A0A096NV13_PAPAN Loading...

Beta-defensin

Has antibacterial activity.

AlphaFold DB , UniProt , Accession A0A096NV13, Species PAPAN (Papio anubis, Olive baboon), Gene DEFB123, Length 67 aa.

						>A0A096NV13_PAPAN|A0A096NV13|DEFB123
MKLLLLTLTVLLLLSQLTPGGTQRCWNLYGKCRHRCSKKERVYVYCLNNKMCCVKPRYQPKEKWWPF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.6	Low	82	Confident	191 Å²	191	118.7 Å²	118.7	94%	0.941	62%	0.621	S	S	*	*				0	-49.7	0	-55.2	-47.7	-178.9	0	0	113.8	L3 L4 L5	M1-L3 PolarHBondContact O-N 3.3Å; M1-L4 PolarHBondContact O-N 3.29Å; M1-L5 PolarHBondContact O-N 3.3Å
2	K	76.1	Confident	81.9	Confident	178 Å²	178	116.6 Å²	116.6	77%	0.774	61%	0.609	S	S	*	*	H	α-helix	trans	-61.5	-37	-177.5	-80	172.8	172	-178.5	0	115.4	L5 L6	K2-L5 PolarHBondContact O-N 3.48Å; K2-L6 PolarHBondContact O-N 3.4Å; K2-L6 VanDerWaalsContact O-N 3.11Å
3	L	81.6	Confident	81.5	Confident	139 Å²	139	115.8 Å²	115.8	73%	0.728	61%	0.605	S	S	*	*	H	α-helix	trans	-64.7	-39.8	179	-76.9	164.2	0	0	0	112.8	M1 L5 L6 T7	M1-L3 PolarHBondContact O-N 3.3Å; L3-L5 VanDerWaalsContact C-N 3.34Å; L3-L5 PolarHBondContact O-N 3.43Å; L3-L6 PolarHBondContact O-N 3.48Å; L3-T7 WeakPolarHBondContact O-CG2 3.38Å; L3-T7 PolarHBondContact O-N 2.73Å; L3-T7 PolarHBondContact O-OG1 3.02Å
4	L	83.4	Confident	80.6	Confident	123 Å²	123	114.6 Å²	114.6	64%	0.644	60%	0.599	S	S	*	*	H	α-helix	trans	-64.5	-40.2	178.8	-71	170.2	0	0	0	111.9	M1 T7 L8	M1-L4 PolarHBondContact O-N 3.29Å; L4-T7 VanDerWaalsContact CA-OG1 3.32Å; L4-T7 WeakPolarHBondContact CA-OG1 3.47Å; L4-T7 PolarHBondContact O-N 2.97Å; L4-T7 PolarHBondContact O-OG1 3.26Å; L4-L8 WeakPolarHBondContact O-CB 3.39Å; L4-L8 PolarHBondContact O-N 3.27Å
5	L	84.8	Confident	79.5	Confident	113 Å²	113	111.6 Å²	111.6	59%	0.592	59%	0.592	S	S	*	*	H	α-helix	trans	-62.7	-45	174.3	-84.3	150.6	0	0	0	111.3	M1 K2 L3 L8 T9	M1-L5 PolarHBondContact O-N 3.3Å; K2-L5 PolarHBondContact O-N 3.48Å; L3-L5 VanDerWaalsContact C-N 3.34Å; L3-L5 PolarHBondContact O-N 3.43Å; L5-L8 PolarHBondContact O-N 3.49Å; L5-T9 WeakPolarHBondContact O-CG2 3.42Å; L5-T9 PolarHBondContact O-N 3.26Å; L5-T9 PolarHBondContact O-OG1 3.38Å
6	L	85.4	Confident	78.5	Confident	104 Å²	104	113.8 Å²	113.8	55%	0.545	60%	0.598	S	S	.	*	H	α-helix	trans	-60.9	-48	176.4	-80.8	160.9	0	0	0	111.6	K2 L3 L8 T9 V10	K2-L6 PolarHBondContact O-N 3.4Å; K2-L6 VanDerWaalsContact O-N 3.11Å; L3-L6 PolarHBondContact O-N 3.48Å; L6-L8 VanDerWaalsContact C-N 3.27Å; L6-L8 PolarHBondContact O-N 3.03Å; L6-T9 WeakPolarHBondContact CA-OG1 3.37Å; L6-T9 PolarHBondContact O-N 3.11Å; L6-T9 PolarHBondContact O-OG1 3.16Å; L6-V10 WeakPolarHBondContact O-CG2 3.47Å; L6-V10 PolarHBondContact O-N 3.41Å
7	T	85.9	Confident	77.3	Confident	84 Å²	84	114.9 Å²	114.9	52%	0.515	60%	0.603	S	S	.	*	H	α-helix	trans	-60.4	-38.1	177.4	49.6	0	0	0	0	112.3	L3 L4 V10 L11	L3-T7 WeakPolarHBondContact O-CG2 3.38Å; L3-T7 PolarHBondContact O-N 2.73Å; L3-T7 PolarHBondContact O-OG1 3.02Å; L4-T7 VanDerWaalsContact CA-OG1 3.32Å; L4-T7 WeakPolarHBondContact CA-OG1 3.47Å; L4-T7 PolarHBondContact O-N 2.97Å; L4-T7 PolarHBondContact O-OG1 3.26Å; T7-V10 PolarHBondContact O-N 2.75Å; T7-L11 WeakPolarHBondContact O-CB 3.47Å; T7-L11 PolarHBondContact O-N 3.02Å
8	L	85.4	Confident	75.8	Confident	102 Å²	102	113.4 Å²	113.4	53%	0.534	60%	0.6	S	S	.	*	H	α-helix	trans	-67.1	-44.1	178.5	-165.4	74.8	0	0	0	111.5	L4 L5 L6 V10 L11 L12	L4-L8 WeakPolarHBondContact O-CB 3.39Å; L4-L8 PolarHBondContact O-N 3.27Å; L5-L8 PolarHBondContact O-N 3.49Å; L6-L8 VanDerWaalsContact C-N 3.27Å; L6-L8 PolarHBondContact O-N 3.03Å; L8-V10 VanDerWaalsContact C-N 3.35Å; L8-V10 PolarHBondContact O-N 2.92Å; L8-L11 PolarHBondContact O-N 3.32Å; L8-L12 HydrophobicContact CG-CD1 4.12Å; L8-L12 WeakPolarHBondContact O-CB 3.36Å; L8-L12 PolarHBondContact O-N 3.23Å
9	T	86.1	Confident	74.5	Confident	72 Å²	72	113.6 Å²	113.6	44%	0.442	61%	0.608	S	S	.	*	H	α-helix	trans	-62.3	-40.8	177	54.8	0	0	0	0	112.5	L5 L6 L12 L13	L5-T9 WeakPolarHBondContact O-CG2 3.42Å; L5-T9 PolarHBondContact O-N 3.26Å; L5-T9 PolarHBondContact O-OG1 3.38Å; L6-T9 WeakPolarHBondContact CA-OG1 3.37Å; L6-T9 PolarHBondContact O-N 3.11Å; L6-T9 PolarHBondContact O-OG1 3.16Å; T9-L12 PolarHBondContact O-N 2.97Å; T9-L13 PolarHBondContact O-N 3.43Å
10	V	87.1	Confident	73.4	Confident	80 Å²	80	111.3 Å²	111.3	49%	0.485	61%	0.613	S	S	.	*	H	α-helix	trans	-64.7	-42.7	176	172.4	0	0	0	0	110.9	L6 T7 L8 L12 L13 L14	L6-V10 WeakPolarHBondContact O-CG2 3.47Å; L6-V10 PolarHBondContact O-N 3.41Å; T7-V10 PolarHBondContact O-N 2.75Å; L8-V10 VanDerWaalsContact C-N 3.35Å; L8-V10 PolarHBondContact O-N 2.92Å; V10-L12 PolarHBondContact O-N 3.34Å; V10-L13 PolarHBondContact O-N 3.13Å; V10-L14 HydrophobicContact CG1-CD1 3.75Å; V10-L14 WeakPolarHBondContact O-CD1 3.34Å; V10-L14 WeakPolarHBondContact O-CG 3.16Å; V10-L14 PolarHBondContact O-N 2.97Å
11	L	83.5	Confident	72.7	Confident	120 Å²	120	109.2 Å²	109.2	63%	0.628	62%	0.616	S	S	*	*	H	α-helix	trans	-62.7	-41.6	177.2	-132.3	77.2	0	0	0	112.6	T7 L8 L14 S15	T7-L11 WeakPolarHBondContact O-CB 3.47Å; T7-L11 PolarHBondContact O-N 3.02Å; L8-L11 PolarHBondContact O-N 3.32Å; L11-L14 PolarHBondContact O-N 3.49Å; L11-S15 PolarHBondContact O-N 3.48Å; L11-S15 VanDerWaalsContact O-N 3.13Å; L11-S15 PolarHBondContact O-OG 3.28Å
12	L	80.7	Confident	73.1	Confident	93 Å²	93	102.8 Å²	102.8	49%	0.487	59%	0.588	S	S	.	*	H	α-helix	trans	-66.4	-34.5	176.4	-89.3	151.6	0	0	0	112.8	L8 T9 V10 S15 Q16	L8-L12 HydrophobicContact CG-CD1 4.12Å; L8-L12 WeakPolarHBondContact O-CB 3.36Å; L8-L12 PolarHBondContact O-N 3.23Å; T9-L12 PolarHBondContact O-N 2.97Å; V10-L12 PolarHBondContact O-N 3.34Å; L12-S15 PolarHBondContact O-OG 3.47Å; L12-Q16 WeakPolarHBondContact O-CG 3.38Å; L12-Q16 PolarHBondContact O-NE2 3.48Å
13	L	76.9	Confident	73.7	Confident	106 Å²	106	98.3 Å²	98.3	56%	0.555	57%	0.57	S	S	*	*	H	α-helix	trans	-69.7	-42.4	173.1	-107.1	75.1	0	0	0	111.5	T9 V10 S15 Q16 L17	T9-L13 PolarHBondContact O-N 3.43Å; V10-L13 PolarHBondContact O-N 3.13Å; L13-S15 VanDerWaalsContact C-N 3.34Å; L13-S15 PolarHBondContact O-N 3.42Å; L13-Q16 PolarHBondContact O-N 2.79Å; L13-L17 WeakPolarHBondContact O-CG 3.32Å; L13-L17 PolarHBondContact O-N 3.12Å
14	L	69.3	Low	74.1	Confident	100 Å²	100	99.1 Å²	99.1	52%	0.524	56%	0.563	S	S	.	*	H	α-helix	trans	-63.9	-36.9	-179	-77.1	158.2	0	0	0	112.7	V10 L11 Q16 L17 T18	V10-L14 HydrophobicContact CG1-CD1 3.75Å; V10-L14 WeakPolarHBondContact O-CD1 3.34Å; V10-L14 WeakPolarHBondContact O-CG 3.16Å; V10-L14 PolarHBondContact O-N 2.97Å; L11-L14 PolarHBondContact O-N 3.49Å; L14-Q16 VanDerWaalsContact C-N 3.33Å; L14-Q16 PolarHBondContact O-N 3Å; L14-L17 PolarHBondContact O-N 3.29Å; L14-T18 PolarHBondContact O-N 3.19Å; L14-T18 VanDerWaalsContact O-N 3.12Å
15	S	63.9	Low	74.5	Confident	69 Å²	69	94.1 Å²	94.1	48%	0.483	54%	0.538	S	S	.	.	H	α-helix	trans	-68.6	-29.6	176.5	57	0	0	0	0	113.1	L11 L12 L13 T18	L11-S15 PolarHBondContact O-N 3.48Å; L11-S15 VanDerWaalsContact O-N 3.13Å; L11-S15 PolarHBondContact O-OG 3.28Å; L12-S15 PolarHBondContact O-OG 3.47Å; L13-S15 VanDerWaalsContact C-N 3.34Å; L13-S15 PolarHBondContact O-N 3.42Å; S15-T18 PolarHBondContact O-OG1 3.38Å
16	Q	63.4	Low	74.9	Confident	147 Å²	147	92.9 Å²	92.9	69%	0.687	53%	0.526	S	S	*	.	H	α-helix	trans	-74.1	-30.5	173.3	-65.2	175.2	39.3	0	0	112.6	L12 L13 L14	L12-Q16 WeakPolarHBondContact O-CG 3.38Å; L12-Q16 PolarHBondContact O-NE2 3.48Å; L13-Q16 PolarHBondContact O-N 2.79Å; L14-Q16 VanDerWaalsContact C-N 3.33Å; L14-Q16 PolarHBondContact O-N 3Å
17	L	57.7	Low	75.2	Confident	132 Å²	132	94.4 Å²	94.4	69%	0.691	53%	0.534	S	S	*	.	H	α-helix	trans	-84.5	-16.3	-178.7	-69.8	171.5	0	0	0	113.8	L13 L14 P19	L13-L17 WeakPolarHBondContact O-CG 3.32Å; L13-L17 PolarHBondContact O-N 3.12Å; L14-L17 PolarHBondContact O-N 3.29Å; L17-P19 WeakPolarHBondContact O-CD 3.49Å
18	T	51.4	Low	75.5	Confident	89 Å²	89	95.7 Å²	95.7	55%	0.546	54%	0.538	S	S	.	.	S	Bend	trans	-71.5	108.9	163.9	40.2	0	0	0	0	106.7	L14 S15 G20	L14-T18 PolarHBondContact O-N 3.19Å; L14-T18 VanDerWaalsContact O-N 3.12Å; S15-T18 PolarHBondContact O-OG1 3.38Å; T18-G20 VanDerWaalsContact C-N 3.31Å; T18-G20 PolarHBondContact O-N 3.01Å
19	P	50.8	Low	75.9	Confident	116 Å²	116	96.4 Å²	96.4	75%	0.753	53%	0.534	S	S	*	.			trans	-64.6	102.8	178.8	8.8	1.3	0	0	0	105.1	L17 G21	L17-P19 WeakPolarHBondContact O-CD 3.49Å; P19-G21 WeakPolarHBondContact O-CA 2.85Å; P19-G21 PolarHBondContact O-N 2.98Å
20	G	52.7	Low	76.3	Confident	68 Å²	68	93.1 Å²	93.1	70%	0.701	52%	0.515	S	S	*	.			trans	-28.6	99.2	-163.2	0	0	0	0	0	110.2	T18 T22	T18-G20 VanDerWaalsContact C-N 3.31Å; T18-G20 PolarHBondContact O-N 3.01Å; G20-T22 WeakPolarHBondContact O-CA 3.49Å; G20-T22 PolarHBondContact O-N 3.02Å
21	G	58.1	Low	76.6	Confident	67 Å²	67	93.6 Å²	93.6	69%	0.691	51%	0.51	S	S	*	.			trans	-46.3	111	-158.7	0	0	0	0	0	108.2	P19 Q23	P19-G21 WeakPolarHBondContact O-CA 2.85Å; P19-G21 PolarHBondContact O-N 2.98Å; G21-Q23 PolarHBondContact O-N 3.44Å
22	T	70.7	Confident	77.1	Confident	57 Å²	57	88 Å²	88	35%	0.35	48%	0.481	S	S	.	.			trans	-53.6	110.2	-162	-46.8	0	0	0	0	108.5	G20 R24 K31 C32 R33	G20-T22 WeakPolarHBondContact O-CA 3.49Å; G20-T22 PolarHBondContact O-N 3.02Å; T22-R24 PolarHBondContact O-N 3.25Å; T22-R24 VanDerWaalsContact O-N 3.1Å; T22-K31 HydrophobicContact CG2-CB 3.84Å; T22-K31 HydrophobicContact CG2-CG 4.49Å; T22-C32 WeakPolarHBondContact CG2-O 2.96Å; T22-R33 HydrophobicContact CG2-CG 4.22Å
23	Q	87.9	Confident	77.6	Confident	83 Å²	83	88.1 Å²	88.1	39%	0.388	48%	0.475	S	S	.	.			trans	-47.5	122.9	-171.2	176.4	-178.8	-16.4	0	0	108.5	G21 C32 N48	G21-Q23 PolarHBondContact O-N 3.44Å; Q23-C32 HydrophobicContact CB-CB 4.07Å; Q23-C32 WeakPolarHBondContact O-CB 3.34Å; Q23-C32 PolarHBondContact O-N 2.02Å; Q23-C32 PolarHBondContact O-SG 3.07Å; Q23-N48 PolarHBondContact OE1-ND2 2.01Å
24	R	91.3	Very high	78.3	Confident	156 Å²	156	90 Å²	90	59%	0.589	48%	0.481	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.2	148	178.8	-68	-168.7	-173.8	-179.7	6.9	109.3	T22 L28 G30	T22-R24 PolarHBondContact O-N 3.25Å; T22-R24 VanDerWaalsContact O-N 3.1Å; R24-L28 HydrophobicContact CB-CD2 3.72Å; R24-L28 HydrophobicContact CG-CD2 4.4Å; R24-G30 WeakPolarHBondContact CA-O 3.2Å
25	C	92.4	Very high	79.4	Confident	18 Å²	18	95.5 Å²	95.5	12%	0.122	50%	0.495	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	171.5	-178.9	58.5	0	0	0	0	109.2	L28 Y29 G30 K31 C52	C25-L28 PolarHBondContact O-N 2.84Å; C25-Y29 PolarHBondContact O-N 3.41Å; C25-G30 PolarHBondContact N-O 3.45Å; C25-G30 VanDerWaalsContact N-O 3.07Å; C25-G30 WeakPolarHBondContact O-CA 3.48Å; C25-G30 PolarHBondContact O-N 3.25Å; C25-K31 PolarHBondContact SG-N 2.81Å; C25-C52 HydrophobicContact CB-CB 3.83Å; C25-C52 WeakPolarHBondContact CB-SG 3.41Å; C25-C52 WeakPolarHBondContact SG-CA 3.5Å; C25-C52 WeakPolarHBondContact SG-CB 2.98Å; C25-C52 CovalentContact SG-SG 2.01Å; C25-C52 PolarHBondContact SG-SG 2.94Å
26	W	92.9	Very high	80.8	Confident	88 Å²	88	93.5 Å²	93.5	33%	0.333	48%	0.48	S	S	.	.	T	Hydrogen-bonded Turn	trans	51.3	62.6	179.2	-166.7	-114.9	0	0	0	113.1	L28 Y29 Y43 V54 Y58 P60	W26-L28 PolarHBondContact O-N 2.88Å; W26-Y29 WeakPolarHBondContact O-CB 3.24Å; W26-Y29 WeakPolarHBondContact O-CD2 3.35Å; W26-Y29 PolarHBondContact O-N 2.92Å; W26-Y43 AromaticContact CD2-CD1 3.61Å; W26-Y43 HydrophobicContact CD2-CD1 3.61Å; W26-Y43 AromaticContact CD2-CE1 3.56Å; W26-Y43 HydrophobicContact CD2-CE1 3.56Å; W26-Y43 HydrophobicContact CD2-CG 4.42Å; W26-Y43 AromaticContact CE2-CE1 3.81Å; W26-Y43 AromaticContact CE2-CZ 4Å; W26-Y43 AromaticContact CE3-CD1 3.49Å; W26-Y43 HydrophobicContact CE3-CD1 3.49Å; W26-Y43 VanDerWaalsContact CE3-CD1 3.49Å; W26-Y43 AromaticContact CE3-CE1 3.12Å; W26-Y43 HydrophobicContact CE3-CE1 3.12Å; W26-Y43 HydrophobicContact CG-CD1 4.18Å; W26-Y43 HydrophobicContact CH2-CD1 4.35Å; W26-Y43 AromaticContact CH2-CE1 3.33Å; W26-Y43 HydrophobicContact CH2-CE1 3.33Å; W26-Y43 HydrophobicContact CH2-CE2 4.38Å; W26-Y43 AromaticContact CH2-CZ 3.31Å; W26-Y43 WeakPolarHBondContact CH2-OH 3.03Å; W26-Y43 HydrophobicContact CZ2-CD1 4.42Å; W26-Y43 AromaticContact CZ2-CE1 3.71Å; W26-Y43 HydrophobicContact CZ2-CE1 3.71Å; W26-Y43 HydrophobicContact CZ2-CE2 4.21Å; W26-Y43 AromaticContact CZ2-CZ 3.53Å; W26-Y43 WeakPolarHBondContact CZ2-OH 3.32Å; W26-Y43 AromaticContact CZ3-CD1 3.92Å; W26-Y43 HydrophobicContact CZ3-CD1 3.92Å; W26-Y43 AromaticContact CZ3-CE1 3.03Å; W26-Y43 HydrophobicContact CZ3-CE1 3.03Å; W26-Y43 AromaticContact CZ3-CZ 3.58Å; W26-V54 HydrophobicContact CB-CG2 3.82Å; W26-V54 HydrophobicContact CG-CG1 4.46Å; W26-V54 HydrophobicContact CG-CG2 4.01Å; W26-Y58 PolarHBondContact NE1-O 2.9Å; W26-P60 HydrophobicContact CH2-CG 4.49Å; W26-P60 HydrophobicContact CZ2-CG 4.04Å
27	N	91.4	Very high	82.2	Confident	135 Å²	135	89.7 Å²	89.7	72%	0.722	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.7	44.1	-177.5	-159.3	21.4	0	0	0	113.7	Y29	N27-Y29 HydrophobicContact CB-CD2 4.13Å; N27-Y29 HydrophobicContact CB-CE2 4.27Å; N27-Y29 WeakPolarHBondContact O-CD2 3.24Å; N27-Y29 PolarHBondContact O-N 2.8Å; N27-Y29 VanDerWaalsContact O-N 3.12Å
28	L	92.4	Very high	83.9	Confident	112 Å²	112	93.6 Å²	93.6	59%	0.586	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	67.4	2.2	-178.6	-45.3	176.5	0	0	0	116	R24 C25 W26 G30	R24-L28 HydrophobicContact CB-CD2 3.72Å; R24-L28 HydrophobicContact CG-CD2 4.4Å; C25-L28 PolarHBondContact O-N 2.84Å; W26-L28 PolarHBondContact O-N 2.88Å; L28-G30 VanDerWaalsContact C-N 3.32Å
29	Y	93.2	Very high	85.9	Confident	117 Å²	117	97.8 Å²	97.8	46%	0.459	49%	0.492	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.6	-12.4	175.8	-64	-65.6	0	0	0	113.6	C25 W26 N27 Y58	C25-Y29 PolarHBondContact O-N 3.41Å; W26-Y29 WeakPolarHBondContact O-CB 3.24Å; W26-Y29 WeakPolarHBondContact O-CD2 3.35Å; W26-Y29 PolarHBondContact O-N 2.92Å; N27-Y29 HydrophobicContact CB-CD2 4.13Å; N27-Y29 HydrophobicContact CB-CE2 4.27Å; N27-Y29 WeakPolarHBondContact O-CD2 3.24Å; N27-Y29 PolarHBondContact O-N 2.8Å; N27-Y29 VanDerWaalsContact O-N 3.12Å; Y29-Y58 AromaticContact CD1-CD1 3.42Å; Y29-Y58 HydrophobicContact CD1-CD1 3.42Å; Y29-Y58 VanDerWaalsContact CD1-CD1 3.42Å; Y29-Y58 AromaticContact CD1-CD2 3.9Å; Y29-Y58 HydrophobicContact CD1-CD2 3.9Å; Y29-Y58 AromaticContact CD1-CE1 3.47Å; Y29-Y58 HydrophobicContact CD1-CE1 3.47Å; Y29-Y58 VanDerWaalsContact CD1-CE1 3.47Å; Y29-Y58 AromaticContact CD1-CE2 3.93Å; Y29-Y58 HydrophobicContact CD1-CE2 3.93Å; Y29-Y58 AromaticContact CD1-CG 3.65Å; Y29-Y58 HydrophobicContact CD1-CG 3.65Å; Y29-Y58 AromaticContact CD1-CZ 3.71Å; Y29-Y58 AromaticContact CE1-CD1 3.68Å; Y29-Y58 HydrophobicContact CE1-CD1 3.68Å; Y29-Y58 AromaticContact CE1-CE1 3.48Å; Y29-Y58 HydrophobicContact CE1-CE1 3.48Å; Y29-Y58 VanDerWaalsContact CE1-CE1 3.48Å; Y29-Y58 HydrophobicContact CE1-CG 4.36Å; Y29-Y58 AromaticContact CG-CD1 3.91Å; Y29-Y58 HydrophobicContact CG-CD1 3.91Å; Y29-Y58 HydrophobicContact CG-CD2 4.22Å; Y29-Y58 HydrophobicContact CG-CE1 4.39Å; Y29-Y58 AromaticContact CG-CG 3.81Å; Y29-Y58 HydrophobicContact CG-CG 3.81Å
30	G	93.6	Very high	88	Confident	3 Å²	3	94 Å²	94	3%	0.031	46%	0.464	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	167.4	179.3	0	0	0	0	0	114.3	R24 C25 L28 C53	R24-G30 WeakPolarHBondContact CA-O 3.2Å; C25-G30 PolarHBondContact N-O 3.45Å; C25-G30 VanDerWaalsContact N-O 3.07Å; C25-G30 WeakPolarHBondContact O-CA 3.48Å; C25-G30 PolarHBondContact O-N 3.25Å; L28-G30 VanDerWaalsContact C-N 3.32Å; G30-C53 WeakPolarHBondContact CA-O 3.36Å
31	K	94.1	Very high	89.9	Confident	89 Å²	89	98.1 Å²	98.1	39%	0.387	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	135.6	173.5	-69.8	-178.2	179.7	-175	0	110.4	T22 C25 R33 C53	T22-K31 HydrophobicContact CG2-CB 3.84Å; T22-K31 HydrophobicContact CG2-CG 4.49Å; C25-K31 PolarHBondContact SG-N 2.81Å; K31-R33 PolarHBondContact O-N 2.88Å; K31-C53 PolarHBondContact N-O 2.85Å; K31-C53 PolarHBondContact O-N 3.01Å
32	C	93.4	Very high	91.6	Very high	4 Å²	4	98.3 Å²	98.3	3%	0.027	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.1	114.8	176	-58.5	0	0	0	0	111	T22 Q23 C46 K50 M51	T22-C32 WeakPolarHBondContact CG2-O 2.96Å; Q23-C32 HydrophobicContact CB-CB 4.07Å; Q23-C32 WeakPolarHBondContact O-CB 3.34Å; Q23-C32 PolarHBondContact O-N 2.02Å; Q23-C32 PolarHBondContact O-SG 3.07Å; C32-C46 HydrophobicContact CB-CB 3.8Å; C32-C46 WeakPolarHBondContact CB-SG 3.37Å; C32-C46 WeakPolarHBondContact SG-CB 3.42Å; C32-C46 CovalentContact SG-SG 2.02Å; C32-C46 PolarHBondContact SG-SG 2.94Å; C32-K50 HydrophobicContact CB-CB 4.18Å; C32-M51 CarbonylContact C-O 3.55Å; C32-M51 WeakPolarHBondContact CA-O 2.98Å
33	R	92.6	Very high	92.6	Very high	94 Å²	94	99.6 Å²	99.6	36%	0.355	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.2	155.7	-178.9	-58.3	176.5	-179.8	-95	5.7	111.2	T22 K31 R35 E40 M51	T22-R33 HydrophobicContact CG2-CG 4.22Å; K31-R33 PolarHBondContact O-N 2.88Å; R33-R35 WeakPolarHBondContact CB-O 3.21Å; R33-R35 PolarHBondContact O-N 2.93Å; R33-E40 IonicContact NE-OE2 3.75Å; R33-M51 PolarHBondContact N-O 2.04Å; R33-M51 PolarHBondContact O-N 3.07Å
34	H	91.9	Very high	92.8	Very high	147 Å²	147	98.8 Å²	98.8	68%	0.681	45%	0.446	S	S	*	.	S	Bend	trans	-69.1	-22.9	169.5	-70.7	-73.9	0	0	0	113	K50 M51	H34-K50 WeakPolarHBondContact NE2-CE 2.99Å; H34-K50 PolarHBondContact NE2-NZ 3.27Å; H34-M51 WeakPolarHBondContact O-CE 3.4Å
35	R	92.3	Very high	92.8	Very high	215 Å²	215	99.3 Å²	99.3	81%	0.811	45%	0.449	S	S	*	.	S	Bend	trans	-148.9	136.3	174.8	-166.8	178.6	-175.4	-155.7	3.7	109.3	R33	R33-R35 WeakPolarHBondContact CB-O 3.21Å; R33-R35 PolarHBondContact O-N 2.93Å
36	C	92.9	Very high	92.8	Very high	26 Å²	26	99.1 Å²	99.1	18%	0.176	45%	0.448	C	S	.	.			trans	-78.5	151.4	175.2	-59.7	0	0	0	0	111.8	E40 C53	C36-E40 HydrophobicContact CB-CB 4.17Å; C36-C53 WeakPolarHBondContact CA-SG 3.39Å; C36-C53 HydrophobicContact CB-CB 3.71Å; C36-C53 WeakPolarHBondContact CB-SG 3.28Å; C36-C53 VanDerWaalsContact SG-CA 3.5Å; C36-C53 WeakPolarHBondContact SG-CB 3.03Å; C36-C53 CovalentContact SG-SG 2.04Å; C36-C53 PolarHBondContact SG-SG 3.19Å
37	S	93.3	Very high	92.7	Very high	67 Å²	67	102.7 Å²	102.7	47%	0.469	47%	0.473	S	S	.	.			trans	-68.7	156.9	170	-174.7	0	0	0	0	110.6	K39 E40	S37-K39 PolarHBondContact O-N 2.81Å; S37-E40 PolarHBondContact N-OE2 2.83Å; S37-E40 PolarHBondContact O-N 3Å; S37-E40 VanDerWaalsContact O-O 3.13Å
38	K	93.4	Very high	92.5	Very high	214 Å²	214	99.3 Å²	99.3	93%	0.93	45%	0.454	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	-22.7	177.1	-66.7	-175.5	178.6	-177.8	0	113.6
39	K	93.1	Very high	92.4	Very high	177 Å²	177	100.7 Å²	100.7	77%	0.77	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.3	2.7	179.6	-59.2	-176.8	-178.7	-178.8	0	113.5	S37 P56	S37-K39 PolarHBondContact O-N 2.81Å; K39-P56 VanDerWaalsContact O-CD 3.23Å; K39-P56 WeakPolarHBondContact O-CD 3.01Å
40	E	94.4	Very high	92.3	Very high	36 Å²	36	98.1 Å²	98.1	17%	0.168	45%	0.453	C	S	.	.			trans	-117.7	157.2	178.3	-66.2	172.3	154.6	0	0	108.8	R33 C36 S37 C53 V54 K55	R33-E40 IonicContact NE-OE2 3.75Å; C36-E40 HydrophobicContact CB-CB 4.17Å; S37-E40 PolarHBondContact N-OE2 2.83Å; S37-E40 PolarHBondContact O-N 3Å; S37-E40 VanDerWaalsContact O-O 3.13Å; E40-C53 HydrophobicContact CB-CB 4.03Å; E40-C53 HydrophobicContact CG-CB 4.45Å; E40-C53 WeakPolarHBondContact OE2-CB 3.4Å; E40-V54 CarbonylContact C-O 3.6Å; E40-V54 WeakPolarHBondContact CA-O 3.03Å; E40-K55 HydrophobicContact CG-CG 4.49Å
41	R	93.5	Very high	92.4	Very high	156 Å²	156	100.1 Å²	100.1	59%	0.589	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.1	151.4	171.4	-68.8	-176.9	-177.2	-174.8	-1.7	109.2	V54 P56 Q59	R41-V54 PolarHBondContact N-O 2.91Å; R41-V54 PolarHBondContact O-N 3.04Å; R41-P56 HydrophobicContact CG-CG 4.37Å; R41-Q59 VanDerWaalsContact CB-NE2 3.33Å
42	V	94	Very high	92.4	Very high	71 Å²	71	95.9 Å²	95.9	43%	0.43	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.2	132.6	170.2	-176.2	0	0	0	0	107.5	M51	V42-M51 HydrophobicContact CG1-CB 4.09Å; V42-M51 HydrophobicContact CG1-CG 3.96Å; V42-M51 HydrophobicContact CG1-SD 4.37Å; V42-M51 HydrophobicContact CG2-CB 4.15Å; V42-M51 HydrophobicContact CG2-CG 4.05Å; V42-M51 HydrophobicContact CG2-SD 3.48Å; V42-M51 WeakPolarHBondContact CG2-SD 3.43Å
43	Y	90.3	Very high	92.5	Very high	83 Å²	83	95.7 Å²	95.7	33%	0.325	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	-52.1	176	-173	-99.8	0	0	0	111.9	W26 C52 Q59 P60	W26-Y43 AromaticContact CD2-CD1 3.61Å; W26-Y43 HydrophobicContact CD2-CD1 3.61Å; W26-Y43 AromaticContact CD2-CE1 3.56Å; W26-Y43 HydrophobicContact CD2-CE1 3.56Å; W26-Y43 HydrophobicContact CD2-CG 4.42Å; W26-Y43 AromaticContact CE2-CE1 3.81Å; W26-Y43 AromaticContact CE2-CZ 4Å; W26-Y43 AromaticContact CE3-CD1 3.49Å; W26-Y43 HydrophobicContact CE3-CD1 3.49Å; W26-Y43 VanDerWaalsContact CE3-CD1 3.49Å; W26-Y43 AromaticContact CE3-CE1 3.12Å; W26-Y43 HydrophobicContact CE3-CE1 3.12Å; W26-Y43 HydrophobicContact CG-CD1 4.18Å; W26-Y43 HydrophobicContact CH2-CD1 4.35Å; W26-Y43 AromaticContact CH2-CE1 3.33Å; W26-Y43 HydrophobicContact CH2-CE1 3.33Å; W26-Y43 HydrophobicContact CH2-CE2 4.38Å; W26-Y43 AromaticContact CH2-CZ 3.31Å; W26-Y43 WeakPolarHBondContact CH2-OH 3.03Å; W26-Y43 HydrophobicContact CZ2-CD1 4.42Å; W26-Y43 AromaticContact CZ2-CE1 3.71Å; W26-Y43 HydrophobicContact CZ2-CE1 3.71Å; W26-Y43 HydrophobicContact CZ2-CE2 4.21Å; W26-Y43 AromaticContact CZ2-CZ 3.53Å; W26-Y43 WeakPolarHBondContact CZ2-OH 3.32Å; W26-Y43 AromaticContact CZ3-CD1 3.92Å; W26-Y43 HydrophobicContact CZ3-CD1 3.92Å; W26-Y43 AromaticContact CZ3-CE1 3.03Å; W26-Y43 HydrophobicContact CZ3-CE1 3.03Å; W26-Y43 AromaticContact CZ3-CZ 3.58Å; Y43-C52 PolarHBondContact N-O 3.1Å; Y43-Q59 HydrophobicContact CD2-CG 4.21Å; Y43-P60 HydrophobicContact CE2-CG 4.11Å
44	V	91.8	Very high	92.6	Very high	66 Å²	66	91.2 Å²	91.2	40%	0.4	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.7	169	176.1	-69.2	0	0	0	0	110	C52	V44-C52 HydrophobicContact CG2-CB 3.75Å; V44-C52 WeakPolarHBondContact O-CA 3.43Å; V44-C52 WeakPolarHBondContact O-CB 3.35Å; V44-C52 PolarHBondContact O-N 3.07Å
45	Y	93	Very high	92.7	Very high	167 Å²	167	88.9 Å²	88.9	66%	0.655	41%	0.414	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87	143.3	167.9	-72.9	-84.8	0	0	0	110.9	M51	Y45-M51 HydrophobicContact CD1-CG 4.26Å; Y45-M51 HydrophobicContact CE1-CG 3.75Å
46	C	92.4	Very high	92.7	Very high	14 Å²	14	81.6 Å²	81.6	10%	0.095	40%	0.395	C	S	.	.			trans	-82.5	163.9	170.6	-60.5	0	0	0	0	110.5	C32 N48 N49 K50	C32-C46 HydrophobicContact CB-CB 3.8Å; C32-C46 WeakPolarHBondContact CB-SG 3.37Å; C32-C46 WeakPolarHBondContact SG-CB 3.42Å; C32-C46 CovalentContact SG-SG 2.02Å; C32-C46 PolarHBondContact SG-SG 2.94Å; C46-N48 VanDerWaalsContact CB-OD1 3.28Å; C46-N48 WeakPolarHBondContact CB-OD1 3.23Å; C46-N48 PolarHBondContact O-N 2.78Å; C46-N48 VanDerWaalsContact O-N 3.07Å; C46-N49 WeakPolarHBondContact O-CA 3.16Å; C46-N49 PolarHBondContact O-N 3.49Å; C46-K50 PolarHBondContact N-O 2.92Å
47	L	89.5	Confident	92.6	Very high	164 Å²	164	88.6 Å²	88.6	86%	0.859	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.5	-21.6	179.9	-63.8	175.8	0	0	0	114.2	N49	L47-N49 VanDerWaalsContact C-N 3.28Å
48	N	88	Confident	92.5	Very high	63 Å²	63	89.2 Å²	89.2	34%	0.337	41%	0.41	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.5	21.5	175.2	61.5	6.8	0	0	0	113	Q23 C46 K50	Q23-N48 PolarHBondContact OE1-ND2 2.01Å; C46-N48 VanDerWaalsContact CB-OD1 3.28Å; C46-N48 WeakPolarHBondContact CB-OD1 3.23Å; C46-N48 PolarHBondContact O-N 2.78Å; C46-N48 VanDerWaalsContact O-N 3.07Å; N48-K50 PolarHBondContact O-N 3.45Å; N48-K50 VanDerWaalsContact OD1-CB 3.24Å; N48-K50 WeakPolarHBondContact OD1-CB 3.08Å; N48-K50 WeakPolarHBondContact OD1-CG 3.44Å; N48-K50 PolarHBondContact OD1-N 3.27Å
49	N	89.1	Confident	92.2	Very high	142 Å²	142	80.7 Å²	80.7	76%	0.759	37%	0.373	S	S	*	.	S	Bend	trans	59.5	10.3	-178.7	-61.2	62.6	0	0	0	114.9	C46 L47	C46-N49 WeakPolarHBondContact O-CA 3.16Å; C46-N49 PolarHBondContact O-N 3.49Å; L47-N49 VanDerWaalsContact C-N 3.28Å
50	K	92.5	Very high	91.6	Very high	62 Å²	62	75.9 Å²	75.9	27%	0.27	36%	0.36	S	S	.	.			trans	-79.2	156.4	172.2	-61	-176.3	-166.5	-169.3	0	110.2	C32 H34 C46 N48	C32-K50 HydrophobicContact CB-CB 4.18Å; H34-K50 WeakPolarHBondContact NE2-CE 2.99Å; H34-K50 PolarHBondContact NE2-NZ 3.27Å; C46-K50 PolarHBondContact N-O 2.92Å; N48-K50 PolarHBondContact O-N 3.45Å; N48-K50 VanDerWaalsContact OD1-CB 3.24Å; N48-K50 WeakPolarHBondContact OD1-CB 3.08Å; N48-K50 WeakPolarHBondContact OD1-CG 3.44Å; N48-K50 PolarHBondContact OD1-N 3.27Å
51	M	94	Very high	90.8	Very high	46 Å²	46	83.6 Å²	83.6	23%	0.227	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.2	131.6	174.7	-71	170.5	-85.5	0	0	110.5	C32 R33 H34 V42 Y45 C53	C32-M51 CarbonylContact C-O 3.55Å; C32-M51 WeakPolarHBondContact CA-O 2.98Å; R33-M51 PolarHBondContact N-O 2.04Å; R33-M51 PolarHBondContact O-N 3.07Å; H34-M51 WeakPolarHBondContact O-CE 3.4Å; V42-M51 HydrophobicContact CG1-CB 4.09Å; V42-M51 HydrophobicContact CG1-CG 3.96Å; V42-M51 HydrophobicContact CG1-SD 4.37Å; V42-M51 HydrophobicContact CG2-CB 4.15Å; V42-M51 HydrophobicContact CG2-CG 4.05Å; V42-M51 HydrophobicContact CG2-SD 3.48Å; V42-M51 WeakPolarHBondContact CG2-SD 3.43Å; Y45-M51 HydrophobicContact CD1-CG 4.26Å; Y45-M51 HydrophobicContact CE1-CG 3.75Å; M51-C53 PolarHBondContact O-N 3.27Å
52	C	94.8	Very high	89.6	Confident	0 Å²	0	84.3 Å²	84.3	0%	0	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.9	105.7	166.2	-178.6	0	0	0	0	109.2	C25 Y43 V44	C25-C52 HydrophobicContact CB-CB 3.83Å; C25-C52 WeakPolarHBondContact CB-SG 3.41Å; C25-C52 WeakPolarHBondContact SG-CA 3.5Å; C25-C52 WeakPolarHBondContact SG-CB 2.98Å; C25-C52 CovalentContact SG-SG 2.01Å; C25-C52 PolarHBondContact SG-SG 2.94Å; Y43-C52 PolarHBondContact N-O 3.1Å; V44-C52 HydrophobicContact CG2-CB 3.75Å; V44-C52 WeakPolarHBondContact O-CA 3.43Å; V44-C52 WeakPolarHBondContact O-CB 3.35Å; V44-C52 PolarHBondContact O-N 3.07Å
53	C	95.1	Very high	88	Confident	0 Å²	0	88.7 Å²	88.7	0%	0	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	119.6	-179.4	-56.2	0	0	0	0	110.1	G30 K31 C36 E40 M51	G30-C53 WeakPolarHBondContact CA-O 3.36Å; K31-C53 PolarHBondContact N-O 2.85Å; K31-C53 PolarHBondContact O-N 3.01Å; C36-C53 WeakPolarHBondContact CA-SG 3.39Å; C36-C53 HydrophobicContact CB-CB 3.71Å; C36-C53 WeakPolarHBondContact CB-SG 3.28Å; C36-C53 VanDerWaalsContact SG-CA 3.5Å; C36-C53 WeakPolarHBondContact SG-CB 3.03Å; C36-C53 CovalentContact SG-SG 2.04Å; C36-C53 PolarHBondContact SG-SG 3.19Å; E40-C53 HydrophobicContact CB-CB 4.03Å; E40-C53 HydrophobicContact CG-CB 4.45Å; E40-C53 WeakPolarHBondContact OE2-CB 3.4Å; M51-C53 PolarHBondContact O-N 3.27Å
54	V	95	Very high	86.2	Confident	0 Å²	0	95.5 Å²	95.5	0%	0	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	141.4	-174.3	-173.5	0	0	0	0	109.5	W26 E40 R41 Q59	W26-V54 HydrophobicContact CB-CG2 3.82Å; W26-V54 HydrophobicContact CG-CG1 4.46Å; W26-V54 HydrophobicContact CG-CG2 4.01Å; E40-V54 CarbonylContact C-O 3.6Å; E40-V54 WeakPolarHBondContact CA-O 3.03Å; R41-V54 PolarHBondContact N-O 2.91Å; R41-V54 PolarHBondContact O-N 3.04Å; V54-Q59 HydrophobicContact CB-CG 4.29Å; V54-Q59 HydrophobicContact CG1-CG 4.09Å
55	K	94.2	Very high	84.7	Confident	98 Å²	98	100.9 Å²	100.9	43%	0.426	46%	0.455	S	S	.	.			trans	-67.6	138.1	171.7	-67.8	-179.3	178.3	177.7	0	109.9	E40 R57 Y58	E40-K55 HydrophobicContact CG-CG 4.49Å; K55-R57 HydrophobicContact CB-CG 4.23Å; K55-R57 PolarHBondContact O-N 3.06Å; K55-Y58 HydrophobicContact CB-CD2 3.95Å; K55-Y58 HydrophobicContact CB-CE2 4.36Å; K55-Y58 HydrophobicContact CD-CE2 4.36Å; K55-Y58 PolarHBondContact O-N 3.13Å
56	P	92	Very high	83.1	Confident	62 Å²	62	98.6 Å²	98.6	40%	0.403	46%	0.46	S	S	.	.	G	3₁₀ helix	trans	-50.7	-34.7	-177.3	-30.5	34.8	0	0	0	115.1	K39 R41 Y58 Q59	K39-P56 VanDerWaalsContact O-CD 3.23Å; K39-P56 WeakPolarHBondContact O-CD 3.01Å; R41-P56 HydrophobicContact CG-CG 4.37Å; P56-Y58 PolarHBondContact O-N 2.96Å; P56-Y58 VanDerWaalsContact O-N 3.13Å; P56-Q59 PolarHBondContact O-N 3.18Å
57	R	91.9	Very high	81.2	Confident	172 Å²	172	110.1 Å²	110.1	65%	0.649	51%	0.509	S	S	*	.	G	3₁₀ helix	trans	-61.3	-19.6	178.3	71.3	-177.1	-174.8	-174.5	3.5	115.3	K55	K55-R57 HydrophobicContact CB-CG 4.23Å; K55-R57 PolarHBondContact O-N 3.06Å
58	Y	91.4	Very high	80.8	Confident	80 Å²	80	107.4 Å²	107.4	31%	0.314	49%	0.492	S	S	.	.	G	3₁₀ helix	trans	-105.1	1	178.9	-58.5	-60.4	0	0	0	112.5	W26 Y29 K55 P56	W26-Y58 PolarHBondContact NE1-O 2.9Å; Y29-Y58 AromaticContact CD1-CD1 3.42Å; Y29-Y58 HydrophobicContact CD1-CD1 3.42Å; Y29-Y58 VanDerWaalsContact CD1-CD1 3.42Å; Y29-Y58 AromaticContact CD1-CD2 3.9Å; Y29-Y58 HydrophobicContact CD1-CD2 3.9Å; Y29-Y58 AromaticContact CD1-CE1 3.47Å; Y29-Y58 HydrophobicContact CD1-CE1 3.47Å; Y29-Y58 VanDerWaalsContact CD1-CE1 3.47Å; Y29-Y58 AromaticContact CD1-CE2 3.93Å; Y29-Y58 HydrophobicContact CD1-CE2 3.93Å; Y29-Y58 AromaticContact CD1-CG 3.65Å; Y29-Y58 HydrophobicContact CD1-CG 3.65Å; Y29-Y58 AromaticContact CD1-CZ 3.71Å; Y29-Y58 AromaticContact CE1-CD1 3.68Å; Y29-Y58 HydrophobicContact CE1-CD1 3.68Å; Y29-Y58 AromaticContact CE1-CE1 3.48Å; Y29-Y58 HydrophobicContact CE1-CE1 3.48Å; Y29-Y58 VanDerWaalsContact CE1-CE1 3.48Å; Y29-Y58 HydrophobicContact CE1-CG 4.36Å; Y29-Y58 AromaticContact CG-CD1 3.91Å; Y29-Y58 HydrophobicContact CG-CD1 3.91Å; Y29-Y58 HydrophobicContact CG-CD2 4.22Å; Y29-Y58 HydrophobicContact CG-CE1 4.39Å; Y29-Y58 AromaticContact CG-CG 3.81Å; Y29-Y58 HydrophobicContact CG-CG 3.81Å; K55-Y58 HydrophobicContact CB-CD2 3.95Å; K55-Y58 HydrophobicContact CB-CE2 4.36Å; K55-Y58 HydrophobicContact CD-CE2 4.36Å; K55-Y58 PolarHBondContact O-N 3.13Å; P56-Y58 PolarHBondContact O-N 2.96Å; P56-Y58 VanDerWaalsContact O-N 3.13Å
59	Q	85.5	Confident	80.5	Confident	35 Å²	35	109.7 Å²	109.7	16%	0.164	50%	0.5	C	S	.	.	S	Bend	trans	-82.6	149.8	171.3	-64.3	-170.5	-21.8	0	0	109	R41 Y43 V54 P56 K61	R41-Q59 VanDerWaalsContact CB-NE2 3.33Å; Y43-Q59 HydrophobicContact CD2-CG 4.21Å; V54-Q59 HydrophobicContact CB-CG 4.29Å; V54-Q59 HydrophobicContact CG1-CG 4.09Å; P56-Q59 PolarHBondContact O-N 3.18Å; Q59-K61 PolarHBondContact O-N 2.99Å
60	P	81.4	Confident	80	Confident	77 Å²	77	107.9 Å²	107.9	50%	0.5	49%	0.486	S	S	.	.	P	Polyproline II helix	trans	-53	129.5	166.3	-18.5	30.7	0	0	0	108.2	W26 Y43 E62	W26-P60 HydrophobicContact CH2-CG 4.49Å; W26-P60 HydrophobicContact CZ2-CG 4.04Å; Y43-P60 HydrophobicContact CE2-CG 4.11Å; P60-E62 PolarHBondContact O-N 3.12Å
61	K	77.4	Confident	79.2	Confident	197 Å²	197	110.6 Å²	110.6	86%	0.857	50%	0.498	S	S	*	.	P	Polyproline II helix	trans	-64.5	124.7	166.6	-65.4	-177.7	180	-178.6	0	105.7	Q59 K63	Q59-K61 PolarHBondContact O-N 2.99Å; K61-K63 PolarHBondContact O-N 2.85Å
62	E	68.3	Low	78.3	Confident	171 Å²	171	114.7 Å²	114.7	80%	0.799	52%	0.515	S	S	*	.			trans	-50.8	111.6	167.7	-85	175.7	154.7	0	0	106.9	P60 W64	P60-E62 PolarHBondContact O-N 3.12Å; E62-W64 VanDerWaalsContact C-N 3.26Å; E62-W64 PolarHBondContact O-N 3.24Å
63	K	60.6	Low	77.2	Confident	164 Å²	164	122.3 Å²	122.3	71%	0.713	55%	0.55	S	S	*	.			trans	-67.6	101.9	161.4	-77.9	-174.7	176.4	-176.9	0	103.8	K61 W65	K61-K63 PolarHBondContact O-N 2.85Å; K63-W65 HydrophobicContact CD-CZ2 4.25Å; K63-W65 PolarHBondContact O-N 2.89Å
64	W	52.3	Low	75.9	Confident	226 Å²	226	131.1 Å²	131.1	86%	0.856	59%	0.589	S	S	*	*			trans	-53.8	98.9	157.9	-92.3	51.4	0	0	0	105.8	E62 P66	E62-W64 VanDerWaalsContact C-N 3.26Å; E62-W64 PolarHBondContact O-N 3.24Å; W64-P66 WeakPolarHBondContact O-CD 3.33Å
65	W	59.9	Low	74.5	Confident	179 Å²	179	141.2 Å²	141.2	68%	0.678	63%	0.634	S	S	*	*			trans	-83.2	109.7	163.3	-74.5	107.3	0	0	0	105.4	K63 F67	K63-W65 HydrophobicContact CD-CZ2 4.25Å; K63-W65 PolarHBondContact O-N 2.89Å; W65-F67 VanDerWaalsContact C-N 3.28Å; W65-F67 HydrophobicContact CB-CD2 4.06Å; W65-F67 HydrophobicContact CB-CE2 3.92Å; W65-F67 HydrophobicContact CG-CE2 4.48Å; W65-F67 PolarHBondContact O-N 3.07Å
66	P	59.9	Low	72.8	Confident	118 Å²	118	144.8 Å²	144.8	77%	0.766	65%	0.652	S	S	*	*			trans	-76.3	93.9	167	32.7	-24.2	0	0	0	104.9	W64	W64-P66 WeakPolarHBondContact O-CD 3.33Å
67	F	53.5	Low	71.1	Confident	256 Å²	256	152.3 Å²	152.3	100%	1.123	67%	0.674	S	S	*	*			trans	-77.4	0	155.4	-73.6	-76.1	0	0	0	107.8	W65	W65-F67 VanDerWaalsContact C-N 3.28Å; W65-F67 HydrophobicContact CB-CD2 4.06Å; W65-F67 HydrophobicContact CB-CE2 3.92Å; W65-F67 HydrophobicContact CG-CE2 4.48Å; W65-F67 PolarHBondContact O-N 3.07Å

Retrieved 67 of 67 residues in 205.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).