A0A096NT42_PAPAN Loading...

Photoreceptor disc component

AlphaFold DB , UniProt , Accession A0A096NT42, Species PAPAN (Papio anubis, Olive baboon), Gene PRCD, Length 54 aa.

						>A0A096NT42_PAPAN|A0A096NT42|PRCD
MCTTLFLLSTLAMLWRRRFANRVQPEPSDVDGAARGSSVDADPQSSGREKEPLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.9	Low	87.1	Confident	193 Å²	193	106.7 Å²	106.7	95%	0.951	59%	0.587	S	S	*	*				0	2.6	0	-57.8	-59.3	174.5	0	0	113.8	T4	M1-T4 PolarHBondContact O-OG1 3.4Å
2	C	75.3	Confident	87.3	Confident	104 Å²	104	101.2 Å²	101.2	70%	0.703	57%	0.565	S	S	*	*	H	α-helix	trans	-92.8	-31.6	177.9	-51	0	0	0	0	112.1	T4 L5 F6	C2-T4 VanDerWaalsContact C-N 3.33Å; C2-T4 PolarHBondContact O-N 3.25Å; C2-L5 PolarHBondContact O-N 2.81Å; C2-F6 PolarHBondContact O-N 2.94Å; C2-F6 WeakPolarHBondContact O-CB 3.27Å
3	T	88.7	Confident	87.4	Confident	105 Å²	105	102.5 Å²	102.5	64%	0.644	57%	0.567	S	S	*	*	H	α-helix	trans	-62	-39.1	176.3	46.6	0	0	0	0	112.1	F6 L7	T3-F6 PolarHBondContact O-N 3.39Å; T3-L7 WeakPolarHBondContact O-CB 3.48Å; T3-L7 VanDerWaalsContact O-CG 3.23Å; T3-L7 WeakPolarHBondContact O-CG 3.36Å; T3-L7 PolarHBondContact O-N 3.24Å
4	T	90.9	Very high	87.4	Confident	73 Å²	73	102.8 Å²	102.8	45%	0.448	57%	0.566	S	S	.	*	H	α-helix	trans	-62.5	-46.7	173.6	27.4	0	0	0	0	111.8	M1 C2 F6 L7 L8	M1-T4 PolarHBondContact O-OG1 3.4Å; C2-T4 VanDerWaalsContact C-N 3.33Å; C2-T4 PolarHBondContact O-N 3.25Å; T4-F6 PolarHBondContact O-N 2.91Å; T4-L7 PolarHBondContact O-N 2.93Å; T4-L8 WeakPolarHBondContact O-CB 3.08Å; T4-L8 PolarHBondContact O-N 3.05Å; T4-L8 WeakPolarHBondContact O-CG 3.21Å
5	L	91.5	Very high	87.2	Confident	112 Å²	112	106.9 Å²	106.9	59%	0.586	57%	0.57	S	S	*	*	H	α-helix	trans	-65.5	-38.3	177.2	-64.7	177.4	0	0	0	112.4	C2 L8 S9	C2-L5 PolarHBondContact O-N 2.81Å; L5-L8 PolarHBondContact O-N 2.9Å; L5-S9 VanDerWaalsContact O-CB 3.31Å; L5-S9 WeakPolarHBondContact O-CB 3.41Å; L5-S9 PolarHBondContact O-N 3.08Å; L5-S9 PolarHBondContact O-OG 2.98Å
6	F	89.9	Confident	86.6	Confident	146 Å²	146	112.2 Å²	112.2	64%	0.64	58%	0.579	S	S	*	*	H	α-helix	trans	-65	-44.7	175.6	-177.7	-101	0	0	0	112.2	C2 T3 T4 S9 T10	C2-F6 PolarHBondContact O-N 2.94Å; C2-F6 WeakPolarHBondContact O-CB 3.27Å; T3-F6 PolarHBondContact O-N 3.39Å; T4-F6 PolarHBondContact O-N 2.91Å; F6-S9 PolarHBondContact O-N 2.79Å; F6-T10 PolarHBondContact O-OG1 3.37Å; F6-T10 WeakPolarHBondContact O-CB 3.43Å; F6-T10 PolarHBondContact O-N 2.98Å
7	L	94.6	Very high	85.7	Confident	114 Å²	114	116.3 Å²	116.3	60%	0.597	59%	0.586	S	S	*	*	H	α-helix	trans	-62.9	-45.4	175.2	-76.5	168.4	0	0	0	111.5	T3 T4 S9 T10 L11	T3-L7 WeakPolarHBondContact O-CB 3.48Å; T3-L7 VanDerWaalsContact O-CG 3.23Å; T3-L7 WeakPolarHBondContact O-CG 3.36Å; T3-L7 PolarHBondContact O-N 3.24Å; T4-L7 PolarHBondContact O-N 2.93Å; L7-S9 PolarHBondContact O-N 3.4Å; L7-T10 PolarHBondContact O-N 3.29Å; L7-L11 WeakPolarHBondContact O-CB 3.5Å; L7-L11 PolarHBondContact O-N 3.02Å
8	L	93.9	Very high	85	Confident	110 Å²	110	117.8 Å²	117.8	58%	0.576	58%	0.583	S	S	*	*	H	α-helix	trans	-62.5	-41.8	176.8	-72.1	172.1	0	0	0	111.8	T4 L5 L11 A12	T4-L8 WeakPolarHBondContact O-CB 3.08Å; T4-L8 PolarHBondContact O-N 3.05Å; T4-L8 WeakPolarHBondContact O-CG 3.21Å; L5-L8 PolarHBondContact O-N 2.9Å; L8-L11 PolarHBondContact O-N 2.85Å; L8-A12 VanDerWaalsContact O-CB 3.28Å; L8-A12 WeakPolarHBondContact O-CB 3.23Å; L8-A12 PolarHBondContact O-N 2.73Å
9	S	87.5	Confident	84.2	Confident	66 Å²	66	118.2 Å²	118.2	46%	0.462	58%	0.581	S	S	.	*	H	α-helix	trans	-64	-43.4	177.3	-59.6	0	0	0	0	111.6	L5 F6 L7 A12 M13	L5-S9 VanDerWaalsContact O-CB 3.31Å; L5-S9 WeakPolarHBondContact O-CB 3.41Å; L5-S9 PolarHBondContact O-N 3.08Å; L5-S9 PolarHBondContact O-OG 2.98Å; F6-S9 PolarHBondContact O-N 2.79Å; L7-S9 PolarHBondContact O-N 3.4Å; S9-A12 PolarHBondContact O-N 2.74Å; S9-M13 WeakPolarHBondContact O-CG 3.31Å; S9-M13 PolarHBondContact O-N 3.43Å
10	T	91.4	Very high	83	Confident	61 Å²	61	115.4 Å²	115.4	37%	0.374	58%	0.578	S	S	.	*	H	α-helix	trans	-63.9	-44.2	176.7	-54.7	0	0	0	0	111.4	F6 L7 M13 L14	F6-T10 PolarHBondContact O-OG1 3.37Å; F6-T10 WeakPolarHBondContact O-CB 3.43Å; F6-T10 PolarHBondContact O-N 2.98Å; L7-T10 PolarHBondContact O-N 3.29Å; T10-M13 PolarHBondContact O-N 2.91Å; T10-L14 WeakPolarHBondContact O-CB 3.3Å; T10-L14 PolarHBondContact O-N 3.38Å
11	L	93.1	Very high	81.8	Confident	90 Å²	90	115.2 Å²	115.2	47%	0.471	58%	0.579	S	S	.	*	H	α-helix	trans	-65.4	-41.2	178.6	-168.3	64.3	0	0	0	111.6	L7 L8 L14 W15	L7-L11 WeakPolarHBondContact O-CB 3.5Å; L7-L11 PolarHBondContact O-N 3.02Å; L8-L11 PolarHBondContact O-N 2.85Å; L11-L14 PolarHBondContact O-N 2.94Å; L11-W15 WeakPolarHBondContact O-CB 3.25Å; L11-W15 PolarHBondContact O-N 3.47Å
12	A	90.2	Very high	81.6	Confident	40 Å²	40	113.8 Å²	113.8	33%	0.331	56%	0.563	S	S	.	*	H	α-helix	trans	-63.6	-41.5	175.5	0	0	0	0	0	112.5	L8 S9 W15 R16	L8-A12 VanDerWaalsContact O-CB 3.28Å; L8-A12 WeakPolarHBondContact O-CB 3.23Å; L8-A12 PolarHBondContact O-N 2.73Å; S9-A12 PolarHBondContact O-N 2.74Å; A12-W15 PolarHBondContact O-N 3.18Å; A12-R16 WeakPolarHBondContact O-CG 3.2Å; A12-R16 PolarHBondContact O-N 3.43Å
13	M	88.3	Confident	80.6	Confident	119 Å²	119	114.2 Å²	114.2	59%	0.586	56%	0.562	S	S	*	*	H	α-helix	trans	-62.6	-42.9	173.7	-76.8	-172.7	-72.3	0	0	111.6	S9 T10 R16 R17	S9-M13 WeakPolarHBondContact O-CG 3.31Å; S9-M13 PolarHBondContact O-N 3.43Å; T10-M13 PolarHBondContact O-N 2.91Å; M13-R16 PolarHBondContact O-N 3.33Å; M13-R17 PolarHBondContact O-N 3.19Å; M13-R17 WeakPolarHBondContact O-CB 3.25Å
14	L	87.2	Confident	78.8	Confident	106 Å²	106	117 Å²	117	56%	0.555	57%	0.568	S	S	*	*	H	α-helix	trans	-66.5	-40.4	179.8	-161.7	69.3	0	0	0	111.5	T10 L11 R17 R18	T10-L14 WeakPolarHBondContact O-CB 3.3Å; T10-L14 PolarHBondContact O-N 3.38Å; L11-L14 PolarHBondContact O-N 2.94Å; L14-R17 PolarHBondContact O-N 2.93Å; L14-R18 VanDerWaalsContact O-CB 3.3Å; L14-R18 WeakPolarHBondContact O-CB 3.28Å; L14-R18 PolarHBondContact O-N 3.49Å
15	W	85	Confident	77.4	Confident	165 Å²	165	117.9 Å²	117.9	63%	0.625	58%	0.575	S	S	*	*	H	α-helix	trans	-61.1	-50.8	172.5	-83.9	15.6	0	0	0	111.6	L11 A12 R17 R18 F19	L11-W15 WeakPolarHBondContact O-CB 3.25Å; L11-W15 PolarHBondContact O-N 3.47Å; A12-W15 PolarHBondContact O-N 3.18Å; W15-R17 VanDerWaalsContact C-N 3.3Å; W15-R17 PolarHBondContact O-N 3.44Å; W15-R18 PolarHBondContact O-N 2.89Å; W15-F19 VanDerWaalsContact O-CD2 3.25Å; W15-F19 PolarHBondContact O-N 2.81Å; W15-F19 WeakPolarHBondContact O-CD2 3.36Å; W15-F19 WeakPolarHBondContact O-CB 3.39Å; W15-F19 HydrophobicContact CB-CD2 4.36Å
16	R	77.1	Confident	75.5	Confident	191 Å²	191	120.7 Å²	120.7	72%	0.721	59%	0.585	S	S	*	*	H	α-helix	trans	-57	-43.8	177.1	-73.8	177.9	-174.2	168.1	2.1	111.7	A12 M13 A20	A12-R16 WeakPolarHBondContact O-CG 3.2Å; A12-R16 PolarHBondContact O-N 3.43Å; M13-R16 PolarHBondContact O-N 3.33Å; R16-A20 WeakPolarHBondContact O-CB 3.49Å; R16-A20 PolarHBondContact O-N 2.9Å
17	R	71.8	Confident	73.8	Confident	182 Å²	182	117.7 Å²	117.7	69%	0.687	58%	0.58	S	S	*	*	H	α-helix	trans	-65.8	-42.9	177.2	-168.3	175.1	-174.5	-169.2	2.4	112.2	M13 L14 W15 N21	M13-R17 PolarHBondContact O-N 3.19Å; M13-R17 WeakPolarHBondContact O-CB 3.25Å; L14-R17 PolarHBondContact O-N 2.93Å; W15-R17 VanDerWaalsContact C-N 3.3Å; W15-R17 PolarHBondContact O-N 3.44Å; R17-N21 VanDerWaalsContact O-CB 3.23Å; R17-N21 WeakPolarHBondContact O-CB 3.23Å; R17-N21 PolarHBondContact O-N 3.49Å
18	R	72.3	Confident	71.6	Confident	143 Å²	143	116.8 Å²	116.8	54%	0.54	58%	0.584	S	S	.	*	H	α-helix	trans	-67	-39.3	178.2	-108.6	-74.1	-135.6	-169.3	1.5	112.7	L14 W15 R22	L14-R18 VanDerWaalsContact O-CB 3.3Å; L14-R18 WeakPolarHBondContact O-CB 3.28Å; L14-R18 PolarHBondContact O-N 3.49Å; W15-R18 PolarHBondContact O-N 2.89Å; R18-R22 PolarHBondContact O-N 3.49Å; R18-R22 WeakPolarHBondContact O-CG 3.43Å; R18-R22 VanDerWaalsContact O-CB 3.25Å; R18-R22 VanDerWaalsContact NH1-NE 3.19Å; R18-R22 WeakPolarHBondContact O-CB 3.45Å
19	F	69.8	Low	69.5	Low	125 Å²	125	119.2 Å²	119.2	55%	0.548	60%	0.597	S	S	.	*	H	α-helix	trans	-78	-41.3	178.5	-81.9	-78.7	0	0	0	111.1	W15 R22 V23	W15-F19 VanDerWaalsContact O-CD2 3.25Å; W15-F19 PolarHBondContact O-N 2.81Å; W15-F19 WeakPolarHBondContact O-CD2 3.36Å; W15-F19 WeakPolarHBondContact O-CB 3.39Å; W15-F19 HydrophobicContact CB-CD2 4.36Å; F19-R22 CarbonylContact O-C 3.48Å; F19-R22 WeakPolarHBondContact O-CA 3.32Å; F19-R22 PolarHBondContact O-N 3.45Å; F19-V23 VanDerWaalsContact O-CB 3.27Å; F19-V23 WeakPolarHBondContact O-CB 3.5Å; F19-V23 WeakPolarHBondContact O-CG2 3.19Å; F19-V23 PolarHBondContact O-N 3.26Å
20	A	61.4	Low	67.9	Low	62 Å²	62	121.4 Å²	121.4	51%	0.512	61%	0.608	S	S	.	*	H	α-helix	trans	-62.4	-43.3	172.9	0	0	0	0	0	112	R16 R22 V23 Q24	R16-A20 WeakPolarHBondContact O-CB 3.49Å; R16-A20 PolarHBondContact O-N 2.9Å; A20-R22 PolarHBondContact O-N 2.8Å; A20-V23 PolarHBondContact O-N 3.35Å; A20-Q24 PolarHBondContact O-N 2.94Å
21	N	56.5	Low	65.9	Low	113 Å²	113	125.7 Å²	125.7	60%	0.604	63%	0.628	S	S	*	*	H	α-helix	trans	-64.1	-21.1	171.3	-97.7	16.6	0	0	0	113.7	R17	R17-N21 VanDerWaalsContact O-CB 3.23Å; R17-N21 WeakPolarHBondContact O-CB 3.23Å; R17-N21 PolarHBondContact O-N 3.49Å
22	R	57.2	Low	63.9	Low	162 Å²	162	125.9 Å²	125.9	61%	0.611	65%	0.652	S	S	*	*	H	α-helix	trans	-97.1	-23.5	179.4	-81.2	-171.8	165.5	-178.4	-4.6	113.7	R18 F19 A20	R18-R22 PolarHBondContact O-N 3.49Å; R18-R22 WeakPolarHBondContact O-CG 3.43Å; R18-R22 VanDerWaalsContact O-CB 3.25Å; R18-R22 VanDerWaalsContact NH1-NE 3.19Å; R18-R22 WeakPolarHBondContact O-CB 3.45Å; F19-R22 CarbonylContact O-C 3.48Å; F19-R22 WeakPolarHBondContact O-CA 3.32Å; F19-R22 PolarHBondContact O-N 3.45Å; A20-R22 PolarHBondContact O-N 2.8Å
23	V	54.1	Low	61.9	Low	114 Å²	114	127.8 Å²	127.8	69%	0.691	67%	0.668	S	S	*	*	H	α-helix	trans	-97	-20	-179	175.6	0	0	0	0	111.1	F19 A20	F19-V23 VanDerWaalsContact O-CB 3.27Å; F19-V23 WeakPolarHBondContact O-CB 3.5Å; F19-V23 WeakPolarHBondContact O-CG2 3.19Å; F19-V23 PolarHBondContact O-N 3.26Å; A20-V23 PolarHBondContact O-N 3.35Å
24	Q	50.5	Low	59.8	Low	162 Å²	162	126.8 Å²	126.8	76%	0.757	68%	0.678	S	S	*	*			trans	-131.2	84.7	166.9	-77.9	-101.3	33.6	0	0	110.7	A20	A20-Q24 PolarHBondContact O-N 2.94Å
25	P	61.8	Low	58.1	Low	93 Å²	93	133.3 Å²	133.3	60%	0.604	70%	0.696	S	S	*	*			trans	-112.7	103.9	153.9	30.5	-15.6	0	0	0	109.6
26	E	51.7	Low	56.3	Low	170 Å²	170	129.5 Å²	129.5	79%	0.794	71%	0.707	S	S	*	*			trans	-159.9	153.9	152	-108.6	-91.4	114.7	0	0	107.4
27	P	54.4	Low	54.7	Low	83 Å²	83	124.9 Å²	124.9	54%	0.539	70%	0.704	S	S	.	*				-121.7	110.5	-107.2	35.9	-19	0	0	0	108.9	D29	P27-D29 VanDerWaalsContact C-N 3.3Å; P27-D29 PolarHBondContact O-N 2.88Å; P27-D29 VanDerWaalsContact O-N 3.08Å
28	S	49	Very low	53.6	Low	96 Å²	96	121.5 Å²	121.5	67%	0.671	71%	0.708	S	S	*	*			trans	-85.3	83.8	170.9	179.7	0	0	0	0	108.1	V30	S28-V30 PolarHBondContact O-N 2.89Å; S28-V30 WeakPolarHBondContact OG-CG2 3.32Å; S28-V30 PolarHBondContact OG-O 3.41Å
29	D	50	Low	52.4	Low	161 Å²	161	121.1 Å²	121.1	86%	0.861	72%	0.722	S	S	*	*			trans	-62.6	50.2	156.2	-101.2	-76	0	0	0	110.5	P27	P27-D29 VanDerWaalsContact C-N 3.3Å; P27-D29 PolarHBondContact O-N 2.88Å; P27-D29 VanDerWaalsContact O-N 3.08Å
30	V	53.9	Low	51.2	Low	112 Å²	112	123.1 Å²	123.1	68%	0.679	74%	0.738	S	S	*	*	S	Bend	trans	-149.9	117.8	171.4	-116	0	0	0	0	107.8	S28	S28-V30 PolarHBondContact O-N 2.89Å; S28-V30 WeakPolarHBondContact OG-CG2 3.32Å; S28-V30 PolarHBondContact OG-O 3.41Å
31	D	48.6	Very low	50.5	Low	150 Å²	150	124.7 Å²	124.7	80%	0.802	75%	0.751	S	S	*	*			trans	75.9	70	178	-84.2	-16.5	0	0	0	119.5	A33	D31-A33 PolarHBondContact O-N 3.39Å
32	G	50.9	Low	49.7	Very low	95 Å²	95	125.7 Å²	125.7	98%	0.979	76%	0.756	S	S	*	*			trans	-65.5	56.4	148.5	0	0	0	0	0	113.8
33	A	47.7	Very low	49.6	Very low	80 Å²	80	124 Å²	124	66%	0.661	77%	0.767	S	S	*	*			trans	-147.5	46.9	178.8	0	0	0	0	0	115	D31	D31-A33 PolarHBondContact O-N 3.39Å
34	A	45.8	Very low	49.8	Very low	97 Å²	97	126.8 Å²	126.8	80%	0.802	77%	0.772	S	S	*	*			trans	-158.1	51.2	156.3	0	0	0	0	0	111.7	G36	A34-G36 PolarHBondContact O-N 3.4Å
35	R	50.4	Low	49.5	Very low	244 Å²	244	124.3 Å²	124.3	92%	0.921	77%	0.773	S	S	*	*	S	Bend	trans	-62.7	127.7	158.8	172.2	157.5	145.4	-179.3	-9.4	107.4	S37	R35-S37 PolarHBondContact O-N 3.21Å
36	G	47.3	Very low	49.3	Very low	84 Å²	84	126 Å²	126	87%	0.866	79%	0.786	S	S	*	*	S	Bend	trans	-41.2	105	-177.6	0	0	0	0	0	114.4	A34	A34-G36 PolarHBondContact O-N 3.4Å
37	S	43.7	Very low	48.9	Very low	94 Å²	94	121 Å²	121	66%	0.657	78%	0.781	S	S	*	*			trans	-153.9	93.6	161.7	-168.3	0	0	0	0	108.9	R35 V39	R35-S37 PolarHBondContact O-N 3.21Å; S37-V39 PolarHBondContact O-N 2.89Å
38	S	49	Very low	48.9	Very low	111 Å²	111	127.5 Å²	127.5	78%	0.776	80%	0.795	S	S	*	*	S	Bend	trans	45	49.7	136.4	72.1	0	0	0	0	119.3
39	V	45.9	Very low	48.5	Very low	136 Å²	136	131.5 Å²	131.5	82%	0.824	80%	0.803	S	S	*	*			trans	-149.6	82.8	160.7	175.2	0	0	0	0	108	S37	S37-V39 PolarHBondContact O-N 2.89Å
40	D	45.4	Very low	48.6	Very low	166 Å²	166	131.9 Å²	131.9	89%	0.888	80%	0.797	S	S	*	*			trans	-139.2	74.7	155.9	-160.6	-92.1	0	0	0	106.6
41	A	47.5	Very low	48.1	Very low	95 Å²	95	134.5 Å²	134.5	79%	0.785	80%	0.802	S	S	*	*			trans	-148.1	78.6	162.4	0	0	0	0	0	105.6
42	D	39.5	Very low	48.1	Very low	134 Å²	134	133.3 Å²	133.3	72%	0.717	80%	0.802	S	S	*	*				164.6	117.7	123.2	-162.6	-150.7	0	0	0	110.8	Q44	D42-Q44 PolarHBondContact O-N 2.89Å
43	P	53.7	Low	48.1	Very low	127 Å²	127	136.1 Å²	136.1	83%	0.825	79%	0.794	S	S	*	*			trans	-94	79.7	177	36.1	-28.3	0	0	0	110
44	Q	58.8	Low	47.9	Very low	172 Å²	172	145.5 Å²	145.5	80%	0.804	82%	0.82	S	S	*	*			trans	-155.7	103.5	171.1	-148.8	174.5	-109.4	0	0	115.1	D42	D42-Q44 PolarHBondContact O-N 2.89Å
45	S	45.1	Very low	48	Very low	110 Å²	110	147.9 Å²	147.9	77%	0.769	82%	0.821	S	S	*	*			trans	158.5	84.6	157.1	162.3	0	0	0	0	107.2
46	S	57.7	Low	47.9	Very low	128 Å²	128	142.8 Å²	142.8	90%	0.895	82%	0.815	S	S	*	*				37.1	77.7	57.2	-161.3	0	0	0	0	113.9
47	G	43.2	Very low	47.9	Very low	66 Å²	66	146.1 Å²	146.1	68%	0.68	81%	0.813	S	S	*	*			trans	-165.7	104.5	171.4	0	0	0	0	0	111.9
48	R	53.2	Low	48.2	Very low	219 Å²	219	149.2 Å²	149.2	83%	0.826	82%	0.822	S	S	*	*			trans	-68.8	135.6	174.1	-79	166.2	158.8	160.7	-5.4	111.9
49	E	41.7	Very low	48.1	Very low	181 Å²	181	151.6 Å²	151.6	85%	0.846	83%	0.825	S	S	*	*			trans	-166.1	99.7	148.7	51.8	-162.6	128.3	0	0	106.1
50	K	52.2	Low	48.3	Very low	168 Å²	168	152.6 Å²	152.6	73%	0.73	83%	0.825	S	S	*	*				43.3	105.5	68.8	-47.5	-163.1	-171.9	-139.3	0	112.3
51	E	42.7	Very low	48.5	Very low	167 Å²	167	151.6 Å²	151.6	78%	0.78	82%	0.82	S	S	*	*			trans	-38.2	158.8	167.1	-78.8	172.5	69.7	0	0	114.2
52	P	49.5	Very low	48.6	Very low	125 Å²	125	156 Å²	156	81%	0.812	82%	0.823	S	S	*	*				-138.4	134.5	101.4	32.8	-17.9	0	0	0	114.7
53	L	49.5	Very low	49.3	Very low	155 Å²	155	157.8 Å²	157.8	81%	0.812	83%	0.832	S	S	*	*			trans	-23	125.1	150.8	-146.8	92.3	0	0	0	114.6
54	K	44.8	Very low	48.9	Very low	276 Å²	276	160.6 Å²	160.6	100%	1.2	83%	0.832	S	S	*	*			trans	-154.9	0	150.3	-136.5	173.4	-173.6	173.5	0	112

Retrieved 54 of 54 residues in 46.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).