A0A096NU27_PAPAN Loading...

Family with sequence similarity 24 member A

AlphaFold DB , UniProt , Accession A0A096NU27, Species PAPAN (Papio anubis, Olive baboon), Gene FAM24A, Length 105 aa.

						>A0A096NU27_PAPAN|A0A096NU27|FAM24A
VGKMFDLRTKIMIGIGSSLLVAAMVLLIVVLCLYVKVAKALKAAKDPDAVAVKHHSPDKVWWAKNSQAKDTTMESYPSLQCCEGCRMYGSCDALPPCCCDTNEGL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	V	40.8	Very low	72.3	Confident	190 Å²	190	137.8 Å²	137.8	100%	1.152	71%	0.705	S	S	*	*				0	98.8	0	120	0	0	0	0	107.9	K3	V1-K3 PolarHBondContact O-N 2.94Å
2	G	53.3	Low	73.9	Confident	78 Å²	78	137.3 Å²	137.3	80%	0.804	70%	0.701	S	S	*	*			trans	-72.2	118.4	176.8	0	0	0	0	0	108.1	M4	G2-M4 VanDerWaalsContact C-N 3.34Å; G2-M4 PolarHBondContact O-N 3.34Å
3	K	61.2	Low	75.3	Confident	177 Å²	177	135.1 Å²	135.1	77%	0.77	69%	0.689	S	S	*	*			trans	-66.7	98.3	172.1	-80.3	171.2	175.6	150.9	0	107.3	V1 F5	V1-K3 PolarHBondContact O-N 2.94Å; K3-F5 PolarHBondContact O-N 3.15Å
4	M	62.2	Low	76.5	Confident	187 Å²	187	127.9 Å²	127.9	92%	0.921	67%	0.666	S	S	*	*			trans	-66.6	91.6	167.3	-157.4	155.7	95.9	0	0	105.6	G2 D6	G2-M4 VanDerWaalsContact C-N 3.34Å; G2-M4 PolarHBondContact O-N 3.34Å; M4-D6 PolarHBondContact O-N 3.5Å; M4-D6 VanDerWaalsContact O-N 3.1Å
5	F	61.4	Low	77.8	Confident	155 Å²	155	126.5 Å²	126.5	68%	0.68	66%	0.658	S	S	*	*			trans	-55.1	120.4	173.3	-85.6	-85	0	0	0	107.1	K3 L7	K3-F5 PolarHBondContact O-N 3.15Å; F5-L7 PolarHBondContact O-N 3.36Å
6	D	80.5	Confident	78.8	Confident	99 Å²	99	121.1 Å²	121.1	53%	0.529	64%	0.643	S	S	.	*			trans	-50.3	127.4	-177.3	-163	-52.1	0	0	0	108.9	M4 R8 T9 K10	M4-D6 PolarHBondContact O-N 3.5Å; M4-D6 VanDerWaalsContact O-N 3.1Å; D6-R8 PolarHBondContact O-N 3.37Å; D6-R8 WeakPolarHBondContact OD1-CB 3.43Å; D6-R8 PolarHBondContact OD1-N 3.2Å; D6-R8 VanDerWaalsContact OD1-N 3.14Å; D6-T9 WeakPolarHBondContact O-CA 3.45Å; D6-T9 WeakPolarHBondContact O-CB 3.38Å; D6-T9 PolarHBondContact O-N 2.98Å; D6-K10 PolarHBondContact O-N 3.4Å
7	L	86.1	Confident	79.7	Confident	124 Å²	124	117.4 Å²	117.4	65%	0.649	63%	0.629	S	S	*	*	H	α-helix	trans	-53.6	-33.1	-176	-178.5	62.7	0	0	0	110.7	F5 T9 K10 I11	F5-L7 PolarHBondContact O-N 3.36Å; L7-T9 PolarHBondContact O-N 3.48Å; L7-K10 PolarHBondContact O-N 2.86Å; L7-I11 HydrophobicContact CD1-CD1 4.42Å; L7-I11 HydrophobicContact CG-CD1 3.99Å; L7-I11 WeakPolarHBondContact O-CD1 3.12Å; L7-I11 VanDerWaalsContact O-CG1 3.25Å; L7-I11 WeakPolarHBondContact O-CG1 3.36Å; L7-I11 PolarHBondContact O-N 2.93Å
8	R	84.9	Confident	80.6	Confident	207 Å²	207	114.7 Å²	114.7	78%	0.781	62%	0.621	S	S	*	*	H	α-helix	trans	-61.4	-42.6	174.7	-69	-170.9	177.8	-161.4	1.6	112.8	D6 I11 M12	D6-R8 PolarHBondContact O-N 3.37Å; D6-R8 WeakPolarHBondContact OD1-CB 3.43Å; D6-R8 PolarHBondContact OD1-N 3.2Å; D6-R8 VanDerWaalsContact OD1-N 3.14Å; R8-I11 PolarHBondContact O-N 3.27Å; R8-M12 WeakPolarHBondContact O-CB 3.41Å; R8-M12 PolarHBondContact O-N 3.43Å
9	T	86.5	Confident	81.4	Confident	56 Å²	56	115.3 Å²	115.3	34%	0.344	62%	0.623	S	S	.	*	H	α-helix	trans	-66.6	-39.6	178.3	-54.2	0	0	0	0	111.3	D6 L7 I11 M12 I13	D6-T9 WeakPolarHBondContact O-CA 3.45Å; D6-T9 WeakPolarHBondContact O-CB 3.38Å; D6-T9 PolarHBondContact O-N 2.98Å; L7-T9 PolarHBondContact O-N 3.48Å; T9-I11 PolarHBondContact O-N 3.23Å; T9-M12 PolarHBondContact O-N 2.92Å; T9-I13 HydrophobicContact CG2-CD1 3.88Å; T9-I13 WeakPolarHBondContact O-CD1 3.36Å; T9-I13 WeakPolarHBondContact O-CG1 3.37Å; T9-I13 PolarHBondContact O-N 3.36Å
10	K	86.8	Confident	82.2	Confident	151 Å²	151	114.9 Å²	114.9	66%	0.657	62%	0.62	S	S	*	*	H	α-helix	trans	-64.7	-40	177.5	-167	168.5	-178.8	166.6	0	112	D6 L7 G14	D6-K10 PolarHBondContact O-N 3.4Å; L7-K10 PolarHBondContact O-N 2.86Å; K10-G14 PolarHBondContact O-N 2.88Å; K10-G14 VanDerWaalsContact O-N 3.08Å
11	I	91.3	Very high	82.9	Confident	92 Å²	92	113.7 Å²	113.7	47%	0.472	62%	0.616	S	S	.	*	H	α-helix	trans	-65.5	-45.1	175.3	-66.5	163.9	0	0	0	110.8	L7 R8 T9 I13 G14 I15	L7-I11 HydrophobicContact CD1-CD1 4.42Å; L7-I11 HydrophobicContact CG-CD1 3.99Å; L7-I11 WeakPolarHBondContact O-CD1 3.12Å; L7-I11 VanDerWaalsContact O-CG1 3.25Å; L7-I11 WeakPolarHBondContact O-CG1 3.36Å; L7-I11 PolarHBondContact O-N 2.93Å; R8-I11 PolarHBondContact O-N 3.27Å; T9-I11 PolarHBondContact O-N 3.23Å; I11-I13 VanDerWaalsContact C-N 3.33Å; I11-I13 PolarHBondContact O-N 3.41Å; I11-G14 PolarHBondContact O-N 3.33Å; I11-G14 VanDerWaalsContact O-N 3.16Å; I11-I15 HydrophobicContact CG2-CD1 3.72Å; I11-I15 HydrophobicContact CG2-CG1 4.38Å; I11-I15 WeakPolarHBondContact O-CG1 3.19Å; I11-I15 PolarHBondContact O-N 2.98Å
12	M	91.5	Very high	85.6	Confident	132 Å²	132	107 Å²	107	65%	0.65	58%	0.581	S	S	*	*	H	α-helix	trans	-61.2	-40.9	179.8	-169.1	173.2	71.2	0	0	112.4	R8 T9 I15 G16	R8-M12 WeakPolarHBondContact O-CB 3.41Å; R8-M12 PolarHBondContact O-N 3.43Å; T9-M12 PolarHBondContact O-N 2.92Å; M12-I15 PolarHBondContact O-N 3.39Å; M12-G16 PolarHBondContact O-N 3.41Å
13	I	92.1	Very high	87.7	Confident	108 Å²	108	105.5 Å²	105.5	55%	0.554	56%	0.561	S	S	*	*	H	α-helix	trans	-66.4	-40.1	175.4	-71.8	160.6	0	0	0	111.2	T9 I11 S17	T9-I13 HydrophobicContact CG2-CD1 3.88Å; T9-I13 WeakPolarHBondContact O-CD1 3.36Å; T9-I13 WeakPolarHBondContact O-CG1 3.37Å; T9-I13 PolarHBondContact O-N 3.36Å; I11-I13 VanDerWaalsContact C-N 3.33Å; I11-I13 PolarHBondContact O-N 3.41Å; I13-S17 WeakPolarHBondContact O-CB 3.41Å; I13-S17 PolarHBondContact O-N 2.94Å; I13-S17 PolarHBondContact O-OG 3.35Å
14	G	92.8	Very high	89.4	Confident	35 Å²	35	102 Å²	102	36%	0.361	55%	0.548	S	S	.	.	H	α-helix	trans	-61.5	-46.3	176.1	0	0	0	0	0	112.4	K10 I11 S17 S18	K10-G14 PolarHBondContact O-N 2.88Å; K10-G14 VanDerWaalsContact O-N 3.08Å; I11-G14 PolarHBondContact O-N 3.33Å; I11-G14 VanDerWaalsContact O-N 3.16Å; G14-S17 PolarHBondContact O-OG 2.84Å; G14-S17 VanDerWaalsContact O-OG 3.1Å; G14-S18 WeakPolarHBondContact O-CB 3.27Å; G14-S18 PolarHBondContact O-N 3.27Å; G14-S18 PolarHBondContact O-OG 3.47Å
15	I	95.3	Very high	91	Very high	106 Å²	106	96.8 Å²	96.8	54%	0.544	53%	0.527	S	S	.	.	H	α-helix	trans	-65.8	-48	178.7	-61.9	166.3	0	0	0	110.2	I11 M12 S17 S18 L19	I11-I15 HydrophobicContact CG2-CD1 3.72Å; I11-I15 HydrophobicContact CG2-CG1 4.38Å; I11-I15 WeakPolarHBondContact O-CG1 3.19Å; I11-I15 PolarHBondContact O-N 2.98Å; M12-I15 PolarHBondContact O-N 3.39Å; I15-S17 PolarHBondContact O-N 3.5Å; I15-S18 PolarHBondContact O-OG 3.28Å; I15-L19 WeakPolarHBondContact O-CB 3.42Å; I15-L19 PolarHBondContact O-N 3.01Å
16	G	94.2	Very high	92.7	Very high	41 Å²	41	95 Å²	95	42%	0.423	52%	0.524	S	S	.	.	H	α-helix	trans	-62.3	-44.8	179.6	0	0	0	0	0	113.1	M12 L19 L20	M12-G16 PolarHBondContact O-N 3.41Å; G16-L19 PolarHBondContact O-N 2.77Å; G16-L20 WeakPolarHBondContact O-CB 3.36Å; G16-L20 PolarHBondContact O-N 3.22Å
17	S	94.3	Very high	93.5	Very high	58 Å²	58	95.2 Å²	95.2	41%	0.406	52%	0.524	S	S	.	.	H	α-helix	trans	-66.8	-43	179.7	57.2	0	0	0	0	112.5	I13 G14 I15 L19 L20 V21	I13-S17 WeakPolarHBondContact O-CB 3.41Å; I13-S17 PolarHBondContact O-N 2.94Å; I13-S17 PolarHBondContact O-OG 3.35Å; G14-S17 PolarHBondContact O-OG 2.84Å; G14-S17 VanDerWaalsContact O-OG 3.1Å; I15-S17 PolarHBondContact O-N 3.5Å; S17-L19 VanDerWaalsContact C-N 3.33Å; S17-L19 PolarHBondContact O-N 3.32Å; S17-L20 PolarHBondContact O-N 2.93Å; S17-V21 VanDerWaalsContact O-CG2 3.31Å; S17-V21 WeakPolarHBondContact O-CG2 3.32Å; S17-V21 PolarHBondContact O-N 3.45Å
18	S	94.8	Very high	94	Very high	68 Å²	68	94.1 Å²	94.1	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-62.8	-41	176.7	56.2	0	0	0	0	111.9	G14 I15 V21 A22	G14-S18 WeakPolarHBondContact O-CB 3.27Å; G14-S18 PolarHBondContact O-N 3.27Å; G14-S18 PolarHBondContact O-OG 3.47Å; I15-S18 PolarHBondContact O-OG 3.28Å; S18-V21 PolarHBondContact O-N 3.5Å; S18-A22 WeakPolarHBondContact O-CB 3.24Å; S18-A22 PolarHBondContact O-N 2.89Å
19	L	96.8	Very high	94.6	Very high	126 Å²	126	87.7 Å²	87.7	66%	0.66	50%	0.502	S	S	*	.	H	α-helix	trans	-65.1	-40.6	175.7	-147.1	73.7	0	0	0	111.7	I15 G16 S17 A22 A23	I15-L19 WeakPolarHBondContact O-CB 3.42Å; I15-L19 PolarHBondContact O-N 3.01Å; G16-L19 PolarHBondContact O-N 2.77Å; S17-L19 VanDerWaalsContact C-N 3.33Å; S17-L19 PolarHBondContact O-N 3.32Å; L19-A22 PolarHBondContact O-N 3.31Å; L19-A23 WeakPolarHBondContact O-CB 3.41Å; L19-A23 PolarHBondContact O-N 2.95Å
20	L	97.1	Very high	95	Very high	107 Å²	107	89.5 Å²	89.5	56%	0.56	51%	0.513	S	S	*	.	H	α-helix	trans	-64.4	-45.1	176.9	-175.9	64	0	0	0	111.7	G16 S17 A23 M24	G16-L20 WeakPolarHBondContact O-CB 3.36Å; G16-L20 PolarHBondContact O-N 3.22Å; S17-L20 PolarHBondContact O-N 2.93Å; L20-A23 PolarHBondContact O-N 3.38Å; L20-M24 HydrophobicContact CD1-CE 4.35Å; L20-M24 WeakPolarHBondContact O-CG 3.32Å; L20-M24 PolarHBondContact O-N 2.92Å
21	V	96.9	Very high	95.4	Very high	91 Å²	91	87.6 Å²	87.6	55%	0.552	51%	0.509	S	S	*	.	H	α-helix	trans	-62.7	-44.6	176.8	172	0	0	0	0	110.4	S17 S18 A23 M24 V25	S17-V21 VanDerWaalsContact O-CG2 3.31Å; S17-V21 WeakPolarHBondContact O-CG2 3.32Å; S17-V21 PolarHBondContact O-N 3.45Å; S18-V21 PolarHBondContact O-N 3.5Å; V21-A23 VanDerWaalsContact C-N 3.34Å; V21-A23 PolarHBondContact O-N 3.37Å; V21-M24 PolarHBondContact O-N 2.83Å; V21-V25 HydrophobicContact CG1-CG2 4.4Å; V21-V25 WeakPolarHBondContact O-CG2 3.28Å; V21-V25 PolarHBondContact O-N 3.41Å
22	A	97.1	Very high	95.5	Very high	50 Å²	50	86.9 Å²	86.9	41%	0.413	51%	0.511	S	S	.	.	H	α-helix	trans	-58.4	-45.6	176.2	0	0	0	0	0	111.7	S18 L19 M24 V25 L26	S18-A22 WeakPolarHBondContact O-CB 3.24Å; S18-A22 PolarHBondContact O-N 2.89Å; L19-A22 PolarHBondContact O-N 3.31Å; A22-M24 PolarHBondContact O-N 3.47Å; A22-V25 PolarHBondContact O-N 2.84Å; A22-L26 WeakPolarHBondContact O-CG 3.46Å; A22-L26 PolarHBondContact O-N 2.89Å
23	A	97.5	Very high	95.7	Very high	45 Å²	45	85.3 Å²	85.3	37%	0.372	51%	0.505	S	S	.	.	H	α-helix	trans	-61.6	-44.6	176.6	0	0	0	0	0	112.2	L19 L20 V21 V25 L26 L27	L19-A23 WeakPolarHBondContact O-CB 3.41Å; L19-A23 PolarHBondContact O-N 2.95Å; L20-A23 PolarHBondContact O-N 3.38Å; V21-A23 VanDerWaalsContact C-N 3.34Å; V21-A23 PolarHBondContact O-N 3.37Å; A23-V25 PolarHBondContact O-N 3.37Å; A23-L26 PolarHBondContact O-N 3.28Å; A23-L27 WeakPolarHBondContact O-CG 3.21Å; A23-L27 PolarHBondContact O-N 3.47Å
24	M	96.4	Very high	95.8	Very high	103 Å²	103	88.2 Å²	88.2	51%	0.507	51%	0.51	S	S	.	.	H	α-helix	trans	-61.1	-44.4	177.3	-72.5	-66.2	-175.3	0	0	112	L20 V21 A22 L26 L27 I28	L20-M24 HydrophobicContact CD1-CE 4.35Å; L20-M24 WeakPolarHBondContact O-CG 3.32Å; L20-M24 PolarHBondContact O-N 2.92Å; V21-M24 PolarHBondContact O-N 2.83Å; A22-M24 PolarHBondContact O-N 3.47Å; M24-L26 VanDerWaalsContact C-N 3.35Å; M24-L26 PolarHBondContact O-N 3.45Å; M24-L27 PolarHBondContact O-N 2.8Å; M24-I28 VanDerWaalsContact O-CG1 3.27Å; M24-I28 WeakPolarHBondContact O-CG1 3.32Å; M24-I28 PolarHBondContact O-N 3.33Å
25	V	97.2	Very high	95.5	Very high	79 Å²	79	90.4 Å²	90.4	48%	0.479	52%	0.517	S	S	.	.	H	α-helix	trans	-61.5	-44.9	176.8	171.4	0	0	0	0	110.7	V21 A22 A23 L27 I28 V29	V21-V25 HydrophobicContact CG1-CG2 4.4Å; V21-V25 WeakPolarHBondContact O-CG2 3.28Å; V21-V25 PolarHBondContact O-N 3.41Å; A22-V25 PolarHBondContact O-N 2.84Å; A23-V25 PolarHBondContact O-N 3.37Å; V25-L27 PolarHBondContact O-N 3.47Å; V25-I28 PolarHBondContact O-N 2.94Å; V25-V29 HydrophobicContact CG1-CG2 4.4Å; V25-V29 WeakPolarHBondContact O-CG2 3.31Å; V25-V29 PolarHBondContact O-N 3.48Å
26	L	97.4	Very high	95.3	Very high	117 Å²	117	92.7 Å²	92.7	61%	0.613	52%	0.523	S	S	*	.	H	α-helix	trans	-60.2	-45	176.8	-72.3	172.8	0	0	0	111.7	A22 A23 M24 I28 V29 V30	A22-L26 WeakPolarHBondContact O-CG 3.46Å; A22-L26 PolarHBondContact O-N 2.89Å; A23-L26 PolarHBondContact O-N 3.28Å; M24-L26 VanDerWaalsContact C-N 3.35Å; M24-L26 PolarHBondContact O-N 3.45Å; L26-I28 PolarHBondContact O-N 3.48Å; L26-V29 PolarHBondContact O-N 3.5Å; L26-V30 VanDerWaalsContact O-CG2 3.28Å; L26-V30 WeakPolarHBondContact O-CG2 3.44Å; L26-V30 PolarHBondContact O-N 3.26Å
27	L	96.8	Very high	95.1	Very high	104 Å²	104	95.3 Å²	95.3	55%	0.545	53%	0.53	S	S	.	.	H	α-helix	trans	-59.8	-45.6	176.4	-71.8	173.1	0	0	0	111.7	A23 M24 V25 V29 V30 L31	A23-L27 WeakPolarHBondContact O-CG 3.21Å; A23-L27 PolarHBondContact O-N 3.47Å; M24-L27 PolarHBondContact O-N 2.8Å; V25-L27 PolarHBondContact O-N 3.47Å; L27-V29 PolarHBondContact O-N 3.26Å; L27-V30 PolarHBondContact O-N 2.88Å; L27-L31 WeakPolarHBondContact O-CB 3.24Å; L27-L31 VanDerWaalsContact O-CG 3.24Å; L27-L31 WeakPolarHBondContact O-CG 3.35Å; L27-L31 PolarHBondContact O-N 3.43Å
28	I	96	Very high	94.6	Very high	101 Å²	101	94.1 Å²	94.1	52%	0.518	52%	0.524	S	S	.	.	H	α-helix	trans	-60.1	-48	177.4	-68.6	163.7	0	0	0	110.5	M24 V25 L26 V30 L31 C32	M24-I28 VanDerWaalsContact O-CG1 3.27Å; M24-I28 WeakPolarHBondContact O-CG1 3.32Å; M24-I28 PolarHBondContact O-N 3.33Å; V25-I28 PolarHBondContact O-N 2.94Å; L26-I28 PolarHBondContact O-N 3.48Å; I28-V30 PolarHBondContact O-N 3.37Å; I28-L31 PolarHBondContact O-N 2.94Å; I28-C32 WeakPolarHBondContact O-CB 3.32Å; I28-C32 PolarHBondContact O-N 3.3Å; I28-C32 PolarHBondContact O-SG 2.94Å
29	V	97	Very high	94	Very high	72 Å²	72	98 Å²	98	44%	0.436	53%	0.532	S	S	.	.	H	α-helix	trans	-60.3	-46.4	179.4	171	0	0	0	0	111	V25 L26 L27 L31 C32 L33	V25-V29 HydrophobicContact CG1-CG2 4.4Å; V25-V29 WeakPolarHBondContact O-CG2 3.31Å; V25-V29 PolarHBondContact O-N 3.48Å; L26-V29 PolarHBondContact O-N 3.5Å; L27-V29 PolarHBondContact O-N 3.26Å; V29-L31 PolarHBondContact O-N 3.29Å; V29-C32 PolarHBondContact O-N 3.47Å; V29-L33 HydrophobicContact CG1-CD1 4Å; V29-L33 HydrophobicContact CG1-CG 4.39Å; V29-L33 WeakPolarHBondContact O-CB 3.29Å; V29-L33 VanDerWaalsContact O-CG 3.29Å; V29-L33 WeakPolarHBondContact O-CG 3.28Å; V29-L33 PolarHBondContact O-N 2.92Å
30	V	96	Very high	93.5	Very high	94 Å²	94	94.9 Å²	94.9	57%	0.57	53%	0.525	S	S	*	.	H	α-helix	trans	-60.8	-45.2	177.8	171.4	0	0	0	0	110.9	L26 L27 I28 L33 Y34	L26-V30 VanDerWaalsContact O-CG2 3.28Å; L26-V30 WeakPolarHBondContact O-CG2 3.44Å; L26-V30 PolarHBondContact O-N 3.26Å; L27-V30 PolarHBondContact O-N 2.88Å; I28-V30 PolarHBondContact O-N 3.37Å; V30-L33 PolarHBondContact O-N 3.1Å; V30-Y34 WeakPolarHBondContact O-CB 3.21Å; V30-Y34 PolarHBondContact O-N 2.93Å
31	L	94.4	Very high	92.7	Very high	110 Å²	110	95.3 Å²	95.3	58%	0.576	53%	0.527	S	S	*	.	H	α-helix	trans	-63.3	-43.4	177.2	-71.9	170.7	0	0	0	111.9	L27 I28 V29 L33 Y34 V35	L27-L31 WeakPolarHBondContact O-CB 3.24Å; L27-L31 VanDerWaalsContact O-CG 3.24Å; L27-L31 WeakPolarHBondContact O-CG 3.35Å; L27-L31 PolarHBondContact O-N 3.43Å; I28-L31 PolarHBondContact O-N 2.94Å; V29-L31 PolarHBondContact O-N 3.29Å; L31-L33 PolarHBondContact O-N 2.89Å; L31-Y34 PolarHBondContact O-N 2.99Å; L31-V35 WeakPolarHBondContact O-CG2 3.4Å; L31-V35 PolarHBondContact O-N 3.43Å
32	C	94.5	Very high	91.8	Very high	78 Å²	78	98.2 Å²	98.2	53%	0.527	53%	0.532	S	S	.	.	H	α-helix	trans	-61.4	-44.6	176.4	-71.4	0	0	0	0	111.7	I28 V29 V35 K36	I28-C32 WeakPolarHBondContact O-CB 3.32Å; I28-C32 PolarHBondContact O-N 3.3Å; I28-C32 PolarHBondContact O-SG 2.94Å; V29-C32 PolarHBondContact O-N 3.47Å; C32-V35 PolarHBondContact O-N 3.08Å; C32-K36 WeakPolarHBondContact O-CB 3.36Å; C32-K36 PolarHBondContact O-N 3.39Å
33	L	94.8	Very high	90.7	Very high	99 Å²	99	99.3 Å²	99.3	52%	0.518	54%	0.541	S	S	.	.	H	α-helix	trans	-63.6	-43.2	175.6	-70.9	176	0	0	0	111	V29 V30 L31 V35 K36 V37	V29-L33 HydrophobicContact CG1-CD1 4Å; V29-L33 HydrophobicContact CG1-CG 4.39Å; V29-L33 WeakPolarHBondContact O-CB 3.29Å; V29-L33 VanDerWaalsContact O-CG 3.29Å; V29-L33 WeakPolarHBondContact O-CG 3.28Å; V29-L33 PolarHBondContact O-N 2.92Å; V30-L33 PolarHBondContact O-N 3.1Å; L31-L33 PolarHBondContact O-N 2.89Å; L33-V35 PolarHBondContact O-N 3.16Å; L33-K36 PolarHBondContact O-N 3.49Å; L33-V37 WeakPolarHBondContact O-CB 3.34Å; L33-V37 VanDerWaalsContact O-CG2 3.28Å; L33-V37 WeakPolarHBondContact O-CG2 3.32Å; L33-V37 PolarHBondContact O-N 3.5Å
34	Y	93.9	Very high	89.5	Confident	168 Å²	168	100.9 Å²	100.9	66%	0.659	55%	0.554	S	S	*	*	H	α-helix	trans	-59.5	-47.3	177.1	-176.6	-95.4	0	0	0	111.6	V30 L31 K36 V37 A38	V30-Y34 WeakPolarHBondContact O-CB 3.21Å; V30-Y34 PolarHBondContact O-N 2.93Å; L31-Y34 PolarHBondContact O-N 2.99Å; Y34-K36 PolarHBondContact O-N 2.94Å; Y34-V37 PolarHBondContact O-N 3.35Å; Y34-A38 WeakPolarHBondContact O-CB 3.34Å; Y34-A38 PolarHBondContact O-N 3.04Å
35	V	88.2	Confident	87.9	Confident	82 Å²	82	104.2 Å²	104.2	50%	0.497	57%	0.566	S	S	.	*	H	α-helix	trans	-63	-42.7	176.4	172	0	0	0	0	111	L31 C32 L33 A38 K39	L31-V35 WeakPolarHBondContact O-CG2 3.4Å; L31-V35 PolarHBondContact O-N 3.43Å; C32-V35 PolarHBondContact O-N 3.08Å; L33-V35 PolarHBondContact O-N 3.16Å; V35-A38 PolarHBondContact O-N 2.7Å; V35-K39 HydrophobicContact CG1-CG 4.28Å; V35-K39 WeakPolarHBondContact O-CB 3.47Å; V35-K39 WeakPolarHBondContact O-CG 3.37Å; V35-K39 PolarHBondContact O-N 2.86Å
36	K	91	Very high	85.7	Confident	154 Å²	154	106.1 Å²	106.1	67%	0.67	57%	0.573	S	S	*	*	H	α-helix	trans	-62.3	-45.3	178.8	-167.8	-175.1	179.3	95.5	0	111.4	C32 L33 Y34 K39 A40	C32-K36 WeakPolarHBondContact O-CB 3.36Å; C32-K36 PolarHBondContact O-N 3.39Å; L33-K36 PolarHBondContact O-N 3.49Å; Y34-K36 PolarHBondContact O-N 2.94Å; K36-K39 PolarHBondContact O-N 2.82Å; K36-A40 WeakPolarHBondContact O-CB 3.25Å; K36-A40 PolarHBondContact O-N 2.94Å
37	V	88.9	Confident	83.5	Confident	96 Å²	96	106.2 Å²	106.2	58%	0.582	58%	0.581	S	S	*	*	H	α-helix	trans	-67.3	-42.2	176.8	173.3	0	0	0	0	110.8	L33 Y34 K39 A40 L41	L33-V37 WeakPolarHBondContact O-CB 3.34Å; L33-V37 VanDerWaalsContact O-CG2 3.28Å; L33-V37 WeakPolarHBondContact O-CG2 3.32Å; L33-V37 PolarHBondContact O-N 3.5Å; Y34-V37 PolarHBondContact O-N 3.35Å; V37-K39 VanDerWaalsContact C-N 3.31Å; V37-K39 PolarHBondContact O-N 3.01Å; V37-A40 PolarHBondContact O-N 3.45Å; V37-L41 VanDerWaalsContact O-CB 3.24Å; V37-L41 WeakPolarHBondContact O-CB 3.4Å; V37-L41 PolarHBondContact O-N 3.05Å
38	A	85	Confident	81	Confident	33 Å²	33	108.4 Å²	108.4	27%	0.273	59%	0.593	S	S	.	*	H	α-helix	trans	-62.8	-38.5	176.6	0	0	0	0	0	111.9	Y34 V35 K42	Y34-A38 WeakPolarHBondContact O-CB 3.34Å; Y34-A38 PolarHBondContact O-N 3.04Å; V35-A38 PolarHBondContact O-N 2.7Å; A38-K42 WeakPolarHBondContact O-CB 3.4Å; A38-K42 WeakPolarHBondContact O-CG 3.45Å; A38-K42 PolarHBondContact O-N 2.91Å
39	K	82.1	Confident	78.4	Confident	149 Å²	149	107.8 Å²	107.8	65%	0.648	60%	0.603	S	S	*	*	H	α-helix	trans	-66.9	-44.7	174.1	-72.3	-75.5	-176.9	169.8	0	111.6	V35 K36 V37 K42 A43	V35-K39 HydrophobicContact CG1-CG 4.28Å; V35-K39 WeakPolarHBondContact O-CB 3.47Å; V35-K39 WeakPolarHBondContact O-CG 3.37Å; V35-K39 PolarHBondContact O-N 2.86Å; K36-K39 PolarHBondContact O-N 2.82Å; V37-K39 VanDerWaalsContact C-N 3.31Å; V37-K39 PolarHBondContact O-N 3.01Å; K39-K42 PolarHBondContact O-N 3.1Å; K39-A43 PolarHBondContact O-N 3.48Å
40	A	84.8	Confident	76.3	Confident	61 Å²	61	111.4 Å²	111.4	50%	0.504	63%	0.625	S	S	.	*	H	α-helix	trans	-63.4	-41.3	176	0	0	0	0	0	112	K36 V37 A43 A44	K36-A40 WeakPolarHBondContact O-CB 3.25Å; K36-A40 PolarHBondContact O-N 2.94Å; V37-A40 PolarHBondContact O-N 3.45Å; A40-A43 PolarHBondContact O-N 3.14Å; A40-A44 WeakPolarHBondContact O-CB 3.47Å; A40-A44 PolarHBondContact O-N 3.18Å
41	L	80.4	Confident	74	Confident	115 Å²	115	111 Å²	111	60%	0.602	63%	0.631	S	S	*	*	H	α-helix	trans	-66.3	-40.9	177.2	-175.4	68.4	0	0	0	111.6	V37 A44 K45	V37-L41 VanDerWaalsContact O-CB 3.24Å; V37-L41 WeakPolarHBondContact O-CB 3.4Å; V37-L41 PolarHBondContact O-N 3.05Å; L41-A44 PolarHBondContact O-N 2.86Å; L41-K45 WeakPolarHBondContact O-CB 3.5Å; L41-K45 PolarHBondContact O-N 3.43Å
42	K	78.7	Confident	71.3	Confident	152 Å²	152	112.3 Å²	112.3	66%	0.661	64%	0.644	S	S	*	*	H	α-helix	trans	-61.1	-46.3	172.9	-79.8	-170.1	176.4	-167.4	0	111.3	A38 K39 A44 K45 D46	A38-K42 WeakPolarHBondContact O-CB 3.4Å; A38-K42 WeakPolarHBondContact O-CG 3.45Å; A38-K42 PolarHBondContact O-N 2.91Å; K39-K42 PolarHBondContact O-N 3.1Å; K42-A44 VanDerWaalsContact C-N 3.31Å; K42-A44 PolarHBondContact O-N 2.93Å; K42-K45 PolarHBondContact O-N 2.95Å; K42-D46 PolarHBondContact O-N 3.24Å
43	A	73.2	Confident	69	Low	73 Å²	73	118.1 Å²	118.1	60%	0.603	66%	0.66	S	S	*	*	H	α-helix	trans	-63.4	-35.3	177	0	0	0	0	0	112.9	K39 A40 K45	K39-A43 PolarHBondContact O-N 3.48Å; A40-A43 PolarHBondContact O-N 3.14Å; A43-K45 VanDerWaalsContact C-N 3.35Å
44	A	71.9	Confident	66.1	Low	79 Å²	79	121.8 Å²	121.8	65%	0.653	67%	0.674	S	S	*	*	H	α-helix	trans	-75.3	-22.1	177.3	0	0	0	0	0	113.5	A40 L41 K42	A40-A44 WeakPolarHBondContact O-CB 3.47Å; A40-A44 PolarHBondContact O-N 3.18Å; L41-A44 PolarHBondContact O-N 2.86Å; K42-A44 VanDerWaalsContact C-N 3.31Å; K42-A44 PolarHBondContact O-N 2.93Å
45	K	64.6	Low	63.3	Low	173 Å²	173	121.2 Å²	121.2	75%	0.752	68%	0.677	S	S	*	*	H	α-helix	trans	-89	-7.7	179	-142.3	178.8	79.7	157.7	0	113.8	L41 K42 A43 P47	L41-K45 WeakPolarHBondContact O-CB 3.5Å; L41-K45 PolarHBondContact O-N 3.43Å; K42-K45 PolarHBondContact O-N 2.95Å; A43-K45 VanDerWaalsContact C-N 3.35Å; K45-P47 WeakPolarHBondContact O-CD 3.48Å
46	D	51.2	Low	60.6	Low	119 Å²	119	121 Å²	121	64%	0.636	68%	0.679	S	S	*	*			trans	-105.9	74	169.8	-81.2	-53.4	0	0	0	110.7	K42 D48	K42-D46 PolarHBondContact O-N 3.24Å; D46-D48 PolarHBondContact O-N 3.06Å
47	P	50.7	Low	58.2	Low	119 Å²	119	120 Å²	120	77%	0.773	69%	0.688	S	S	*	*			trans	-82	14.5	167.5	33.7	-33.7	0	0	0	113.7	K45	K45-P47 WeakPolarHBondContact O-CD 3.48Å
48	D	43.6	Very low	55.8	Low	150 Å²	150	119 Å²	119	80%	0.802	68%	0.68	S	S	*	*	S	Bend	trans	-150.6	77.6	-179.6	-144.1	-43.4	0	0	0	112.9	D46	D46-D48 PolarHBondContact O-N 3.06Å
49	A	40.7	Very low	53.5	Low	87 Å²	87	125.1 Å²	125.1	72%	0.719	70%	0.7	S	S	*	*			trans	-167.3	61.3	157.9	0	0	0	0	0	110.2
50	V	54.1	Low	51.3	Low	148 Å²	148	123.1 Å²	123.1	90%	0.897	70%	0.7	S	S	*	*			trans	-79.5	121.2	156.9	-179.6	0	0	0	0	107
51	A	48.1	Very low	48.7	Very low	85 Å²	85	131.2 Å²	131.2	70%	0.702	72%	0.718	S	S	*	*			trans	77.7	102.9	170.9	0	0	0	0	0	117.2
52	V	38	Very low	46.6	Very low	139 Å²	139	136.2 Å²	136.2	84%	0.842	73%	0.729	S	S	*	*				-176	125.8	102.2	150.6	0	0	0	0	110	H54	V52-H54 PolarHBondContact O-N 3.41Å
53	K	46.3	Very low	44.4	Very low	199 Å²	199	132.5 Å²	132.5	87%	0.865	73%	0.726	S	S	*	*			trans	-29.7	118.7	160	-156.4	-168.9	-168.3	-167.1	0	114.4
54	H	33.2	Very low	42.5	Very low	177 Å²	177	139.2 Å²	139.2	82%	0.819	74%	0.742	S	S	*	*			trans	-164.9	96.9	147.6	-128.9	-103.9	0	0	0	109.2	V52	V52-H54 PolarHBondContact O-N 3.41Å
55	H	33.8	Very low	41.1	Very low	156 Å²	156	142.6 Å²	142.6	72%	0.722	75%	0.749	S	S	*	*				74.3	100.3	97.3	-156.4	-60.3	0	0	0	114.5
56	S	32.6	Very low	39.7	Very low	76 Å²	76	139.5 Å²	139.5	53%	0.531	75%	0.75	S	S	.	*			trans	63.7	132.3	160	-62.2	0	0	0	0	121.3
57	P	39.3	Very low	39.2	Very low	133 Å²	133	143.4 Å²	143.4	86%	0.864	76%	0.764	S	S	*	*			trans	-117.3	79.5	138.7	36.1	-22.3	0	0	0	108.4
58	D	39	Very low	38.3	Very low	75 Å²	75	141.8 Å²	141.8	40%	0.401	76%	0.76	S	S	.	*			trans	-127.9	98.5	158.1	-112.6	-41	0	0	0	107	Y76 S78	D58-Y76 HydrophobicContact CB-CE1 4.5Å; D58-Y76 WeakPolarHBondContact OD2-CE1 3.37Å; D58-S78 WeakPolarHBondContact OD2-CB 3.46Å
59	K	37.8	Very low	37.8	Very low	162 Å²	162	143.6 Å²	143.6	70%	0.704	76%	0.761	S	S	*	*			trans	-178.7	108.3	133.6	-92	160.6	-158.3	-137.2	0	111.2
60	V	35.7	Very low	37.2	Very low	107 Å²	107	146 Å²	146	65%	0.648	76%	0.762	S	S	*	*				72.4	108.5	128.4	-173.1	0	0	0	0	119
61	W	29.8	Very low	36.2	Very low	231 Å²	231	144.5 Å²	144.5	88%	0.875	75%	0.753	S	S	*	*				-145.3	96.2	118.2	-174.4	-88.5	0	0	0	109.7	A63	W61-A63 PolarHBondContact NE1-O 3.04Å
62	W	35.5	Very low	35.5	Very low	220 Å²	220	146.7 Å²	146.7	83%	0.833	76%	0.758	S	S	*	*			trans	-76.4	151.3	163.5	-64.6	86.9	0	0	0	109.6
63	A	32.5	Very low	35.1	Very low	74 Å²	74	148.3 Å²	148.3	61%	0.612	76%	0.758	S	S	*	*			trans	85.9	105.6	162.5	0	0	0	0	0	118.6	W61	W61-A63 PolarHBondContact NE1-O 3.04Å
64	K	35.1	Very low	34.3	Very low	214 Å²	214	146.7 Å²	146.7	93%	0.93	75%	0.754	S	S	*	*	S	Bend		-150.4	68.9	118.3	-159.7	-179.8	-177.7	-174.9	0	112
65	N	41.5	Very low	34.2	Very low	151 Å²	151	143.9 Å²	143.9	81%	0.807	75%	0.754	S	S	*	*	S	Bend	trans	-161.9	56.1	146.2	67.3	-5	0	0	0	113.1
66	S	36.1	Very low	34.3	Very low	108 Å²	108	143.2 Å²	143.2	76%	0.755	75%	0.746	S	S	*	*			trans	-170.4	106.5	145.9	35.8	0	0	0	0	109.9	A68	S66-A68 PolarHBondContact O-N 3.34Å
67	Q	40.1	Very low	34.6	Very low	200 Å²	200	145.1 Å²	145.1	94%	0.935	76%	0.757	S	S	*	*			trans	-69.5	108.6	156.1	173.5	-165.3	89.5	0	0	106.6
68	A	31.1	Very low	34.5	Very low	85 Å²	85	141.9 Å²	141.9	70%	0.702	74%	0.738	S	S	*	*			trans	-172.4	94.2	149.7	0	0	0	0	0	109.9	S66	S66-A68 PolarHBondContact O-N 3.34Å
69	K	33.7	Very low	34.5	Very low	189 Å²	189	146.6 Å²	146.6	82%	0.822	76%	0.762	S	S	*	*			trans	47.7	133.6	137.9	-64.9	-164.4	173.3	-156.2	0	121.5
70	D	28.5	Very low	34.5	Very low	137 Å²	137	147.7 Å²	147.7	73%	0.733	77%	0.769	S	S	*	*			trans	101	96.6	142.8	-60.9	-21.1	0	0	0	119.6
71	T	31.5	Very low	34.5	Very low	117 Å²	117	148.3 Å²	148.3	72%	0.718	78%	0.777	S	S	*	*				65.6	114.5	125.4	-5	0	0	0	0	120.9
72	T	34.2	Very low	35	Very low	130 Å²	130	143.1 Å²	143.1	80%	0.798	78%	0.775	S	S	*	*			trans	55.2	118.1	140.7	-54.6	0	0	0	0	119.2
73	M	28.8	Very low	35.3	Very low	173 Å²	173	142.5 Å²	142.5	85%	0.852	78%	0.781	S	S	*	*				165.6	108.5	122.2	-171.6	158	-177.2	0	0	111.2
74	E	31	Very low	35.9	Very low	166 Å²	166	142.2 Å²	142.2	78%	0.776	79%	0.785	S	S	*	*			trans	38.2	122.6	134.1	-53.7	-63.9	103.6	0	0	121
75	S	31.1	Very low	36.1	Very low	117 Å²	117	138.6 Å²	138.6	82%	0.818	79%	0.785	S	S	*	*			trans	74.5	120.3	137.3	-152.9	0	0	0	0	120.2
76	Y	36.1	Very low	36.2	Very low	143 Å²	143	142.1 Å²	142.1	56%	0.561	79%	0.787	S	S	*	*			trans	-122.3	141.4	172.7	-163.2	-95.2	0	0	0	108.6	D58	D58-Y76 HydrophobicContact CB-CE1 4.5Å; D58-Y76 WeakPolarHBondContact OD2-CE1 3.37Å
77	P	38.7	Very low	36.2	Very low	116 Å²	116	145.1 Å²	145.1	75%	0.753	79%	0.791	S	S	*	*				-139.8	157.2	128.2	29.6	-10.8	0	0	0	115.4
78	S	35.8	Very low	36.3	Very low	65 Å²	65	147.2 Å²	147.2	46%	0.455	79%	0.792	S	S	.	*			trans	-64.2	142.1	-173.9	53.5	0	0	0	0	117.6	D58	D58-S78 WeakPolarHBondContact OD2-CB 3.46Å
79	L	40.3	Very low	36.4	Very low	173 Å²	173	146.4 Å²	146.4	91%	0.906	79%	0.793	S	S	*	*			trans	-130	124.2	166.7	-141.3	152.9	0	0	0	110.2
80	Q	37.6	Very low	36.9	Very low	185 Å²	185	143 Å²	143	86%	0.864	79%	0.793	S	S	*	*			trans	-69.3	131.7	-171.2	-64.6	-167.5	-6.3	0	0	112.5
81	C	36.5	Very low	37.2	Very low	121 Å²	121	142 Å²	142	82%	0.818	80%	0.795	S	S	*	*			trans	-78.6	123	179.9	-168.9	0	0	0	0	110.7	E83	C81-E83 PolarHBondContact O-N 3.5Å; C81-E83 VanDerWaalsContact O-N 3.15Å
82	C	38.5	Very low	38.1	Very low	121 Å²	121	144.5 Å²	144.5	82%	0.818	80%	0.804	S	S	*	*			trans	-60.7	109.7	174.2	-81	0	0	0	0	111.6	G84	C82-G84 VanDerWaalsContact C-N 3.25Å; C82-G84 PolarHBondContact O-N 3Å
83	E	42	Very low	38.3	Very low	208 Å²	208	143 Å²	143	97%	0.972	81%	0.805	S	S	*	*	S	Bend	trans	-80.8	68.6	174.3	-162.8	141.1	176.8	0	0	110.7	C81	C81-E83 PolarHBondContact O-N 3.5Å; C81-E83 VanDerWaalsContact O-N 3.15Å
84	G	45	Very low	39	Very low	68 Å²	68	142.8 Å²	142.8	70%	0.701	81%	0.806	S	S	*	*			trans	-163.9	17.4	-173.7	0	0	0	0	0	117.6	C82	C82-G84 VanDerWaalsContact C-N 3.25Å; C82-G84 PolarHBondContact O-N 3Å
85	C	39.4	Very low	39.9	Very low	137 Å²	137	140.3 Å²	140.3	93%	0.926	81%	0.805	S	S	*	*			trans	-126.8	89.5	176.8	-105.8	0	0	0	0	111.9
86	R	43.4	Very low	40.5	Very low	226 Å²	226	140.4 Å²	140.4	85%	0.853	80%	0.802	S	S	*	*			trans	-114.8	108.1	167.1	-172.3	-175.9	171.5	105.4	2.2	107.2
87	M	37.5	Very low	40.7	Very low	171 Å²	171	139.5 Å²	139.5	84%	0.842	82%	0.815	S	S	*	*			trans	-174.2	139.9	135	-87.4	-38.1	161	0	0	110.1
88	Y	41.6	Very low	41.1	Very low	243 Å²	243	139.6 Å²	139.6	95%	0.953	82%	0.818	S	S	*	*			trans	-70.4	132.9	175.5	-129.7	-101	0	0	0	110
89	G	34	Very low	41.4	Very low	69 Å²	69	143 Å²	143	71%	0.711	84%	0.84	S	S	*	*			trans	-178	116.7	170.5	0	0	0	0	0	110.8
90	S	42.5	Very low	41.6	Very low	118 Å²	118	140.7 Å²	140.7	83%	0.825	83%	0.828	S	S	*	*			trans	-67.8	162.1	173.5	-168.7	0	0	0	0	111.3
91	C	35.1	Very low	41.6	Very low	115 Å²	115	138.1 Å²	138.1	78%	0.777	83%	0.826	S	S	*	*	S	Bend	trans	99.7	127	170.5	-56.2	0	0	0	0	116.4
92	D	50.2	Low	41.9	Very low	169 Å²	169	137 Å²	137	90%	0.904	81%	0.811	S	S	*	*			trans	-32.2	120.7	-177.9	-60.4	-88	0	0	0	117.2
93	A	39.6	Very low	42.2	Very low	99 Å²	99	139.7 Å²	139.7	82%	0.818	81%	0.812	S	S	*	*			trans	-162.4	127.8	150.2	0	0	0	0	0	111.4
94	L	43.5	Very low	42.2	Very low	169 Å²	169	133.5 Å²	133.5	89%	0.885	80%	0.804	S	S	*	*			trans	-67	170.9	169.4	-85.4	164.9	0	0	0	112.1
95	P	49.2	Very low	41.6	Very low	114 Å²	114	142.3 Å²	142.3	74%	0.74	83%	0.834	S	S	*	*			trans	-94.9	158.1	-139.7	38.5	-36	0	0	0	114.6
96	P	43.4	Very low	41.7	Very low	118 Å²	118	142.6 Å²	142.6	77%	0.766	83%	0.829	S	S	*	*			trans	-136.2	150	147.7	35.7	-20.6	0	0	0	111.2
97	C	41.4	Very low	41.6	Very low	124 Å²	124	138.2 Å²	138.2	84%	0.838	83%	0.828	S	S	*	*			cis	-156.9	145.6	17.6	-131.3	0	0	0	0	109.1
98	C	46.3	Very low	41.8	Very low	119 Å²	119	136.3 Å²	136.3	80%	0.804	83%	0.827	S	S	*	*			trans	-63.3	136.8	169.3	-60.1	0	0	0	0	111.4
99	C	42.1	Very low	41.9	Very low	136 Å²	136	130.1 Å²	130.1	92%	0.919	82%	0.82	S	S	*	*			trans	-110.1	89.5	149.1	-72.6	0	0	0	0	106.9
100	D	44.8	Very low	42.4	Very low	124 Å²	124	133.9 Å²	133.9	66%	0.663	83%	0.826	S	S	*	*			trans	-83.6	123.1	161.7	-163.9	-68.2	0	0	0	107.4	N102	D100-N102 PolarHBondContact OD1-OD1 2.97Å
101	T	36.9	Very low	42.3	Very low	132 Å²	132	134.9 Å²	134.9	81%	0.81	83%	0.826	S	S	*	*			trans	-151.5	84.1	155.1	-38.2	0	0	0	0	105.9
102	N	43	Very low	42.9	Very low	96 Å²	96	136.4 Å²	136.4	51%	0.513	83%	0.83	S	S	.	*			trans	-31.4	140.3	131.4	55.3	-40.2	0	0	0	109.2	D100	D100-N102 PolarHBondContact OD1-OD1 2.97Å
103	E	45	Very low	42.3	Very low	179 Å²	179	133.8 Å²	133.8	84%	0.836	82%	0.824	S	S	*	*				-172.4	135.5	77.9	-32.1	-161.7	116.4	0	0	103.9
104	G	41.8	Very low	42.5	Very low	78 Å²	78	136.8 Å²	136.8	80%	0.804	83%	0.825	S	S	*	*				112.4	101.9	66.8	0	0	0	0	0	110.1
105	L	32.9	Very low	42.4	Very low	252 Å²	252	133.8 Å²	133.8	100%	1.319	82%	0.819	S	S	*	*				165.4	0	125.1	-166.2	65.9	0	0	0	110.9

Retrieved 105 of 105 residues in 62.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).