97.3	Very high	95.8	Very high	102 Å²	102	72.8 Å²	72.8	44%	0.443	35%	0.35	S	S	.	.	H	α-helix	trans	-59.2	-37.9	174.5	-66.1	177.8	-177.2	177.4	0	112.5	P76 D78 K79 K86	P76-K82 WeakPolarHBondContact O-CE 3.38Å; D78-K82 PolarHBondContact O-N 3.3Å; D78-K82 VanDerWaalsContact O-N 3.07Å; K79-K82 PolarHBondContact O-N 3.48Å; K82-K86 WeakPolarHBondContact O-CG 3.44Å; K82-K86 PolarHBondContact O-N 2.96Å; K82-K86 VanDerWaalsContact O-N 3.12Å
83	K	96.3	Very high	94.9	Very high	147 Å²	147	82.5 Å²	82.5	64%	0.639	39%	0.386	S	S	*	.	H	α-helix	trans	-66.7	-41.8	174.6	-171.7	176.3	-178.9	177.3	0	111.9	K79 K80 V81 K86 Y87	K79-K83 PolarHBondContact O-N 3.45Å; K80-K83 PolarHBondContact O-N 3.39Å; V81-K83 VanDerWaalsContact C-N 3.28Å; V81-K83 PolarHBondContact O-N 3.41Å; K83-K86 PolarHBondContact O-N 2.98Å; K83-Y87 PolarHBondContact O-N 2.98Å
84	A	97.1	Very high	93.3	Very high	0 Å²	0	88.7 Å²	88.7	0%	0	43%	0.43	C	S	.	.	H	α-helix	trans	-64.4	-40.5	176.8	0	0	0	0	0	112.5	I42 L44 L47 F64 K80 V81 Y87 L88	I42-A84 HydrophobicContact CG2-CB 4.13Å; L44-A84 HydrophobicContact CD2-CB 3.44Å; L44-A84 VanDerWaalsContact CD2-CB 3.44Å; L47-A84 HydrophobicContact CD1-CB 4.03Å; F64-A84 HydrophobicContact CE1-CB 3.92Å; F64-A84 HydrophobicContact CE2-CB 4.13Å; F64-A84 HydrophobicContact CZ-CB 3.56Å; K80-A84 PolarHBondContact O-N 3.43Å; V81-A84 WeakPolarHBondContact O-CB 3.41Å; V81-A84 PolarHBondContact O-N 2.89Å; V81-A84 VanDerWaalsContact O-N 3.1Å; A84-Y87 WeakPolarHBondContact O-CB 3.28Å; A84-Y87 PolarHBondContact O-N 3.46Å; A84-L88 PolarHBondContact O-N 3.35Å
85	L	97.1	Very high	93	Very high	25 Å²	25	92.9 Å²	92.9	13%	0.131	45%	0.449	C	S	.	.	H	α-helix	trans	-58.1	-50.9	172.5	-80	164.9	0	0	0	111.8	W50 I62 F64 V81 Y87 L88 Q89	W50-L85 HydrophobicContact CB-CD2 4.32Å; W50-L85 HydrophobicContact CD2-CD2 3.21Å; W50-L85 VanDerWaalsContact CE2-CD2 3.42Å; W50-L85 HydrophobicContact CE3-CD2 3.55Å; W50-L85 HydrophobicContact CG-CD2 3.56Å; W50-L85 HydrophobicContact CH2-CD2 4.21Å; W50-L85 HydrophobicContact CZ2-CD2 3.93Å; W50-L85 HydrophobicContact CZ3-CD2 4.03Å; I62-L85 HydrophobicContact CG1-CD1 4.26Å; I62-L85 HydrophobicContact CG2-CD1 4.48Å; I62-L85 HydrophobicContact CG2-CD2 4.1Å; I62-L85 HydrophobicContact CG2-CG 4.41Å; F64-L85 HydrophobicContact CE1-CD2 4.28Å; F64-L85 HydrophobicContact CE1-CG 4.19Å; F64-L85 HydrophobicContact CZ-CG 4.17Å; V81-L85 HydrophobicContact CG1-CD1 4.3Å; V81-L85 PolarHBondContact O-N 3.5Å; L85-Y87 VanDerWaalsContact C-N 3.28Å; L85-Y87 PolarHBondContact O-N 3Å; L85-L88 PolarHBondContact O-N 3.35Å; L85-Q89 WeakPolarHBondContact O-CB 3.42Å; L85-Q89 VanDerWaalsContact O-CG 3.29Å; L85-Q89 WeakPolarHBondContact O-CG 3.37Å; L85-Q89 PolarHBondContact O-N 3.34Å
86	K	96.6	Very high	92.8	Very high	148 Å²	148	95.2 Å²	95.2	64%	0.643	46%	0.459	S	S	*	.	H	α-helix	trans	-58.7	-40.3	177.4	-72.6	-179.9	-179.2	-171.9	0	112.3	K82 K83 Q89 S90	K82-K86 WeakPolarHBondContact O-CG 3.44Å; K82-K86 PolarHBondContact O-N 2.96Å; K82-K86 VanDerWaalsContact O-N 3.12Å; K83-K86 PolarHBondContact O-N 2.98Å; K86-Q89 PolarHBondContact O-N 3.07Å; K86-S90 WeakPolarHBondContact O-CB 3.42Å; K86-S90 PolarHBondContact O-N 3.34Å
87	Y	95.2	Very high	92.5	Very high	82 Å²	82	98.8 Å²	98.8	32%	0.322	47%	0.474	S	S	.	.	H	α-helix	trans	-59.4	-53	175.2	172.2	-106.8	0	0	0	111.2	L44 K83 A84 L85 Q89 S90 L91	L44-Y87 HydrophobicContact CB-CD1 4.33Å; L44-Y87 HydrophobicContact CB-CE1 4.36Å; L44-Y87 HydrophobicContact CD2-CD1 4.39Å; L44-Y87 VanDerWaalsContact O-CE1 3.31Å; L44-Y87 WeakPolarHBondContact O-CE1 3.32Å; K83-Y87 PolarHBondContact O-N 2.98Å; A84-Y87 WeakPolarHBondContact O-CB 3.28Å; A84-Y87 PolarHBondContact O-N 3.46Å; L85-Y87 VanDerWaalsContact C-N 3.28Å; L85-Y87 PolarHBondContact O-N 3Å; Y87-Q89 PolarHBondContact O-N 3.45Å; Y87-S90 PolarHBondContact O-N 3.46Å; Y87-S90 VanDerWaalsContact O-N 3.17Å; Y87-S90 PolarHBondContact O-OG 3Å; Y87-L91 HydrophobicContact CD1-CD1 4.35Å; Y87-L91 HydrophobicContact CE1-CD1 3.73Å; Y87-L91 HydrophobicContact CE2-CD1 4.25Å; Y87-L91 HydrophobicContact CE2-CD2 4.48Å; Y87-L91 HydrophobicContact CE2-CG 4.44Å; Y87-L91 PolarHBondContact O-N 3.02Å
88	L	95.9	Very high	92.3	Very high	7 Å²	7	97.6 Å²	97.6	4%	0.037	47%	0.465	C	S	.	.	H	α-helix	trans	-60.7	-42.4	177.9	-74.1	173.7	0	0	0	112.6	L47 W50 F64 A84 L85 S90 L91 Q92	L47-L88 HydrophobicContact CB-CD1 4.1Å; L47-L88 HydrophobicContact CB-CD2 3.79Å; L47-L88 HydrophobicContact CB-CG 4.23Å; L47-L88 HydrophobicContact CD1-CD1 4.05Å; L47-L88 HydrophobicContact CD1-CG 4.38Å; W50-L88 HydrophobicContact CB-CD1 4.11Å; W50-L88 HydrophobicContact CG-CD1 4.3Å; F64-L88 HydrophobicContact CD1-CD1 3.79Å; F64-L88 HydrophobicContact CE1-CD1 4.01Å; A84-L88 PolarHBondContact O-N 3.35Å; L85-L88 PolarHBondContact O-N 3.35Å; L88-S90 VanDerWaalsContact C-N 3.28Å; L88-S90 PolarHBondContact O-N 3.48Å; L88-L91 PolarHBondContact O-N 3.11Å; L88-Q92 PolarHBondContact O-N 3.48Å
89	Q	95.1	Very high	92	Very high	78 Å²	78	99.6 Å²	99.6	36%	0.364	47%	0.472	S	S	.	.	H	α-helix	trans	-62.5	-34.9	176.7	-72.9	171.4	-17.2	0	0	112.5	L85 K86 Y87 L91 Q92	L85-Q89 WeakPolarHBondContact O-CB 3.42Å; L85-Q89 VanDerWaalsContact O-CG 3.29Å; L85-Q89 WeakPolarHBondContact O-CG 3.37Å; L85-Q89 PolarHBondContact O-N 3.34Å; K86-Q89 PolarHBondContact O-N 3.07Å; Y87-Q89 PolarHBondContact O-N 3.45Å; Q89-L91 VanDerWaalsContact C-N 3.32Å; Q89-Q92 PolarHBondContact O-N 3.45Å
90	S	94.8	Very high	91.7	Very high	66 Å²	66	94.3 Å²	94.3	46%	0.462	45%	0.451	S	S	.	.	H	α-helix	trans	-68	-33.3	176.5	74.1	0	0	0	0	112.4	K86 Y87 L88 R93	K86-S90 WeakPolarHBondContact O-CB 3.42Å; K86-S90 PolarHBondContact O-N 3.34Å; Y87-S90 PolarHBondContact O-N 3.46Å; Y87-S90 VanDerWaalsContact O-N 3.17Å; Y87-S90 PolarHBondContact O-OG 3Å; L88-S90 VanDerWaalsContact C-N 3.28Å; L88-S90 PolarHBondContact O-N 3.48Å; S90-R93 PolarHBondContact O-N 2.98Å
91	L	91.1	Very high	91.4	Very high	88 Å²	88	90.4 Å²	90.4	46%	0.461	44%	0.437	S	S	.	.	H	α-helix	trans	-72.3	-29.3	176.2	-63.4	178.3	0	0	0	113	Y87 L88 Q89 R93	Y87-L91 HydrophobicContact CD1-CD1 4.35Å; Y87-L91 HydrophobicContact CE1-CD1 3.73Å; Y87-L91 HydrophobicContact CE2-CD1 4.25Å; Y87-L91 HydrophobicContact CE2-CD2 4.48Å; Y87-L91 HydrophobicContact CE2-CG 4.44Å; Y87-L91 PolarHBondContact O-N 3.02Å; L88-L91 PolarHBondContact O-N 3.11Å; Q89-L91 VanDerWaalsContact C-N 3.32Å; L91-R93 VanDerWaalsContact C-N 3.29Å
92	Q	84.7	Confident	91	Very high	143 Å²	143	97.2 Å²	97.2	67%	0.668	47%	0.469	S	S	*	.	H	α-helix	trans	-77.1	-15.1	178.1	-68.9	-173.6	-63.6	0	0	113.8	L88 Q89	L88-Q92 PolarHBondContact O-N 3.48Å; Q89-Q92 PolarHBondContact O-N 3.45Å
93	R	78.8	Confident	90.5	Very high	219 Å²	219	96.8 Å²	96.8	83%	0.826	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.8	-9.2	-179.7	-70.6	-179.8	179.2	-179.9	-0.5	113.3	S90 L91	S90-R93 PolarHBondContact O-N 2.98Å; L91-R93 VanDerWaalsContact C-N 3.29Å
94	S	63	Low	89.9	Confident	158 Å²	158	92.2 Å²	92.2	100%	1.105	46%	0.456	S	S	*	.			trans	-91.9	0	175.9	-176	0	0	0	0	110.9

Retrieved 94 of 94 residues in 148.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).