A0A096NNV7_PAPAN Loading...

T cell receptor alpha variable 30

AlphaFold DB , UniProt , Accession A0A096NNV7, Species PAPAN (Papio anubis, Olive baboon), Gene TRAV30, Length 93 aa.

						>A0A096NNV7_PAPAN|A0A096NNV7|TRAV30
QKPVQSPQVVILQEGEDAIINCNSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKSHDKIVATFNEKKQQSSLYLMASQLSYSRTYFCGAETQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Q	61.5	Low	90.3	Very high	158 Å²	158	100.3 Å²	100.3	74%	0.738	53%	0.53	S	S	*	.				0	138.8	0	-171.3	72.1	20.6	0	0	106.9
2	K	80	Confident	90.4	Very high	173 Å²	173	96.7 Å²	96.7	75%	0.752	51%	0.511	S	S	*	.	P	Polyproline II helix	trans	-70.6	135.7	176.7	-172.7	-178.5	176.4	-178.8	0	109.9
3	P	88.7	Confident	90.7	Very high	16 Å²	16	100.5 Å²	100.5	10%	0.104	52%	0.524	C	S	.	.	P	Polyproline II helix	trans	-64.8	152.3	174.9	27.4	-35	0	0	0	111.6	C22 N23 A90	P3-C22 VanDerWaalsContact CB-SG 3.59Å; P3-N23 CarbonylContact C-O 3.52Å; P3-N23 VanDerWaalsContact CA-O 3.24Å; P3-N23 WeakPolarHBondContact CA-O 3.47Å; P3-N23 WeakPolarHBondContact CB-O 3.43Å; P3-A90 HydrophobicContact CB-CB 4.47Å; P3-A90 HydrophobicContact CG-CB 4Å
4	V	95.1	Very high	90.9	Very high	98 Å²	98	102.5 Å²	102.5	59%	0.594	53%	0.53	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.7	123	-179.4	-178.4	0	0	0	0	109.3	N23	V4-N23 PolarHBondContact N-O 3.5Å; V4-N23 PolarHBondContact O-N 2.96Å
5	Q	96.1	Very high	91.1	Very high	34 Å²	34	98.8 Å²	98.8	16%	0.159	53%	0.527	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	140.2	175.4	-73.7	-177.2	-105.4	0	0	112	Q8 N21 C22 Y86 C88	Q5-Q8 PolarHBondContact O-NE2 3.49Å; Q5-N21 CarbonylContact C-O 3.55Å; Q5-N21 WeakPolarHBondContact CA-O 3.31Å; Q5-C22 HydrophobicContact CG-CB 4.32Å; Q5-Y86 PolarHBondContact NE2-O 2.98Å; Q5-C88 VanDerWaalsContact CD-N 3.26Å; Q5-C88 HydrophobicContact CG-CB 3.78Å
6	S	96.7	Very high	91.4	Very high	63 Å²	63	98.7 Å²	98.7	44%	0.441	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.7	139.5	176.4	-178.9	0	0	0	0	111.2	N21	S6-N21 PolarHBondContact N-O 3.22Å; S6-N21 PolarHBondContact O-N 2.75Å
7	P	96.8	Very high	91.7	Very high	52 Å²	52	99.6 Å²	99.6	34%	0.338	53%	0.528	S	S	.	.			cis	-72.8	161.7	-4	31.8	-37.3	0	0	0	112.6	V10 I19	P7-V10 HydrophobicContact CB-CG2 4.26Å; P7-V10 HydrophobicContact CG-CG2 3.27Å; P7-I19 WeakPolarHBondContact CD-O 3.18Å
8	Q	94.6	Very high	91.9	Very high	161 Å²	161	94.6 Å²	94.6	75%	0.752	50%	0.502	S	S	*	.	S	Bend	trans	-77.1	-33.2	177.7	-67.6	-70.3	-41.5	0	0	112.3	Q5	Q5-Q8 PolarHBondContact O-NE2 3.49Å
9	V	95.1	Very high	92.2	Very high	115 Å²	115	93.7 Å²	93.7	70%	0.697	50%	0.497	S	S	*	.			trans	-138.6	136.3	179.1	-179.8	0	0	0	0	107.7	I11	V9-I11 HydrophobicContact CG1-CG1 4.26Å
10	V	94.4	Very high	92.4	Very high	70 Å²	70	89.9 Å²	89.9	42%	0.424	48%	0.476	S	S	.	.			trans	-126.7	130	171	-167	0	0	0	0	107.7	P7 L12 A18	P7-V10 HydrophobicContact CB-CG2 4.26Å; P7-V10 HydrophobicContact CG-CG2 3.27Å; V10-L12 HydrophobicContact CB-CD2 4.32Å; V10-L12 HydrophobicContact CG1-CB 4.44Å; V10-L12 HydrophobicContact CG1-CD2 3.59Å; V10-L12 HydrophobicContact CG1-CG 4.48Å; V10-A18 HydrophobicContact CG1-CB 4.44Å
11	I	94	Very high	92.7	Very high	163 Å²	163	87.5 Å²	87.5	84%	0.836	46%	0.464	S	S	*	.			trans	-117.5	124.1	171.3	-56.4	173.2	0	0	0	105.5	V9	V9-I11 HydrophobicContact CG1-CG1 4.26Å
12	L	92.3	Very high	94.4	Very high	57 Å²	57	80 Å²	80	30%	0.298	43%	0.429	S	S	.	.			trans	-149.6	156	-171.6	61.6	93.9	0	0	0	109.9	V10 E16 A18	V10-L12 HydrophobicContact CB-CD2 4.32Å; V10-L12 HydrophobicContact CG1-CB 4.44Å; V10-L12 HydrophobicContact CG1-CD2 3.59Å; V10-L12 HydrophobicContact CG1-CG 4.48Å; L12-E16 VanDerWaalsContact CA-OE2 3.29Å; L12-E16 WeakPolarHBondContact CA-OE2 3.24Å; L12-E16 HydrophobicContact CB-CB 4.25Å; L12-E16 WeakPolarHBondContact CB-OE2 3.33Å; L12-E16 HydrophobicContact CD1-CB 4.4Å; L12-A18 HydrophobicContact CD2-CB 3.65Å
13	Q	93.7	Very high	95.1	Very high	146 Å²	146	74.1 Å²	74.1	68%	0.682	41%	0.406	S	S	*	.			trans	-85.3	156.8	174.2	-63.8	-66.2	-21.7	0	0	111.1	G15 E16	Q13-G15 PolarHBondContact O-N 3.05Å; Q13-E16 HydrophobicContact CB-CG 4.18Å; Q13-E16 PolarHBondContact N-OE2 2.77Å; Q13-E16 WeakPolarHBondContact O-CB 3.43Å; Q13-E16 PolarHBondContact O-N 3.39Å; Q13-E16 VanDerWaalsContact O-N 3.11Å
14	E	93.5	Very high	95.4	Very high	129 Å²	129	74.1 Å²	74.1	60%	0.603	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	136.4	173.4	178.7	161.2	-149.7	0	0	110.9	E16 S78	E14-E16 VanDerWaalsContact C-N 3.35Å; E14-S78 CarbonylContact C-O 3.53Å; E14-S78 WeakPolarHBondContact CA-O 3.29Å; E14-S78 WeakPolarHBondContact CG-O 3.4Å
15	G	94.3	Very high	95.2	Very high	47 Å²	47	74.9 Å²	74.9	49%	0.485	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	89.4	-12.6	-174.5	0	0	0	0	0	114.8	Q13 S78	Q13-G15 PolarHBondContact O-N 3.05Å; G15-S78 PolarHBondContact N-O 2.92Å
16	E	95.8	Very high	95	Very high	97 Å²	97	77.3 Å²	77.3	45%	0.453	43%	0.426	S	S	.	.			trans	-77.8	152.8	175.2	-64.6	-171.2	133.4	0	0	112.3	L12 Q13 E14 S78	L12-E16 VanDerWaalsContact CA-OE2 3.29Å; L12-E16 WeakPolarHBondContact CA-OE2 3.24Å; L12-E16 HydrophobicContact CB-CB 4.25Å; L12-E16 WeakPolarHBondContact CB-OE2 3.33Å; L12-E16 HydrophobicContact CD1-CB 4.4Å; Q13-E16 HydrophobicContact CB-CG 4.18Å; Q13-E16 PolarHBondContact N-OE2 2.77Å; Q13-E16 WeakPolarHBondContact O-CB 3.43Å; Q13-E16 PolarHBondContact O-N 3.39Å; Q13-E16 VanDerWaalsContact O-N 3.11Å; E14-E16 VanDerWaalsContact C-N 3.35Å; E16-S78 WeakPolarHBondContact O-CB 3.33Å; E16-S78 PolarHBondContact O-N 3.04Å; E16-S78 PolarHBondContact O-OG 3.09Å
17	D	95.8	Very high	94.8	Very high	115 Å²	115	75.9 Å²	75.9	62%	0.615	42%	0.418	S	S	*	.			trans	-92.6	144.8	176.2	-67.3	-14.8	0	0	0	110.7	L75 M76 A77	D17-L75 CarbonylContact C-O 3.56Å; D17-L75 VanDerWaalsContact CA-O 3.31Å; D17-L75 WeakPolarHBondContact CA-O 3.45Å; D17-M76 VanDerWaalsContact OD1-CA 3.25Å; D17-M76 WeakPolarHBondContact OD1-CA 3.31Å; D17-A77 PolarHBondContact OD1-N 3.45Å
18	A	95.4	Very high	94.5	Very high	8 Å²	8	73.9 Å²	73.9	7%	0.066	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	150.3	173.6	0	0	0	0	0	111.4	V10 L12 Y74 L75	V10-A18 HydrophobicContact CG1-CB 4.44Å; L12-A18 HydrophobicContact CD2-CB 3.65Å; A18-Y74 CarbonylContact O-C 3.58Å; A18-Y74 WeakPolarHBondContact O-CA 3.35Å; A18-L75 HydrophobicContact CB-CB 4.18Å; A18-L75 HydrophobicContact CB-CD1 4.26Å; A18-L75 PolarHBondContact N-O 3.18Å; A18-L75 PolarHBondContact O-N 2.68Å
19	I	97.5	Very high	94.3	Very high	78 Å²	78	72 Å²	72	40%	0.4	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	125.7	174.6	-52.1	174.3	0	0	0	108.6	P7 L73 Y74	P7-I19 WeakPolarHBondContact CD-O 3.18Å; I19-L73 WeakPolarHBondContact CA-O 3.22Å; I19-Y74 HydrophobicContact CD1-CD1 3.77Å; I19-Y74 HydrophobicContact CD1-CE1 3.49Å; I19-Y74 VanDerWaalsContact CD1-CE1 3.49Å; I19-Y74 HydrophobicContact CG1-CD1 3.6Å; I19-Y74 HydrophobicContact CG1-CE1 3.82Å; I19-Y74 HydrophobicContact CG1-CG 4.48Å; I19-Y74 HydrophobicContact CG2-CD1 4.29Å; I19-Y74 HydrophobicContact CG2-CE1 4.12Å
20	I	97.7	Very high	94.2	Very high	17 Å²	17	66.8 Å²	66.8	9%	0.087	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	118.4	173.7	-51.7	175.5	0	0	0	107.6	W33 S72 L73 L75 Y86	I20-W33 HydrophobicContact CB-CH2 4.3Å; I20-W33 HydrophobicContact CB-CZ3 4.42Å; I20-W33 HydrophobicContact CG2-CH2 4Å; I20-W33 HydrophobicContact CG2-CZ3 4.04Å; I20-W33 WeakPolarHBondContact O-CH2 3.26Å; I20-S72 CarbonylContact O-C 3.58Å; I20-S72 WeakPolarHBondContact O-CA 2.97Å; I20-L73 HydrophobicContact CB-CB 4.38Å; I20-L73 PolarHBondContact N-O 3.01Å; I20-L73 PolarHBondContact O-N 2.95Å; I20-L75 HydrophobicContact CD1-CD1 4.31Å; I20-Y86 HydrophobicContact CD1-CD2 3.75Å; I20-Y86 HydrophobicContact CD1-CG 3.82Å
21	N	97.9	Very high	94.3	Very high	40 Å²	40	63.5 Å²	63.5	21%	0.214	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	145.7	179	-60.2	-63.9	0	0	0	110.5	Q5 S6 Q70 S71 S72	Q5-N21 CarbonylContact C-O 3.55Å; Q5-N21 WeakPolarHBondContact CA-O 3.31Å; S6-N21 PolarHBondContact N-O 3.22Å; S6-N21 PolarHBondContact O-N 2.75Å; N21-Q70 PolarHBondContact OD1-NE2 2.91Å; N21-S71 CarbonylContact C-O 3.51Å; N21-S72 WeakPolarHBondContact OD1-CB 3.47Å; N21-S72 PolarHBondContact OD1-OG 2.75Å
22	C	96.8	Very high	94.4	Very high	0 Å²	0	57.8 Å²	57.8	0%	0	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	111.6	174.1	-179.2	0	0	0	0	108.5	P3 Q5 W33 Q70 S71 C88	P3-C22 VanDerWaalsContact CB-SG 3.59Å; Q5-C22 HydrophobicContact CG-CB 4.32Å; C22-W33 HydrophobicContact CB-CH2 3.81Å; C22-W33 HydrophobicContact CB-CZ2 3.73Å; C22-Q70 CarbonylContact O-C 3.57Å; C22-Q70 VanDerWaalsContact O-CA 3.28Å; C22-Q70 WeakPolarHBondContact O-CA 3.3Å; C22-S71 PolarHBondContact N-O 3.05Å; C22-S71 PolarHBondContact O-N 2.78Å; C22-C88 HydrophobicContact CB-CB 3.46Å; C22-C88 VanDerWaalsContact CB-CB 3.46Å; C22-C88 WeakPolarHBondContact CB-SG 3.08Å; C22-C88 WeakPolarHBondContact SG-CB 2.84Å; C22-C88 CovalentContact SG-SG 2.02Å; C22-C88 PolarHBondContact SG-SG 2.82Å
23	N	95.4	Very high	94.6	Very high	51 Å²	51	55.1 Å²	55.1	27%	0.273	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	147.3	-173.9	-74.2	-78.8	0	0	0	111.2	P3 V4 Q70	P3-N23 CarbonylContact C-O 3.52Å; P3-N23 VanDerWaalsContact CA-O 3.24Å; P3-N23 WeakPolarHBondContact CA-O 3.47Å; P3-N23 WeakPolarHBondContact CB-O 3.43Å; V4-N23 PolarHBondContact N-O 3.5Å; V4-N23 PolarHBondContact O-N 2.96Å; N23-Q70 PolarHBondContact ND2-OE1 2.81Å; N23-Q70 VanDerWaalsContact OD1-CB 3.31Å; N23-Q70 WeakPolarHBondContact OD1-CB 3.31Å; N23-Q70 WeakPolarHBondContact OD1-CG 3.5Å; N23-Q70 PolarHBondContact OD1-OE1 2.98Å
24	S	93.9	Very high	94.8	Very high	16 Å²	16	51.6 Å²	51.6	11%	0.112	28%	0.276	C	S	.	.			trans	-133.2	139.9	173.2	174.4	0	0	0	0	110.7	K26 Q69	S24-K26 WeakPolarHBondContact CB-O 3.46Å; S24-K26 PolarHBondContact O-N 2.84Å; S24-K26 PolarHBondContact OG-N 2.85Å; S24-K26 PolarHBondContact OG-O 2.87Å; S24-Q69 PolarHBondContact N-O 2.79Å; S24-Q69 WeakPolarHBondContact O-CB 3.5Å
25	S	92.3	Very high	94.8	Very high	113 Å²	113	48.2 Å²	48.2	79%	0.79	26%	0.258	S	S	*	.	S	Bend	trans	-76.2	-10.4	169.6	56.1	0	0	0	0	112.9
26	K	91.7	Very high	94.9	Very high	86 Å²	86	48.3 Å²	48.3	37%	0.374	25%	0.246	S	C	.	.	S	Bend	trans	-112	159.2	177.7	-65.6	-161.1	172.6	-166.3	0	111.5	S24 L28 Q93	S24-K26 WeakPolarHBondContact CB-O 3.46Å; S24-K26 PolarHBondContact O-N 2.84Å; S24-K26 PolarHBondContact OG-N 2.85Å; S24-K26 PolarHBondContact OG-O 2.87Å; K26-L28 PolarHBondContact O-N 3.09Å; K26-Q93 WeakPolarHBondContact CD-O 3.34Å; K26-Q93 WeakPolarHBondContact CE-O 3.14Å; K26-Q93 VanDerWaalsContact NZ-C 3.32Å; K26-Q93 PolarHBondContact NZ-O 3.3Å; K26-Q93 PolarHBondContact NZ-OXT 2.81Å
27	A	91.3	Very high	94.9	Very high	33 Å²	33	48.4 Å²	48.4	27%	0.273	25%	0.245	S	C	.	.			trans	-56.5	124.4	172.1	0	0	0	0	0	110.9	T92 Q93	A27-T92 VanDerWaalsContact O-CA 3.26Å; A27-T92 WeakPolarHBondContact O-CA 3.35Å; A27-Q93 HydrophobicContact CB-CB 4.46Å; A27-Q93 HydrophobicContact CB-CG 4.32Å; A27-Q93 PolarHBondContact O-N 2.99Å; A27-Q93 VanDerWaalsContact O-N 3.09Å
28	L	91.4	Very high	94.7	Very high	9 Å²	9	51.8 Å²	51.8	5%	0.047	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	123.3	174.5	-65.1	-178.3	0	0	0	108.9	K26 V31 F64 Q69 A90 T92	K26-L28 PolarHBondContact O-N 3.09Å; L28-V31 HydrophobicContact CB-CG2 4.32Å; L28-V31 HydrophobicContact CD1-CG2 3.8Å; L28-F64 HydrophobicContact CB-CE2 3.82Å; L28-F64 HydrophobicContact CB-CZ 3.65Å; L28-F64 HydrophobicContact CD1-CE2 3.92Å; L28-F64 HydrophobicContact CG-CE2 4.45Å; L28-F64 WeakPolarHBondContact O-CZ 3.24Å; L28-Q69 WeakPolarHBondContact CD1-O 3.39Å; L28-Q69 HydrophobicContact CG-CB 4.47Å; L28-A90 HydrophobicContact CD2-CB 3.56Å; L28-T92 HydrophobicContact CD2-CG2 3.69Å
29	Y	90.6	Very high	94.7	Very high	122 Å²	122	55.1 Å²	55.1	48%	0.478	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.9	-44.7	171.5	-72.3	-57.3	0	0	0	111.6	E91 Q93	Y29-E91 HydrophobicContact CD2-CG 4.28Å; Y29-E91 PolarHBondContact N-O 3.22Å; Y29-Q93 HydrophobicContact CD2-CG 4.08Å; Y29-Q93 HydrophobicContact CE1-CG 3.96Å; Y29-Q93 HydrophobicContact CE2-CB 4.28Å; Y29-Q93 HydrophobicContact CE2-CG 3.17Å; Y29-Q93 VanDerWaalsContact CZ-CD 3.5Å; Y29-Q93 WeakPolarHBondContact OH-CG 3.31Å; Y29-Q93 PolarHBondContact OH-NE2 3.48Å
30	S	92.7	Very high	94.7	Very high	6 Å²	6	55.4 Å²	55.4	4%	0.042	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.2	147.8	179.3	65.3	0	0	0	0	110.2	H32 L48 A90 E91	S30-H32 PolarHBondContact OG-CE1 2.84Å; S30-H32 VanDerWaalsContact OG-CE1 3.32Å; S30-L48 WeakPolarHBondContact CA-O 3.37Å; S30-A90 VanDerWaalsContact O-CA 3.29Å; S30-A90 WeakPolarHBondContact O-CA 3.25Å; S30-E91 PolarHBondContact O-N 3.45Å; S30-E91 VanDerWaalsContact OG-CB 3.28Å; S30-E91 WeakPolarHBondContact OG-CB 3.47Å; S30-E91 PolarHBondContact OG-OE2 2.83Å
31	V	95.6	Very high	94.6	Very high	0 Å²	0	58 Å²	58	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	132	175.2	-170	0	0	0	0	109.7	L28 I47 L48 F64 C88 A90	L28-V31 HydrophobicContact CB-CG2 4.32Å; L28-V31 HydrophobicContact CD1-CG2 3.8Å; V31-I47 CarbonylContact O-C 3.56Å; V31-I47 VanDerWaalsContact O-CA 3.26Å; V31-I47 WeakPolarHBondContact O-CA 3.28Å; V31-L48 PolarHBondContact N-O 2.9Å; V31-L48 PolarHBondContact O-N 2.79Å; V31-F64 HydrophobicContact CG2-CD2 4.26Å; V31-F64 HydrophobicContact CG2-CE2 4.38Å; V31-C88 WeakPolarHBondContact CG1-SG 3.26Å; V31-A90 HydrophobicContact CG2-CB 4.39Å
32	H	95.9	Very high	94.5	Very high	44 Å²	44	59.5 Å²	59.5	20%	0.204	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	130.8	-179	-52.1	88	0	0	0	108.9	S30 Y34 M46 I47 C88 G89	S30-H32 PolarHBondContact OG-CE1 2.84Å; S30-H32 VanDerWaalsContact OG-CE1 3.32Å; H32-Y34 HydrophobicContact CB-CD2 4.34Å; H32-Y34 HydrophobicContact CB-CE2 3.45Å; H32-Y34 VanDerWaalsContact CB-CE2 3.45Å; H32-M46 WeakPolarHBondContact CA-O 3.12Å; H32-I47 VanDerWaalsContact CD2-CD1 3.43Å; H32-I47 WeakPolarHBondContact CD2-CD1 3.48Å; H32-I47 VanDerWaalsContact CD2-CG1 3.48Å; H32-I47 WeakPolarHBondContact CD2-CG1 3.43Å; H32-I47 WeakPolarHBondContact NE2-CD1 3.36Å; H32-C88 WeakPolarHBondContact O-CA 3.35Å; H32-G89 WeakPolarHBondContact CB-O 3.38Å; H32-G89 PolarHBondContact N-O 3.25Å; H32-G89 PolarHBondContact ND1-O 3.23Å; H32-G89 PolarHBondContact O-N 3.17Å
33	W	97.6	Very high	94.5	Very high	0 Å²	0	63 Å²	63	0%	0	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	138.2	172.1	-74.5	101.3	0	0	0	110.3	I20 C22 L45 M46 S71 L73 F87 C88	I20-W33 HydrophobicContact CB-CH2 4.3Å; I20-W33 HydrophobicContact CB-CZ3 4.42Å; I20-W33 HydrophobicContact CG2-CH2 4Å; I20-W33 HydrophobicContact CG2-CZ3 4.04Å; I20-W33 WeakPolarHBondContact O-CH2 3.26Å; C22-W33 HydrophobicContact CB-CH2 3.81Å; C22-W33 HydrophobicContact CB-CZ2 3.73Å; W33-L45 HydrophobicContact CB-CB 4.29Å; W33-L45 HydrophobicContact CB-CD1 4.48Å; W33-L45 WeakPolarHBondContact O-CB 3.42Å; W33-L45 PolarHBondContact O-N 2.9Å; W33-M46 HydrophobicContact CB-CG 4.22Å; W33-M46 PolarHBondContact N-O 2.95Å; W33-M46 PolarHBondContact O-N 3.33Å; W33-S71 PolarHBondContact NE1-OG 3.01Å; W33-L73 HydrophobicContact CB-CD1 4.27Å; W33-L73 HydrophobicContact CD2-CB 3.88Å; W33-L73 HydrophobicContact CD2-CD1 4.05Å; W33-L73 HydrophobicContact CD2-CD2 4.12Å; W33-L73 HydrophobicContact CD2-CG 4.25Å; W33-L73 HydrophobicContact CE3-CB 3.95Å; W33-L73 HydrophobicContact CE3-CD2 3.73Å; W33-L73 HydrophobicContact CE3-CG 4.28Å; W33-L73 HydrophobicContact CG-CD1 3.93Å; W33-L73 HydrophobicContact CH2-CB 3.78Å; W33-L73 HydrophobicContact CZ2-CB 3.74Å; W33-L73 HydrophobicContact CZ3-CB 3.9Å; W33-L73 HydrophobicContact CZ3-CD2 4.1Å; W33-F87 WeakPolarHBondContact CA-O 3.43Å; W33-C88 HydrophobicContact CE3-CB 4.14Å; W33-C88 HydrophobicContact CH2-CB 3.98Å; W33-C88 HydrophobicContact CZ2-CB 4.33Å; W33-C88 HydrophobicContact CZ3-CB 3.87Å
34	Y	96.8	Very high	94.5	Very high	72 Å²	72	65.5 Å²	65.5	28%	0.282	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	151.9	176.9	-56.9	-96.2	0	0	0	109.7	H32 V43 F44 Y86 F87	H32-Y34 HydrophobicContact CB-CD2 4.34Å; H32-Y34 HydrophobicContact CB-CE2 3.45Å; H32-Y34 VanDerWaalsContact CB-CE2 3.45Å; Y34-V43 CarbonylContact C-O 3.56Å; Y34-V43 VanDerWaalsContact CA-O 3.24Å; Y34-V43 WeakPolarHBondContact CA-O 3.34Å; Y34-F44 HydrophobicContact CD1-CB 4.16Å; Y34-F44 HydrophobicContact CE1-CB 4.04Å; Y34-F44 AromaticContact CE1-CD2 3.99Å; Y34-F44 HydrophobicContact CE1-CD2 3.99Å; Y34-Y86 WeakPolarHBondContact O-CA 3.42Å; Y34-F87 PolarHBondContact N-O 3Å; Y34-F87 PolarHBondContact O-N 3.36Å
35	R	95.5	Very high	94.6	Very high	59 Å²	59	65.7 Å²	65.7	22%	0.223	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	145.8	166.3	61.7	174.4	175.1	-164	1.8	110.3	V43 L45 T85 Y86	R35-V43 PolarHBondContact N-O 2.75Å; R35-V43 PolarHBondContact O-N 2.76Å; R35-L45 HydrophobicContact CB-CD1 3.94Å; R35-L45 HydrophobicContact CB-CD2 4.39Å; R35-L45 HydrophobicContact CB-CG 4.18Å; R35-L45 HydrophobicContact CG-CD1 4.16Å; R35-L45 HydrophobicContact CG-CD2 3.69Å; R35-L45 HydrophobicContact CG-CG 3.88Å; R35-T85 CarbonylContact C-O 3.59Å; R35-T85 WeakPolarHBondContact CA-O 3.49Å; R35-Y86 HydrophobicContact CB-CD1 3.98Å; R35-Y86 HydrophobicContact CB-CE1 3.87Å
36	Q	96.3	Very high	94.8	Very high	49 Å²	49	60.8 Å²	60.8	23%	0.229	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	125.7	177.1	-173.2	-177.7	36.1	0	0	109.4	E40 P42 R84 T85 F87	Q36-E40 WeakPolarHBondContact CG-O 3.35Å; Q36-E40 PolarHBondContact NE2-O 3.43Å; Q36-P42 HydrophobicContact CG-CG 4.44Å; Q36-R84 WeakPolarHBondContact O-CB 3.35Å; Q36-T85 PolarHBondContact N-O 2.87Å; Q36-T85 PolarHBondContact O-N 2.83Å; Q36-F87 HydrophobicContact CB-CD2 4.34Å; Q36-F87 HydrophobicContact CB-CE2 3.69Å; Q36-F87 HydrophobicContact CG-CE2 4.46Å
37	K	95.1	Very high	95.1	Very high	98 Å²	98	58.9 Å²	58.9	43%	0.426	32%	0.315	S	S	.	.			trans	-80.3	145.2	164.9	-168.9	167.5	148.1	-137.4	0	108.6	G39 E40	K37-G39 PolarHBondContact O-N 3.42Å; K37-E40 HydrophobicContact CB-CB 4.24Å; K37-E40 HydrophobicContact CB-CG 4.24Å; K37-E40 WeakPolarHBondContact CB-OE2 3.2Å; K37-E40 VanDerWaalsContact CD-OE1 3.31Å; K37-E40 WeakPolarHBondContact CD-OE1 3.43Å; K37-E40 WeakPolarHBondContact CE-OE1 3.17Å; K37-E40 IonicContact NZ-OE1 2.77Å; K37-E40 PolarHBondContact NZ-OE1 2.72Å; K37-E40 PolarHBondContact O-N 2.93Å
38	H	92.3	Very high	95.4	Very high	186 Å²	186	57.3 Å²	57.3	86%	0.861	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53	127.1	178	-176.2	-94.2	0	0	0	111.2	E40	H38-E40 VanDerWaalsContact C-N 3.32Å; H38-E40 PolarHBondContact O-N 2.86Å
39	G	95	Very high	95.5	Very high	79 Å²	79	61.4 Å²	61.4	81%	0.814	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.2	-4.1	-178	0	0	0	0	0	116	K37	K37-G39 PolarHBondContact O-N 3.42Å
40	E	96.3	Very high	95.5	Very high	83 Å²	83	62.5 Å²	62.5	39%	0.388	33%	0.331	S	S	.	.	S	Bend	trans	-106.3	164.1	177.9	-65	174.8	-160.6	0	0	111.1	Q36 K37 H38	Q36-E40 WeakPolarHBondContact CG-O 3.35Å; Q36-E40 PolarHBondContact NE2-O 3.43Å; K37-E40 HydrophobicContact CB-CB 4.24Å; K37-E40 HydrophobicContact CB-CG 4.24Å; K37-E40 WeakPolarHBondContact CB-OE2 3.2Å; K37-E40 VanDerWaalsContact CD-OE1 3.31Å; K37-E40 WeakPolarHBondContact CD-OE1 3.43Å; K37-E40 WeakPolarHBondContact CE-OE1 3.17Å; K37-E40 IonicContact NZ-OE1 2.77Å; K37-E40 PolarHBondContact NZ-OE1 2.72Å; K37-E40 PolarHBondContact O-N 2.93Å; H38-E40 VanDerWaalsContact C-N 3.32Å; H38-E40 PolarHBondContact O-N 2.86Å
41	A	95.9	Very high	95.5	Very high	73 Å²	73	63.7 Å²	63.7	60%	0.603	34%	0.344	S	S	*	.			trans	-71.3	153.7	172.9	0	0	0	0	0	111.4	V43	A41-V43 PolarHBondContact O-N 2.83Å
42	P	96.6	Very high	95.4	Very high	71 Å²	71	67 Å²	67	46%	0.461	38%	0.378	S	S	.	.			trans	-59	131.8	170.7	-22.7	34	0	0	0	111.5	Q36 F87	Q36-P42 HydrophobicContact CG-CG 4.44Å; P42-F87 HydrophobicContact CG-CE2 4.47Å
43	V	96.1	Very high	95.4	Very high	72 Å²	72	67.1 Å²	67.1	44%	0.436	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	131.7	178.8	-177.8	0	0	0	0	109.1	Y34 R35 A41 L45	Y34-V43 CarbonylContact C-O 3.56Å; Y34-V43 VanDerWaalsContact CA-O 3.24Å; Y34-V43 WeakPolarHBondContact CA-O 3.34Å; R35-V43 PolarHBondContact N-O 2.75Å; R35-V43 PolarHBondContact O-N 2.76Å; A41-V43 PolarHBondContact O-N 2.83Å; V43-L45 PolarHBondContact O-N 2.88Å
44	F	96	Very high	95.4	Very high	105 Å²	105	73.6 Å²	73.6	46%	0.461	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.6	133.4	176	176.3	-103.9	0	0	0	111.3	Y34 M46 I47	Y34-F44 HydrophobicContact CD1-CB 4.16Å; Y34-F44 HydrophobicContact CE1-CB 4.04Å; Y34-F44 AromaticContact CE1-CD2 3.99Å; Y34-F44 HydrophobicContact CE1-CD2 3.99Å; F44-M46 WeakPolarHBondContact CE2-O 3.41Å; F44-M46 VanDerWaalsContact CZ-CA 3.43Å; F44-I47 HydrophobicContact CE2-CB 4Å; F44-I47 HydrophobicContact CZ-CB 3.86Å; F44-I47 HydrophobicContact CZ-CG2 3.97Å
45	L	95.5	Very high	95.4	Very high	20 Å²	20	73.8 Å²	73.8	11%	0.105	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	-59.8	172.4	-73.1	175	0	0	0	111.1	W33 R35 V43 Y86	W33-L45 HydrophobicContact CB-CB 4.29Å; W33-L45 HydrophobicContact CB-CD1 4.48Å; W33-L45 WeakPolarHBondContact O-CB 3.42Å; W33-L45 PolarHBondContact O-N 2.9Å; R35-L45 HydrophobicContact CB-CD1 3.94Å; R35-L45 HydrophobicContact CB-CD2 4.39Å; R35-L45 HydrophobicContact CB-CG 4.18Å; R35-L45 HydrophobicContact CG-CD1 4.16Å; R35-L45 HydrophobicContact CG-CD2 3.69Å; R35-L45 HydrophobicContact CG-CG 3.88Å; V43-L45 PolarHBondContact O-N 2.88Å; L45-Y86 HydrophobicContact CD1-CD1 4.08Å; L45-Y86 HydrophobicContact CD1-CE1 4.17Å
46	M	97	Very high	95.4	Very high	10 Å²	10	75.1 Å²	75.1	5%	0.049	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.8	160.3	-173.8	54.3	-167.6	63.5	0	0	112	H32 W33 F44 K55 H57 A62	H32-M46 WeakPolarHBondContact CA-O 3.12Å; W33-M46 HydrophobicContact CB-CG 4.22Å; W33-M46 PolarHBondContact N-O 2.95Å; W33-M46 PolarHBondContact O-N 3.33Å; F44-M46 WeakPolarHBondContact CE2-O 3.41Å; F44-M46 VanDerWaalsContact CZ-CA 3.43Å; M46-K55 HydrophobicContact SD-CB 4.03Å; M46-H57 HydrophobicContact CE-CB 3.56Å; M46-A62 HydrophobicContact CG-CB 4.02Å; M46-A62 HydrophobicContact SD-CB 3.34Å; M46-A62 WeakPolarHBondContact SD-CB 3.29Å
47	I	96.9	Very high	95.1	Very high	45 Å²	45	77 Å²	77	23%	0.231	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	136.7	177.5	-173.7	177.5	0	0	0	110	V31 H32 F44 L49 K55	V31-I47 CarbonylContact O-C 3.56Å; V31-I47 VanDerWaalsContact O-CA 3.26Å; V31-I47 WeakPolarHBondContact O-CA 3.28Å; H32-I47 VanDerWaalsContact CD2-CD1 3.43Å; H32-I47 WeakPolarHBondContact CD2-CD1 3.48Å; H32-I47 VanDerWaalsContact CD2-CG1 3.48Å; H32-I47 WeakPolarHBondContact CD2-CG1 3.43Å; H32-I47 WeakPolarHBondContact NE2-CD1 3.36Å; F44-I47 HydrophobicContact CE2-CB 4Å; F44-I47 HydrophobicContact CZ-CB 3.86Å; F44-I47 HydrophobicContact CZ-CG2 3.97Å; I47-L49 HydrophobicContact CD1-CD2 3.49Å; I47-L49 VanDerWaalsContact CD1-CD2 3.49Å; I47-L49 HydrophobicContact CD1-CG 4.21Å; I47-L49 HydrophobicContact CG1-CD2 3.89Å; I47-L49 HydrophobicContact CG1-CG 4.27Å; I47-K55 WeakPolarHBondContact O-CD 3.09Å; I47-K55 WeakPolarHBondContact O-CE 3.28Å; I47-K55 PolarHBondContact O-NZ 3.41Å
48	L	97.4	Very high	94.7	Very high	0 Å²	0	77.8 Å²	77.8	0%	0	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	124.3	172.2	-58.2	96.4	0	0	0	108.4	S30 V31 E53 A62 T63 F64	S30-L48 WeakPolarHBondContact CA-O 3.37Å; V31-L48 PolarHBondContact N-O 2.9Å; V31-L48 PolarHBondContact O-N 2.79Å; L48-E53 WeakPolarHBondContact CA-OE2 3.31Å; L48-E53 HydrophobicContact CB-CB 4.42Å; L48-E53 HydrophobicContact CD2-CB 4.14Å; L48-E53 WeakPolarHBondContact CD2-O 3.29Å; L48-A62 HydrophobicContact CD1-CB 3.67Å; L48-A62 HydrophobicContact CD2-CB 4.24Å; L48-A62 HydrophobicContact CG-CB 4.49Å; L48-T63 VanDerWaalsContact CD2-C 3.47Å; L48-F64 HydrophobicContact CB-CB 3.88Å; L48-F64 HydrophobicContact CB-CD1 4.45Å; L48-F64 HydrophobicContact CD2-CB 3.74Å; L48-F64 HydrophobicContact CG-CB 4.39Å
49	L	94.6	Very high	94.7	Very high	95 Å²	95	73.1 Å²	73.1	50%	0.497	42%	0.424	S	S	.	.			trans	-108.8	-17.9	-171.5	-67.7	176.9	0	0	0	113.3	I47 E53	I47-L49 HydrophobicContact CD1-CD2 3.49Å; I47-L49 VanDerWaalsContact CD1-CD2 3.49Å; I47-L49 HydrophobicContact CD1-CG 4.21Å; I47-L49 HydrophobicContact CG1-CD2 3.89Å; I47-L49 HydrophobicContact CG1-CG 4.27Å; L49-E53 PolarHBondContact N-OE2 3.22Å
50	K	90.9	Very high	94.7	Very high	145 Å²	145	69.4 Å²	69.4	63%	0.63	39%	0.386	S	S	*	.	S	Bend	trans	-135.3	144.6	-175.9	-59	177.8	-178.9	178.4	0	111.4	G52 E53 F64	K50-G52 PolarHBondContact O-N 3.11Å; K50-E53 HydrophobicContact CB-CG 3.96Å; K50-E53 VanDerWaalsContact O-CB 3.26Å; K50-E53 WeakPolarHBondContact O-CB 3.25Å; K50-E53 WeakPolarHBondContact O-CG 3.49Å; K50-E53 PolarHBondContact O-N 3.32Å; K50-F64 VanDerWaalsContact O-CD1 3.29Å; K50-F64 WeakPolarHBondContact O-CD1 3.45Å
51	G	92.4	Very high	94.8	Very high	32 Å²	32	66.3 Å²	66.3	33%	0.33	37%	0.372	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.4	133.3	171.6	0	0	0	0	0	111.8	E53	G51-E53 VanDerWaalsContact C-N 3.31Å
52	G	93.7	Very high	94.9	Very high	68 Å²	68	62.8 Å²	62.8	70%	0.701	34%	0.344	S	S	*	.	T	Hydrogen-bonded Turn	trans	84.5	-3.2	-176	0	0	0	0	0	114.5	K50 F64	K50-G52 PolarHBondContact O-N 3.11Å; G52-F64 WeakPolarHBondContact CA-O 3.4Å; G52-F64 PolarHBondContact N-O 2.79Å
53	E	96.6	Very high	94.9	Very high	47 Å²	47	60.8 Å²	60.8	22%	0.22	33%	0.33	C	S	.	.			trans	-62.4	143.3	174	-82.3	-176.4	-174	0	0	111.7	L48 L49 K50 G51 T63 F64	L48-E53 WeakPolarHBondContact CA-OE2 3.31Å; L48-E53 HydrophobicContact CB-CB 4.42Å; L48-E53 HydrophobicContact CD2-CB 4.14Å; L48-E53 WeakPolarHBondContact CD2-O 3.29Å; L49-E53 PolarHBondContact N-OE2 3.22Å; K50-E53 HydrophobicContact CB-CG 3.96Å; K50-E53 VanDerWaalsContact O-CB 3.26Å; K50-E53 WeakPolarHBondContact O-CB 3.25Å; K50-E53 WeakPolarHBondContact O-CG 3.49Å; K50-E53 PolarHBondContact O-N 3.32Å; G51-E53 VanDerWaalsContact C-N 3.31Å; E53-T63 CarbonylContact O-C 3.58Å; E53-T63 WeakPolarHBondContact O-CA 3.26Å; E53-F64 PolarHBondContact O-N 2.86Å
54	Q	97.4	Very high	95	Very high	137 Å²	137	57.7 Å²	57.7	64%	0.64	31%	0.31	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.2	130.1	167	178	176	-50.5	0	0	108.2	V61 A62 T63	Q54-V61 HydrophobicContact CG-CG1 3.56Å; Q54-A62 CarbonylContact C-O 3.47Å; Q54-A62 VanDerWaalsContact CA-O 3.27Å; Q54-A62 WeakPolarHBondContact CA-O 3.36Å; Q54-T63 HydrophobicContact CB-CG2 4.3Å; Q54-T63 HydrophobicContact CG-CG2 4.03Å
55	K	97.2	Very high	95	Very high	76 Å²	76	55.6 Å²	55.6	33%	0.33	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	147.3	173.8	-67.7	-168.5	-175.6	175.3	0	109.9	M46 I47 V61 A62	M46-K55 HydrophobicContact SD-CB 4.03Å; I47-K55 WeakPolarHBondContact O-CD 3.09Å; I47-K55 WeakPolarHBondContact O-CE 3.28Å; I47-K55 PolarHBondContact O-NZ 3.41Å; K55-V61 CarbonylContact O-C 3.57Å; K55-V61 WeakPolarHBondContact O-CA 3.37Å; K55-A62 PolarHBondContact N-O 2.94Å; K55-A62 PolarHBondContact O-N 2.78Å
56	S	95.3	Very high	95	Very high	87 Å²	87	59.8 Å²	59.8	61%	0.608	32%	0.323	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.4	148.9	178.7	57.8	0	0	0	0	111.1	I60	S56-I60 CarbonylContact C-O 3.57Å; S56-I60 VanDerWaalsContact CA-O 3.28Å; S56-I60 WeakPolarHBondContact CA-O 3.5Å
57	H	88.6	Confident	94.8	Very high	87 Å²	87	69 Å²	69	40%	0.403	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.8	115.7	168.5	-177.2	-75.5	0	0	0	107	M46 K59 I60	M46-H57 HydrophobicContact CE-CB 3.56Å; H57-K59 PolarHBondContact O-N 2.86Å; H57-I60 PolarHBondContact N-O 2.72Å; H57-I60 WeakPolarHBondContact O-CB 3.33Å; H57-I60 PolarHBondContact O-N 2.89Å
58	D	88.1	Confident	94.7	Very high	116 Å²	116	73.6 Å²	73.6	62%	0.62	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.1	-126.5	-168.9	-52	-47.7	0	0	0	111.8	I60	D58-I60 VanDerWaalsContact C-N 3.3Å
59	K	91.9	Very high	94.6	Very high	88 Å²	88	75.6 Å²	75.6	38%	0.383	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.3	14.2	176.8	-55	-176.8	178.8	175.3	0	113.1	H57 M76 A77 Y82	H57-K59 PolarHBondContact O-N 2.86Å; K59-M76 HydrophobicContact CB-CB 4.28Å; K59-M76 VanDerWaalsContact CB-O 3.25Å; K59-M76 WeakPolarHBondContact CB-O 3.4Å; K59-M76 WeakPolarHBondContact CD-O 2.96Å; K59-M76 WeakPolarHBondContact O-CB 3.28Å; K59-M76 PolarHBondContact O-N 2.67Å; K59-A77 HydrophobicContact CD-CB 4.13Å; K59-Y82 HydrophobicContact CB-CE2 4.26Å
60	I	94.9	Very high	94.7	Very high	1 Å²	1	73 Å²	73	1%	0.005	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	125.1	177.6	-56.5	-177.8	0	0	0	108.6	S56 H57 D58 L73 Y74 L75 Y82 Y86	S56-I60 CarbonylContact C-O 3.57Å; S56-I60 VanDerWaalsContact CA-O 3.28Å; S56-I60 WeakPolarHBondContact CA-O 3.5Å; H57-I60 PolarHBondContact N-O 2.72Å; H57-I60 WeakPolarHBondContact O-CB 3.33Å; H57-I60 PolarHBondContact O-N 2.89Å; D58-I60 VanDerWaalsContact C-N 3.3Å; I60-L73 HydrophobicContact CG2-CD1 3.5Å; I60-L73 HydrophobicContact CG2-CD2 4.41Å; I60-L73 HydrophobicContact CG2-CG 3.98Å; I60-Y74 CarbonylContact C-O 3.47Å; I60-Y74 VanDerWaalsContact CA-O 3.29Å; I60-Y74 WeakPolarHBondContact CA-O 3.49Å; I60-L75 HydrophobicContact CB-CD2 4.27Å; I60-L75 HydrophobicContact CD1-CD2 3.75Å; I60-L75 HydrophobicContact CG1-CD2 3.65Å; I60-L75 HydrophobicContact CG2-CD2 3.85Å; I60-Y82 HydrophobicContact CG1-CE2 4.35Å; I60-Y86 HydrophobicContact CD1-CE1 4.35Å
61	V	97.5	Very high	95.1	Very high	17 Å²	17	66 Å²	66	10%	0.103	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	130.4	-180	-178.2	0	0	0	0	109.1	Q54 K55 T63 L73 Y74 M76	Q54-V61 HydrophobicContact CG-CG1 3.56Å; K55-V61 CarbonylContact O-C 3.57Å; K55-V61 WeakPolarHBondContact O-CA 3.37Å; V61-T63 HydrophobicContact CG1-CG2 4.45Å; V61-L73 CarbonylContact O-C 3.56Å; V61-L73 WeakPolarHBondContact O-CA 3.24Å; V61-Y74 PolarHBondContact N-O 3.05Å; V61-Y74 WeakPolarHBondContact O-CD2 3.41Å; V61-Y74 PolarHBondContact O-N 2.92Å; V61-M76 HydrophobicContact CG2-CE 3.62Å
62	A	98	Very high	95.3	Very high	0 Å²	0	64.8 Å²	64.8	0%	0	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	141.9	169	0	0	0	0	0	110.7	M46 L48 Q54 K55 S72 L73	M46-A62 HydrophobicContact CG-CB 4.02Å; M46-A62 HydrophobicContact SD-CB 3.34Å; M46-A62 WeakPolarHBondContact SD-CB 3.29Å; L48-A62 HydrophobicContact CD1-CB 3.67Å; L48-A62 HydrophobicContact CD2-CB 4.24Å; L48-A62 HydrophobicContact CG-CB 4.49Å; Q54-A62 CarbonylContact C-O 3.47Å; Q54-A62 VanDerWaalsContact CA-O 3.27Å; Q54-A62 WeakPolarHBondContact CA-O 3.36Å; K55-A62 PolarHBondContact N-O 2.94Å; K55-A62 PolarHBondContact O-N 2.78Å; A62-S72 CarbonylContact C-O 3.52Å; A62-S72 VanDerWaalsContact CA-O 3.24Å; A62-S72 WeakPolarHBondContact CA-O 3.35Å; A62-L73 HydrophobicContact CB-CD1 3.88Å
63	T	98.1	Very high	95.5	Very high	28 Å²	28	61.5 Å²	61.5	17%	0.172	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	153.2	174.1	66.2	0	0	0	0	110.6	L48 E53 Q54 V61 S71 S72 Y74	L48-T63 VanDerWaalsContact CD2-C 3.47Å; E53-T63 CarbonylContact O-C 3.58Å; E53-T63 WeakPolarHBondContact O-CA 3.26Å; Q54-T63 HydrophobicContact CB-CG2 4.3Å; Q54-T63 HydrophobicContact CG-CG2 4.03Å; V61-T63 HydrophobicContact CG1-CG2 4.45Å; T63-S71 CarbonylContact O-C 3.54Å; T63-S71 WeakPolarHBondContact O-CA 3.37Å; T63-S71 VanDerWaalsContact O-CB 3.31Å; T63-S71 WeakPolarHBondContact O-CB 3.29Å; T63-S71 PolarHBondContact O-OG 2.83Å; T63-S72 PolarHBondContact N-O 3.42Å; T63-S72 PolarHBondContact O-N 2.78Å; T63-Y74 HydrophobicContact CG2-CD2 4.33Å; T63-Y74 HydrophobicContact CG2-CE2 3.82Å
64	F	97.4	Very high	95.6	Very high	7 Å²	7	63.2 Å²	63.2	3%	0.031	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	113.8	174.3	178.5	-152.6	0	0	0	111	L28 V31 L48 K50 G52 E53 E66	L28-F64 HydrophobicContact CB-CE2 3.82Å; L28-F64 HydrophobicContact CB-CZ 3.65Å; L28-F64 HydrophobicContact CD1-CE2 3.92Å; L28-F64 HydrophobicContact CG-CE2 4.45Å; L28-F64 WeakPolarHBondContact O-CZ 3.24Å; V31-F64 HydrophobicContact CG2-CD2 4.26Å; V31-F64 HydrophobicContact CG2-CE2 4.38Å; L48-F64 HydrophobicContact CB-CB 3.88Å; L48-F64 HydrophobicContact CB-CD1 4.45Å; L48-F64 HydrophobicContact CD2-CB 3.74Å; L48-F64 HydrophobicContact CG-CB 4.39Å; K50-F64 VanDerWaalsContact O-CD1 3.29Å; K50-F64 WeakPolarHBondContact O-CD1 3.45Å; G52-F64 WeakPolarHBondContact CA-O 3.4Å; G52-F64 PolarHBondContact N-O 2.79Å; E53-F64 PolarHBondContact O-N 2.86Å; F64-E66 HydrophobicContact CE2-CB 4.48Å; F64-E66 HydrophobicContact CZ-CB 4.21Å
65	N	96.8	Very high	95.5	Very high	62 Å²	62	57.1 Å²	57.1	33%	0.332	28%	0.275	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	95.8	173.3	-169.9	-41	0	0	0	110	K67 K68 Q69 Q70	N65-K67 PolarHBondContact O-N 2.85Å; N65-K67 PolarHBondContact OD1-N 2.96Å; N65-K68 HydrophobicContact CB-CB 4.29Å; N65-K68 PolarHBondContact O-N 2.72Å; N65-K68 PolarHBondContact OD1-N 2.86Å; N65-Q69 PolarHBondContact O-N 2.02Å; N65-Q70 WeakPolarHBondContact CA-O 3.42Å; N65-Q70 WeakPolarHBondContact CB-O 3.27Å; N65-Q70 PolarHBondContact N-O 2.94Å; N65-Q70 PolarHBondContact O-N 2.76Å
66	E	93.6	Very high	95.4	Very high	107 Å²	107	57.4 Å²	57.4	50%	0.5	28%	0.278	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.4	-40.4	178.9	178.4	178.6	-165.2	0	0	112.3	F64 K68 Q69	F64-E66 HydrophobicContact CE2-CB 4.48Å; F64-E66 HydrophobicContact CZ-CB 4.21Å; E66-K68 PolarHBondContact O-N 2.91Å; E66-Q69 PolarHBondContact O-N 2.84Å; E66-Q69 PolarHBondContact O-NE2 2.85Å
67	K	93.9	Very high	95.2	Very high	204 Å²	204	54.9 Å²	54.9	89%	0.887	26%	0.263	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	-36.6	179.4	-67	-175.8	179.3	-179.6	0	112.6	N65	N65-K67 PolarHBondContact O-N 2.85Å; N65-K67 PolarHBondContact OD1-N 2.96Å
68	K	95.6	Very high	95.1	Very high	142 Å²	142	50.9 Å²	50.9	62%	0.617	25%	0.245	S	C	*	.	T	Hydrogen-bonded Turn	trans	-90.4	-5	177.5	-65.9	-173.8	177.9	-175.7	0	113.4	N65 E66 Q70	N65-K68 HydrophobicContact CB-CB 4.29Å; N65-K68 PolarHBondContact O-N 2.72Å; N65-K68 PolarHBondContact OD1-N 2.86Å; E66-K68 PolarHBondContact O-N 2.91Å; K68-Q70 HydrophobicContact CB-CB 3.96Å; K68-Q70 PolarHBondContact O-N 2.84Å
69	Q	95.3	Very high	95.1	Very high	41 Å²	41	48.9 Å²	48.9	19%	0.192	23%	0.232	C	C	.	.	T	Hydrogen-bonded Turn	trans	48.1	44.9	-169.3	-57.4	-58.9	-22.8	0	0	111.6	S24 L28 N65 E66	S24-Q69 PolarHBondContact N-O 2.79Å; S24-Q69 WeakPolarHBondContact O-CB 3.5Å; L28-Q69 WeakPolarHBondContact CD1-O 3.39Å; L28-Q69 HydrophobicContact CG-CB 4.47Å; N65-Q69 PolarHBondContact O-N 2.02Å; E66-Q69 PolarHBondContact O-N 2.84Å; E66-Q69 PolarHBondContact O-NE2 2.85Å
70	Q	96.8	Very high	94.9	Very high	40 Å²	40	51.4 Å²	51.4	19%	0.187	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.2	133.1	-173.6	-174.4	-175.8	-86.6	0	0	110.8	N21 C22 N23 N65 K68 S72	N21-Q70 PolarHBondContact OD1-NE2 2.91Å; C22-Q70 CarbonylContact O-C 3.57Å; C22-Q70 VanDerWaalsContact O-CA 3.28Å; C22-Q70 WeakPolarHBondContact O-CA 3.3Å; N23-Q70 PolarHBondContact ND2-OE1 2.81Å; N23-Q70 VanDerWaalsContact OD1-CB 3.31Å; N23-Q70 WeakPolarHBondContact OD1-CB 3.31Å; N23-Q70 WeakPolarHBondContact OD1-CG 3.5Å; N23-Q70 PolarHBondContact OD1-OE1 2.98Å; N65-Q70 WeakPolarHBondContact CA-O 3.42Å; N65-Q70 WeakPolarHBondContact CB-O 3.27Å; N65-Q70 PolarHBondContact N-O 2.94Å; N65-Q70 PolarHBondContact O-N 2.76Å; K68-Q70 HydrophobicContact CB-CB 3.96Å; K68-Q70 PolarHBondContact O-N 2.84Å; Q70-S72 PolarHBondContact NE2-OG 2.78Å
71	S	97.6	Very high	94.5	Very high	0 Å²	0	54.4 Å²	54.4	0%	0	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	146.9	161.7	-177.1	0	0	0	0	110.7	N21 C22 W33 T63	N21-S71 CarbonylContact C-O 3.51Å; C22-S71 PolarHBondContact N-O 3.05Å; C22-S71 PolarHBondContact O-N 2.78Å; W33-S71 PolarHBondContact NE1-OG 3.01Å; T63-S71 CarbonylContact O-C 3.54Å; T63-S71 WeakPolarHBondContact O-CA 3.37Å; T63-S71 VanDerWaalsContact O-CB 3.31Å; T63-S71 WeakPolarHBondContact O-CB 3.29Å; T63-S71 PolarHBondContact O-OG 2.83Å
72	S	98.1	Very high	94	Very high	5 Å²	5	54.6 Å²	54.6	4%	0.035	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126	134.3	177.8	-60.9	0	0	0	0	109.7	I20 N21 A62 T63 Q70	I20-S72 CarbonylContact O-C 3.58Å; I20-S72 WeakPolarHBondContact O-CA 2.97Å; N21-S72 WeakPolarHBondContact OD1-CB 3.47Å; N21-S72 PolarHBondContact OD1-OG 2.75Å; A62-S72 CarbonylContact C-O 3.52Å; A62-S72 VanDerWaalsContact CA-O 3.24Å; A62-S72 WeakPolarHBondContact CA-O 3.35Å; T63-S72 PolarHBondContact N-O 3.42Å; T63-S72 PolarHBondContact O-N 2.78Å; Q70-S72 PolarHBondContact NE2-OG 2.78Å
73	L	97.8	Very high	93.7	Very high	0 Å²	0	59.6 Å²	59.6	0%	0	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	112.8	173.2	-170	74.3	0	0	0	108.9	I19 I20 W33 I60 V61 A62 L75 Y86	I19-L73 WeakPolarHBondContact CA-O 3.22Å; I20-L73 HydrophobicContact CB-CB 4.38Å; I20-L73 PolarHBondContact N-O 3.01Å; I20-L73 PolarHBondContact O-N 2.95Å; W33-L73 HydrophobicContact CB-CD1 4.27Å; W33-L73 HydrophobicContact CD2-CB 3.88Å; W33-L73 HydrophobicContact CD2-CD1 4.05Å; W33-L73 HydrophobicContact CD2-CD2 4.12Å; W33-L73 HydrophobicContact CD2-CG 4.25Å; W33-L73 HydrophobicContact CE3-CB 3.95Å; W33-L73 HydrophobicContact CE3-CD2 3.73Å; W33-L73 HydrophobicContact CE3-CG 4.28Å; W33-L73 HydrophobicContact CG-CD1 3.93Å; W33-L73 HydrophobicContact CH2-CB 3.78Å; W33-L73 HydrophobicContact CZ2-CB 3.74Å; W33-L73 HydrophobicContact CZ3-CB 3.9Å; W33-L73 HydrophobicContact CZ3-CD2 4.1Å; I60-L73 HydrophobicContact CG2-CD1 3.5Å; I60-L73 HydrophobicContact CG2-CD2 4.41Å; I60-L73 HydrophobicContact CG2-CG 3.98Å; V61-L73 CarbonylContact O-C 3.56Å; V61-L73 WeakPolarHBondContact O-CA 3.24Å; A62-L73 HydrophobicContact CB-CD1 3.88Å; L73-L75 HydrophobicContact CD2-CD2 4.22Å; L73-L75 HydrophobicContact CG-CD2 4.38Å; L73-Y86 HydrophobicContact CD2-CD1 3.52Å; L73-Y86 HydrophobicContact CD2-CE1 4.17Å; L73-Y86 HydrophobicContact CD2-CG 4.1Å
74	Y	97.4	Very high	93.5	Very high	82 Å²	82	61.9 Å²	61.9	32%	0.322	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	124.1	176.7	-59.4	-98.7	0	0	0	108.9	A18 I19 I60 V61 T63	A18-Y74 CarbonylContact O-C 3.58Å; A18-Y74 WeakPolarHBondContact O-CA 3.35Å; I19-Y74 HydrophobicContact CD1-CD1 3.77Å; I19-Y74 HydrophobicContact CD1-CE1 3.49Å; I19-Y74 VanDerWaalsContact CD1-CE1 3.49Å; I19-Y74 HydrophobicContact CG1-CD1 3.6Å; I19-Y74 HydrophobicContact CG1-CE1 3.82Å; I19-Y74 HydrophobicContact CG1-CG 4.48Å; I19-Y74 HydrophobicContact CG2-CD1 4.29Å; I19-Y74 HydrophobicContact CG2-CE1 4.12Å; I60-Y74 CarbonylContact C-O 3.47Å; I60-Y74 VanDerWaalsContact CA-O 3.29Å; I60-Y74 WeakPolarHBondContact CA-O 3.49Å; V61-Y74 PolarHBondContact N-O 3.05Å; V61-Y74 WeakPolarHBondContact O-CD2 3.41Å; V61-Y74 PolarHBondContact O-N 2.92Å; T63-Y74 HydrophobicContact CG2-CD2 4.33Å; T63-Y74 HydrophobicContact CG2-CE2 3.82Å
75	L	95.7	Very high	93.5	Very high	10 Å²	10	65 Å²	65	5%	0.052	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	105.3	170.6	-52.7	175.9	0	0	0	106.6	D17 A18 I20 I60 L73 Y86	D17-L75 CarbonylContact C-O 3.56Å; D17-L75 VanDerWaalsContact CA-O 3.31Å; D17-L75 WeakPolarHBondContact CA-O 3.45Å; A18-L75 HydrophobicContact CB-CB 4.18Å; A18-L75 HydrophobicContact CB-CD1 4.26Å; A18-L75 PolarHBondContact N-O 3.18Å; A18-L75 PolarHBondContact O-N 2.68Å; I20-L75 HydrophobicContact CD1-CD1 4.31Å; I60-L75 HydrophobicContact CB-CD2 4.27Å; I60-L75 HydrophobicContact CD1-CD2 3.75Å; I60-L75 HydrophobicContact CG1-CD2 3.65Å; I60-L75 HydrophobicContact CG2-CD2 3.85Å; L73-L75 HydrophobicContact CD2-CD2 4.22Å; L73-L75 HydrophobicContact CG-CD2 4.38Å; L75-Y86 HydrophobicContact CD1-CD2 4.25Å; L75-Y86 HydrophobicContact CD1-CE1 4.43Å; L75-Y86 HydrophobicContact CD1-CE2 3.69Å; L75-Y86 HydrophobicContact CD2-CE1 3.86Å
76	M	94.6	Very high	93.5	Very high	81 Å²	81	62.9 Å²	62.9	40%	0.399	32%	0.317	S	S	.	.			trans	-95.1	142.5	-177	-61.6	-179.4	-64.2	0	0	111.5	D17 K59 V61 S78	D17-M76 VanDerWaalsContact OD1-CA 3.25Å; D17-M76 WeakPolarHBondContact OD1-CA 3.31Å; K59-M76 HydrophobicContact CB-CB 4.28Å; K59-M76 VanDerWaalsContact CB-O 3.25Å; K59-M76 WeakPolarHBondContact CB-O 3.4Å; K59-M76 WeakPolarHBondContact CD-O 2.96Å; K59-M76 WeakPolarHBondContact O-CB 3.28Å; K59-M76 PolarHBondContact O-N 2.67Å; V61-M76 HydrophobicContact CG2-CE 3.62Å; M76-S78 VanDerWaalsContact C-N 3.32Å; M76-S78 PolarHBondContact O-N 2.78Å
77	A	90.7	Very high	93.6	Very high	34 Å²	34	61.3 Å²	61.3	28%	0.281	31%	0.308	S	S	.	.	S	Bend	trans	41.7	60.7	-178.8	0	0	0	0	0	111.2	D17 K59	D17-A77 PolarHBondContact OD1-N 3.45Å; K59-A77 HydrophobicContact CD-CB 4.13Å
78	S	87.3	Confident	93.7	Very high	4 Å²	4	52.1 Å²	52.1	3%	0.028	27%	0.269	C	S	.	.			trans	-56.1	136.1	-168.9	-63.3	0	0	0	0	111.6	E14 G15 E16 M76	E14-S78 CarbonylContact C-O 3.53Å; E14-S78 WeakPolarHBondContact CA-O 3.29Å; E14-S78 WeakPolarHBondContact CG-O 3.4Å; G15-S78 PolarHBondContact N-O 2.92Å; E16-S78 WeakPolarHBondContact O-CB 3.33Å; E16-S78 PolarHBondContact O-N 3.04Å; E16-S78 PolarHBondContact O-OG 3.09Å; M76-S78 VanDerWaalsContact C-N 3.32Å; M76-S78 PolarHBondContact O-N 2.78Å
79	Q	89.3	Confident	93.7	Very high	73 Å²	73	46.5 Å²	46.5	34%	0.341	25%	0.252	S	S	.	.			trans	-113.1	161.8	178.2	-70.7	164.5	69.3	0	0	109.9	S81 Y82	Q79-S81 PolarHBondContact O-N 3.27Å; Q79-Y82 WeakPolarHBondContact O-CA 3.48Å; Q79-Y82 VanDerWaalsContact O-CB 3.31Å; Q79-Y82 WeakPolarHBondContact O-CB 3.43Å; Q79-Y82 PolarHBondContact O-N 3.02Å
80	L	86.3	Confident	93.5	Very high	141 Å²	141	45.9 Å²	45.9	74%	0.738	25%	0.254	S	S	*	.	G	3₁₀ helix	trans	-53.6	-33	178.2	-68.2	172.6	0	0	0	113.1	Y82 S83	L80-Y82 PolarHBondContact O-N 2.77Å; L80-S83 VanDerWaalsContact O-CB 3.3Å; L80-S83 WeakPolarHBondContact O-CB 3.13Å; L80-S83 PolarHBondContact O-N 2.79Å; L80-S83 VanDerWaalsContact O-N 3.09Å
81	S	85.9	Confident	93.3	Very high	64 Å²	64	49.4 Å²	49.4	45%	0.448	27%	0.27	S	S	.	.	G	3₁₀ helix	trans	-64.5	-16.3	177	66.8	0	0	0	0	114.2	Q79 R84	Q79-S81 PolarHBondContact O-N 3.27Å; S81-R84 PolarHBondContact O-NE 3.26Å
82	Y	88	Confident	92.8	Very high	21 Å²	21	51.1 Å²	51.1	8%	0.082	28%	0.281	C	S	.	.	G	3₁₀ helix	trans	-88.8	-6.9	177.2	-63.6	-2.9	0	0	0	112.8	K59 I60 Q79 L80 R84 Y86	K59-Y82 HydrophobicContact CB-CE2 4.26Å; I60-Y82 HydrophobicContact CG1-CE2 4.35Å; Q79-Y82 WeakPolarHBondContact O-CA 3.48Å; Q79-Y82 VanDerWaalsContact O-CB 3.31Å; Q79-Y82 WeakPolarHBondContact O-CB 3.43Å; Q79-Y82 PolarHBondContact O-N 3.02Å; L80-Y82 PolarHBondContact O-N 2.77Å; Y82-R84 VanDerWaalsContact C-N 3.34Å; Y82-R84 PolarHBondContact O-N 3.02Å; Y82-Y86 WeakPolarHBondContact O-CE2 3.38Å; Y82-Y86 PolarHBondContact O-OH 2.97Å
83	S	92.3	Very high	91.7	Very high	106 Å²	106	57.4 Å²	57.4	74%	0.741	31%	0.309	S	S	*	.			trans	-66.4	91.6	171.9	-173.8	0	0	0	0	110.3	L80	L80-S83 VanDerWaalsContact O-CB 3.3Å; L80-S83 WeakPolarHBondContact O-CB 3.13Å; L80-S83 PolarHBondContact O-N 2.79Å; L80-S83 VanDerWaalsContact O-N 3.09Å
84	R	94	Very high	91.4	Very high	75 Å²	75	60.3 Å²	60.3	28%	0.283	33%	0.325	S	S	.	.	S	Bend	trans	-154.1	161.9	-168.7	-66.4	-174.2	-173.7	-116.3	-3.5	109.4	Q36 S81 Y82 Y86	Q36-R84 WeakPolarHBondContact O-CB 3.35Å; S81-R84 PolarHBondContact O-NE 3.26Å; Y82-R84 VanDerWaalsContact C-N 3.34Å; Y82-R84 PolarHBondContact O-N 3.02Å; R84-Y86 HydrophobicContact CB-CE2 4Å; R84-Y86 WeakPolarHBondContact O-CD2 3.46Å; R84-Y86 WeakPolarHBondContact O-CE2 3.45Å
85	T	96.2	Very high	91.1	Very high	72 Å²	72	59.1 Å²	59.1	44%	0.442	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	131.5	167.7	-50	0	0	0	0	109.1	R35 Q36 F87	R35-T85 CarbonylContact C-O 3.59Å; R35-T85 WeakPolarHBondContact CA-O 3.49Å; Q36-T85 PolarHBondContact N-O 2.87Å; Q36-T85 PolarHBondContact O-N 2.83Å; T85-F87 HydrophobicContact CG2-CD1 4.45Å; T85-F87 HydrophobicContact CG2-CD2 4.39Å; T85-F87 HydrophobicContact CG2-CE1 3.74Å; T85-F87 HydrophobicContact CG2-CE2 3.66Å; T85-F87 HydrophobicContact CG2-CZ 3.3Å
86	Y	96.4	Very high	90.9	Very high	19 Å²	19	61.8 Å²	61.8	8%	0.075	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	129.7	178	-65.3	-93.8	0	0	0	110.2	Q5 I20 Y34 R35 L45 I60 L73 L75 Y82 R84	Q5-Y86 PolarHBondContact NE2-O 2.98Å; I20-Y86 HydrophobicContact CD1-CD2 3.75Å; I20-Y86 HydrophobicContact CD1-CG 3.82Å; Y34-Y86 WeakPolarHBondContact O-CA 3.42Å; R35-Y86 HydrophobicContact CB-CD1 3.98Å; R35-Y86 HydrophobicContact CB-CE1 3.87Å; L45-Y86 HydrophobicContact CD1-CD1 4.08Å; L45-Y86 HydrophobicContact CD1-CE1 4.17Å; I60-Y86 HydrophobicContact CD1-CE1 4.35Å; L73-Y86 HydrophobicContact CD2-CD1 3.52Å; L73-Y86 HydrophobicContact CD2-CE1 4.17Å; L73-Y86 HydrophobicContact CD2-CG 4.1Å; L75-Y86 HydrophobicContact CD1-CD2 4.25Å; L75-Y86 HydrophobicContact CD1-CE1 4.43Å; L75-Y86 HydrophobicContact CD1-CE2 3.69Å; L75-Y86 HydrophobicContact CD2-CE1 3.86Å; Y82-Y86 WeakPolarHBondContact O-CE2 3.38Å; Y82-Y86 PolarHBondContact O-OH 2.97Å; R84-Y86 HydrophobicContact CB-CE2 4Å; R84-Y86 WeakPolarHBondContact O-CD2 3.46Å; R84-Y86 WeakPolarHBondContact O-CE2 3.45Å
87	F	96.7	Very high	90.7	Very high	74 Å²	74	60.7 Å²	60.7	33%	0.325	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	141.9	-179.3	-57.4	-81.1	0	0	0	110.8	W33 Y34 Q36 P42 T85	W33-F87 WeakPolarHBondContact CA-O 3.43Å; Y34-F87 PolarHBondContact N-O 3Å; Y34-F87 PolarHBondContact O-N 3.36Å; Q36-F87 HydrophobicContact CB-CD2 4.34Å; Q36-F87 HydrophobicContact CB-CE2 3.69Å; Q36-F87 HydrophobicContact CG-CE2 4.46Å; P42-F87 HydrophobicContact CG-CE2 4.47Å; T85-F87 HydrophobicContact CG2-CD1 4.45Å; T85-F87 HydrophobicContact CG2-CD2 4.39Å; T85-F87 HydrophobicContact CG2-CE1 3.74Å; T85-F87 HydrophobicContact CG2-CE2 3.66Å; T85-F87 HydrophobicContact CG2-CZ 3.3Å
88	C	95.9	Very high	90.6	Very high	10 Å²	10	62.4 Å²	62.4	7%	0.068	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	126.6	166.2	178.5	0	0	0	0	109.2	Q5 C22 V31 H32 W33	Q5-C88 VanDerWaalsContact CD-N 3.26Å; Q5-C88 HydrophobicContact CG-CB 3.78Å; C22-C88 HydrophobicContact CB-CB 3.46Å; C22-C88 VanDerWaalsContact CB-CB 3.46Å; C22-C88 WeakPolarHBondContact CB-SG 3.08Å; C22-C88 WeakPolarHBondContact SG-CB 2.84Å; C22-C88 CovalentContact SG-SG 2.02Å; C22-C88 PolarHBondContact SG-SG 2.82Å; V31-C88 WeakPolarHBondContact CG1-SG 3.26Å; H32-C88 WeakPolarHBondContact O-CA 3.35Å; W33-C88 HydrophobicContact CE3-CB 4.14Å; W33-C88 HydrophobicContact CH2-CB 3.98Å; W33-C88 HydrophobicContact CZ2-CB 4.33Å; W33-C88 HydrophobicContact CZ3-CB 3.87Å
89	G	94.4	Very high	90.9	Very high	25 Å²	25	66.3 Å²	66.3	26%	0.258	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	136	164.5	0	0	0	0	0	108.8	H32	H32-G89 WeakPolarHBondContact CB-O 3.38Å; H32-G89 PolarHBondContact N-O 3.25Å; H32-G89 PolarHBondContact ND1-O 3.23Å; H32-G89 PolarHBondContact O-N 3.17Å
90	A	93.1	Very high	91	Very high	27 Å²	27	65.8 Å²	65.8	22%	0.223	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	142	179.6	0	0	0	0	0	111.1	P3 L28 S30 V31	P3-A90 HydrophobicContact CB-CB 4.47Å; P3-A90 HydrophobicContact CG-CB 4Å; L28-A90 HydrophobicContact CD2-CB 3.56Å; S30-A90 VanDerWaalsContact O-CA 3.29Å; S30-A90 WeakPolarHBondContact O-CA 3.25Å; V31-A90 HydrophobicContact CG2-CB 4.39Å
91	E	91.1	Very high	91.4	Very high	115 Å²	115	60 Å²	60	54%	0.537	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	125.4	169.6	-170.7	177.8	-165.6	0	0	108.2	Y29 S30	Y29-E91 HydrophobicContact CD2-CG 4.28Å; Y29-E91 PolarHBondContact N-O 3.22Å; S30-E91 PolarHBondContact O-N 3.45Å; S30-E91 VanDerWaalsContact OG-CB 3.28Å; S30-E91 WeakPolarHBondContact OG-CB 3.47Å; S30-E91 PolarHBondContact OG-OE2 2.83Å
92	T	87.7	Confident	91.8	Very high	35 Å²	35	59.7 Å²	59.7	22%	0.215	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	155.3	-176.8	79.7	0	0	0	0	110.8	A27 L28	A27-T92 VanDerWaalsContact O-CA 3.26Å; A27-T92 WeakPolarHBondContact O-CA 3.35Å; L28-T92 HydrophobicContact CD2-CG2 3.69Å
93	Q	75.9	Confident	92.1	Very high	137 Å²	137	63.2 Å²	63.2	64%	0.64	35%	0.346	S	S	*	.			trans	-63.9	0	157.8	-69.3	-176.1	24.7	0	0	111.5	K26 A27 Y29	K26-Q93 WeakPolarHBondContact CD-O 3.34Å; K26-Q93 WeakPolarHBondContact CE-O 3.14Å; K26-Q93 VanDerWaalsContact NZ-C 3.32Å; K26-Q93 PolarHBondContact NZ-O 3.3Å; K26-Q93 PolarHBondContact NZ-OXT 2.81Å; A27-Q93 HydrophobicContact CB-CB 4.46Å; A27-Q93 HydrophobicContact CB-CG 4.32Å; A27-Q93 PolarHBondContact O-N 2.99Å; A27-Q93 VanDerWaalsContact O-N 3.09Å; Y29-Q93 HydrophobicContact CD2-CG 4.08Å; Y29-Q93 HydrophobicContact CE1-CG 3.96Å; Y29-Q93 HydrophobicContact CE2-CB 4.28Å; Y29-Q93 HydrophobicContact CE2-CG 3.17Å; Y29-Q93 VanDerWaalsContact CZ-CD 3.5Å; Y29-Q93 WeakPolarHBondContact OH-CG 3.31Å; Y29-Q93 PolarHBondContact OH-NE2 3.48Å

Retrieved 93 of 93 residues in 77.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).