A0A096NV14_PAPAN Loading...

Beta-defensin

Has antibacterial activity.

AlphaFold DB , UniProt , Accession A0A096NV14, Species PAPAN (Papio anubis, Olive baboon), Gene DEFB121, Length 76 aa.

						>A0A096NV14_PAPAN|A0A096NV14|DEFB121
MKLLLLLLTVTLLLAQVTPVTKCWGKSGRCRTTCKKREVYYILCKTEAKCCVDPKYVPVRSKLTDTNTSLESTSAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.1	Low	81.7	Confident	195 Å²	195	117.7 Å²	117.7	96%	0.961	62%	0.616	S	S	*	*				0	-36.1	0	-50.7	-46.1	-106.9	0	0	114.6	L3	M1-L3 PolarHBondContact O-N 3.36Å
2	K	80	Confident	81.2	Confident	175 Å²	175	117.3 Å²	117.3	76%	0.761	61%	0.614	S	S	*	*	H	α-helix	trans	-64	-35.9	-178	-134.5	95	163	-175.8	0	114.5	L5 L6	K2-L5 PolarHBondContact O-N 3.14Å; K2-L6 PolarHBondContact O-N 3.4Å
3	L	83.3	Confident	80.4	Confident	130 Å²	130	116.9 Å²	116.9	68%	0.681	61%	0.612	S	S	*	*	H	α-helix	trans	-65.6	-39.5	-177.6	-150.3	82.1	0	0	0	112.7	M1 L5 L6 L7	M1-L3 PolarHBondContact O-N 3.36Å; L3-L5 VanDerWaalsContact C-N 3.33Å; L3-L5 PolarHBondContact O-N 3.2Å; L3-L6 PolarHBondContact O-N 3.42Å; L3-L7 PolarHBondContact O-N 3.35Å
4	L	84	Confident	79.2	Confident	111 Å²	111	116.8 Å²	116.8	58%	0.581	61%	0.611	S	S	*	*	H	α-helix	trans	-63.6	-40.2	178	-70.8	166.8	0	0	0	111.6	L7 L8	L4-L7 PolarHBondContact O-N 3.07Å; L4-L8 WeakPolarHBondContact O-CD1 3.25Å; L4-L8 WeakPolarHBondContact O-CG 3.18Å; L4-L8 PolarHBondContact O-N 3.39Å
5	L	84.1	Confident	78.1	Confident	112 Å²	112	113.9 Å²	113.9	59%	0.586	61%	0.611	S	S	*	*	H	α-helix	trans	-64.1	-40.6	176.7	-68	167.3	0	0	0	111.6	K2 L3 L8 T9	K2-L5 PolarHBondContact O-N 3.14Å; L3-L5 VanDerWaalsContact C-N 3.33Å; L3-L5 PolarHBondContact O-N 3.2Å; L5-L8 PolarHBondContact O-N 2.68Å; L5-T9 WeakPolarHBondContact O-CG2 3.46Å; L5-T9 PolarHBondContact O-N 3.34Å; L5-T9 VanDerWaalsContact O-N 3.1Å; L5-T9 PolarHBondContact O-OG1 3.42Å
6	L	85.4	Confident	77	Confident	106 Å²	106	114.8 Å²	114.8	56%	0.555	61%	0.61	S	S	*	*	H	α-helix	trans	-65.6	-40.9	176.1	-73.7	163.4	0	0	0	112.4	K2 L3 T9 V10	K2-L6 PolarHBondContact O-N 3.4Å; L3-L6 PolarHBondContact O-N 3.42Å; L6-T9 PolarHBondContact O-OG1 2.96Å; L6-V10 VanDerWaalsContact O-CG2 3.3Å; L6-V10 WeakPolarHBondContact O-CG2 3.39Å; L6-V10 PolarHBondContact O-N 3.04Å
7	L	86.6	Confident	75.8	Confident	109 Å²	109	114.4 Å²	114.4	57%	0.571	61%	0.613	S	S	*	*	H	α-helix	trans	-63	-41.7	175.8	-93.8	140.5	0	0	0	112.1	L3 L4 T11	L3-L7 PolarHBondContact O-N 3.35Å; L4-L7 PolarHBondContact O-N 3.07Å; L7-T11 PolarHBondContact O-N 3.37Å; L7-T11 PolarHBondContact O-OG1 3.2Å
8	L	82.6	Confident	74.7	Confident	111 Å²	111	113.6 Å²	113.6	58%	0.581	61%	0.613	S	S	*	*	H	α-helix	trans	-64.6	-43.3	178.6	-81.8	160.5	0	0	0	112.5	L4 L5 T11 L12	L4-L8 WeakPolarHBondContact O-CD1 3.25Å; L4-L8 WeakPolarHBondContact O-CG 3.18Å; L4-L8 PolarHBondContact O-N 3.39Å; L5-L8 PolarHBondContact O-N 2.68Å; L8-T11 WeakPolarHBondContact CA-OG1 3.42Å; L8-T11 PolarHBondContact O-OG1 2.96Å; L8-L12 VanDerWaalsContact O-CB 3.3Å; L8-L12 WeakPolarHBondContact O-CB 3.3Å; L8-L12 PolarHBondContact O-N 3.03Å
9	T	84.3	Confident	73.9	Confident	74 Å²	74	112.8 Å²	112.8	45%	0.454	62%	0.615	S	S	.	*	H	α-helix	trans	-66.1	-41.5	179.1	53.7	0	0	0	0	111.6	L5 L6 L12 L13	L5-T9 WeakPolarHBondContact O-CG2 3.46Å; L5-T9 PolarHBondContact O-N 3.34Å; L5-T9 VanDerWaalsContact O-N 3.1Å; L5-T9 PolarHBondContact O-OG1 3.42Å; L6-T9 PolarHBondContact O-OG1 2.96Å; T9-L12 PolarHBondContact O-N 3.1Å; T9-L13 VanDerWaalsContact O-CD1 3.25Å; T9-L13 WeakPolarHBondContact O-CD1 3.48Å; T9-L13 PolarHBondContact O-N 3.28Å
10	V	84.3	Confident	73.6	Confident	87 Å²	87	110.6 Å²	110.6	53%	0.527	60%	0.604	S	S	.	*	H	α-helix	trans	-63.7	-45.3	177.5	172.4	0	0	0	0	111.7	L6 L13 L14	L6-V10 VanDerWaalsContact O-CG2 3.3Å; L6-V10 WeakPolarHBondContact O-CG2 3.39Å; L6-V10 PolarHBondContact O-N 3.04Å; V10-L13 PolarHBondContact O-N 3.23Å; V10-L14 HydrophobicContact CG1-CD1 4.02Å; V10-L14 WeakPolarHBondContact O-CD1 3.49Å; V10-L14 WeakPolarHBondContact O-CG 3.46Å; V10-L14 PolarHBondContact O-N 3.44Å; V10-L14 VanDerWaalsContact O-N 3.14Å
11	T	78.3	Confident	74.1	Confident	85 Å²	85	108.2 Å²	108.2	52%	0.521	59%	0.593	S	S	.	*	H	α-helix	trans	-65.1	-40	177.1	28.3	0	0	0	0	112.3	L7 L8 L14 A15	L7-T11 PolarHBondContact O-N 3.37Å; L7-T11 PolarHBondContact O-OG1 3.2Å; L8-T11 WeakPolarHBondContact CA-OG1 3.42Å; L8-T11 PolarHBondContact O-OG1 2.96Å; T11-L14 PolarHBondContact O-N 3.49Å; T11-A15 PolarHBondContact O-N 2.89Å; T11-A15 VanDerWaalsContact O-N 3.14Å
12	L	75.7	Confident	75.3	Confident	112 Å²	112	105.9 Å²	105.9	59%	0.586	58%	0.578	S	S	*	*	H	α-helix	trans	-65.9	-40.4	178.3	-162.6	70.8	0	0	0	111.5	L8 T9 A15 Q16	L8-L12 VanDerWaalsContact O-CB 3.3Å; L8-L12 WeakPolarHBondContact O-CB 3.3Å; L8-L12 PolarHBondContact O-N 3.03Å; T9-L12 PolarHBondContact O-N 3.1Å; L12-A15 PolarHBondContact O-N 3.08Å; L12-Q16 WeakPolarHBondContact O-CG 3.49Å; L12-Q16 PolarHBondContact O-NE2 2.77Å
13	L	70.6	Confident	75.9	Confident	113 Å²	113	98.4 Å²	98.4	59%	0.592	55%	0.548	S	S	*	.	H	α-helix	trans	-60.1	-45.3	174.6	-103	81.1	0	0	0	111.7	T9 V10 A15 Q16 V17	T9-L13 VanDerWaalsContact O-CD1 3.25Å; T9-L13 WeakPolarHBondContact O-CD1 3.48Å; T9-L13 PolarHBondContact O-N 3.28Å; V10-L13 PolarHBondContact O-N 3.23Å; L13-A15 VanDerWaalsContact C-N 3.31Å; L13-A15 PolarHBondContact O-N 3.47Å; L13-Q16 PolarHBondContact O-N 3.37Å; L13-V17 WeakPolarHBondContact O-CG2 2.97Å
14	L	64	Low	76.3	Confident	115 Å²	115	96.2 Å²	96.2	60%	0.602	53%	0.53	S	S	*	.	H	α-helix	trans	-63.7	-34.5	-179.8	-74.1	161.1	0	0	0	112.8	V10 T11 Q16 V17	V10-L14 HydrophobicContact CG1-CD1 4.02Å; V10-L14 WeakPolarHBondContact O-CD1 3.49Å; V10-L14 WeakPolarHBondContact O-CG 3.46Å; V10-L14 PolarHBondContact O-N 3.44Å; V10-L14 VanDerWaalsContact O-N 3.14Å; T11-L14 PolarHBondContact O-N 3.49Å; L14-Q16 VanDerWaalsContact C-N 3.25Å; L14-Q16 PolarHBondContact O-N 2.91Å; L14-V17 PolarHBondContact O-N 2.92Å
15	A	61.8	Low	76.5	Confident	73 Å²	73	94.6 Å²	94.6	60%	0.603	54%	0.54	S	S	*	.	H	α-helix	trans	-66	-26.8	177.6	0	0	0	0	0	113.2	T11 L12 L13	T11-A15 PolarHBondContact O-N 2.89Å; T11-A15 VanDerWaalsContact O-N 3.14Å; L12-A15 PolarHBondContact O-N 3.08Å; L13-A15 VanDerWaalsContact C-N 3.31Å; L13-A15 PolarHBondContact O-N 3.47Å
16	Q	60.2	Low	76.7	Confident	129 Å²	129	97.3 Å²	97.3	60%	0.603	55%	0.547	S	S	*	.	H	α-helix	trans	-81	-21.1	-177.7	-28.8	-170.3	-3.2	0	0	112.6	L12 L13 L14 T18 P19	L12-Q16 WeakPolarHBondContact O-CG 3.49Å; L12-Q16 PolarHBondContact O-NE2 2.77Å; L13-Q16 PolarHBondContact O-N 3.37Å; L14-Q16 VanDerWaalsContact C-N 3.25Å; L14-Q16 PolarHBondContact O-N 2.91Å; Q16-T18 PolarHBondContact O-N 3.43Å; Q16-P19 WeakPolarHBondContact O-CD 3.3Å
17	V	57.3	Low	77	Confident	107 Å²	107	94.8 Å²	94.8	65%	0.648	54%	0.539	S	S	*	.	S	Bend	trans	-75	-12.7	-169.8	-159	0	0	0	0	113	L13 L14	L13-V17 WeakPolarHBondContact O-CG2 2.97Å; L14-V17 PolarHBondContact O-N 2.92Å
18	T	55.4	Low	77.3	Confident	101 Å²	101	89.8 Å²	89.8	62%	0.62	51%	0.513	S	S	*	.			trans	-137	81.6	174	59.7	0	0	0	0	111.2	Q16 V20	Q16-T18 PolarHBondContact O-N 3.43Å; T18-V20 PolarHBondContact O-N 3.26Å
19	P	60.4	Low	77.8	Confident	99 Å²	99	90.5 Å²	90.5	64%	0.643	51%	0.508	S	S	*	.			trans	-56.5	108.6	157.4	25.1	-31.3	0	0	0	106.8	Q16 T21	Q16-P19 WeakPolarHBondContact O-CD 3.3Å; P19-T21 PolarHBondContact O-N 3.42Å
20	V	67.3	Low	78.3	Confident	67 Å²	67	87.9 Å²	87.9	41%	0.406	49%	0.492	S	S	.	.			trans	-72.6	83.8	175.5	179.4	0	0	0	0	106.6	T18 K22 R29	T18-V20 PolarHBondContact O-N 3.26Å; V20-K22 PolarHBondContact O-N 3.36Å; V20-R29 HydrophobicContact CG1-CB 3.9Å; V20-R29 HydrophobicContact CG1-CG 3.58Å
21	T	84.6	Confident	78.6	Confident	61 Å²	61	86.9 Å²	86.9	37%	0.374	48%	0.479	S	S	.	.			trans	-65.4	121.4	174.7	47.5	0	0	0	0	107.7	P19 C30	P19-T21 PolarHBondContact O-N 3.42Å; T21-C30 PolarHBondContact O-N 2.84Å; T21-C30 PolarHBondContact O-SG 3.43Å; T21-C30 WeakPolarHBondContact OG1-CB 3.46Å; T21-C30 PolarHBondContact OG1-SG 2.02Å
22	K	90.8	Very high	79.3	Confident	146 Å²	146	88.4 Å²	88.4	64%	0.635	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.8	142.6	176.9	-68.7	-177	-176.8	171.7	0	108.8	V20 K26 G28	V20-K22 PolarHBondContact O-N 3.36Å; K22-K26 HydrophobicContact CD-CB 4.04Å; K22-K26 HydrophobicContact CD-CG 4.17Å; K22-G28 WeakPolarHBondContact CA-O 3.43Å
23	C	92.2	Very high	80	Confident	19 Å²	19	88 Å²	88	13%	0.128	49%	0.49	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	-179.2	173.9	61.2	0	0	0	0	108.9	G25 K26 S27 G28 R29 C50	C23-G25 PolarHBondContact O-N 2.75Å; C23-K26 PolarHBondContact O-N 3.4Å; C23-K26 VanDerWaalsContact O-N 3.09Å; C23-S27 PolarHBondContact O-N 2.96Å; C23-G28 PolarHBondContact N-O 3.14Å; C23-G28 WeakPolarHBondContact O-CA 3.44Å; C23-G28 PolarHBondContact O-N 3.15Å; C23-R29 PolarHBondContact SG-N 3.34Å; C23-R29 VanDerWaalsContact SG-N 3.42Å; C23-C50 HydrophobicContact CB-CB 3.87Å; C23-C50 WeakPolarHBondContact CB-SG 3.24Å; C23-C50 WeakPolarHBondContact SG-CA 3.49Å; C23-C50 WeakPolarHBondContact SG-CB 3.32Å; C23-C50 CovalentContact SG-SG 2.02Å; C23-C50 PolarHBondContact SG-SG 3.43Å
24	W	91.8	Very high	81.1	Confident	84 Å²	84	84 Å²	84	32%	0.318	47%	0.472	S	S	.	.	G	3₁₀ helix	trans	51	53.5	176.3	-163	-113.3	0	0	0	113.4	K26 S27 Y41 V52 Y56	W24-K26 PolarHBondContact O-N 2.04Å; W24-K26 VanDerWaalsContact O-N 3.15Å; W24-S27 WeakPolarHBondContact O-CB 3.49Å; W24-S27 PolarHBondContact O-N 3.3Å; W24-Y41 HydrophobicContact CD2-CD1 4.17Å; W24-Y41 HydrophobicContact CD2-CD2 4.37Å; W24-Y41 HydrophobicContact CD2-CE1 4.31Å; W24-Y41 HydrophobicContact CD2-CE2 4.45Å; W24-Y41 HydrophobicContact CD2-CG 4.24Å; W24-Y41 AromaticContact CE3-CD1 3.42Å; W24-Y41 HydrophobicContact CE3-CD1 3.42Å; W24-Y41 VanDerWaalsContact CE3-CD1 3.42Å; W24-Y41 HydrophobicContact CE3-CD2 4.28Å; W24-Y41 AromaticContact CE3-CE1 3.34Å; W24-Y41 HydrophobicContact CE3-CE1 3.34Å; W24-Y41 HydrophobicContact CE3-CE2 4.17Å; W24-Y41 AromaticContact CE3-CG 3.95Å; W24-Y41 HydrophobicContact CE3-CG 3.95Å; W24-Y41 AromaticContact CE3-CZ 3.74Å; W24-Y41 HydrophobicContact CH2-CD1 4.28Å; W24-Y41 HydrophobicContact CH2-CD2 4.22Å; W24-Y41 AromaticContact CH2-CE1 3.52Å; W24-Y41 HydrophobicContact CH2-CE1 3.52Å; W24-Y41 AromaticContact CH2-CE2 3.39Å; W24-Y41 HydrophobicContact CH2-CE2 3.39Å; W24-Y41 AromaticContact CH2-CZ 2.99Å; W24-Y41 WeakPolarHBondContact CH2-OH 3.01Å; W24-Y41 HydrophobicContact CZ2-CD2 4.21Å; W24-Y41 HydrophobicContact CZ2-CE1 4.39Å; W24-Y41 AromaticContact CZ2-CE2 3.63Å; W24-Y41 HydrophobicContact CZ2-CE2 3.63Å; W24-Y41 AromaticContact CZ2-CZ 3.76Å; W24-Y41 AromaticContact CZ3-CD1 3.55Å; W24-Y41 HydrophobicContact CZ3-CD1 3.55Å; W24-Y41 HydrophobicContact CZ3-CD2 4.26Å; W24-Y41 AromaticContact CZ3-CE1 2.9Å; W24-Y41 HydrophobicContact CZ3-CE1 2.9Å; W24-Y41 AromaticContact CZ3-CE2 3.69Å; W24-Y41 HydrophobicContact CZ3-CE2 3.69Å; W24-Y41 HydrophobicContact CZ3-CG 4.21Å; W24-Y41 AromaticContact CZ3-CZ 2.99Å; W24-Y41 VanDerWaalsContact CZ3-OH 3.24Å; W24-Y41 WeakPolarHBondContact CZ3-OH 3.01Å; W24-V52 HydrophobicContact CB-CG2 3.72Å; W24-V52 VanDerWaalsContact CD1-CG1 3.42Å; W24-V52 HydrophobicContact CG-CG1 4.14Å; W24-V52 HydrophobicContact CG-CG2 3.76Å; W24-Y56 PolarHBondContact NE1-O 2.78Å
25	G	88.9	Confident	82.5	Confident	76 Å²	76	84.5 Å²	84.5	78%	0.784	47%	0.469	S	S	*	.	G	3₁₀ helix	trans	60.8	28.2	178.7	0	0	0	0	0	114.9	C23 S27	C23-G25 PolarHBondContact O-N 2.75Å; G25-S27 VanDerWaalsContact C-N 3.31Å
26	K	88.8	Confident	84	Confident	169 Å²	169	91.6 Å²	91.6	74%	0.735	49%	0.486	S	S	*	.	G	3₁₀ helix	trans	80.1	-3.1	-173.5	-51.4	171.5	-177.5	173.3	0	115.5	K22 C23 W24	K22-K26 HydrophobicContact CD-CB 4.04Å; K22-K26 HydrophobicContact CD-CG 4.17Å; C23-K26 PolarHBondContact O-N 3.4Å; C23-K26 VanDerWaalsContact O-N 3.09Å; W24-K26 PolarHBondContact O-N 2.04Å; W24-K26 VanDerWaalsContact O-N 3.15Å
27	S	91.1	Very high	85.5	Confident	54 Å²	54	96.1 Å²	96.1	38%	0.378	50%	0.498	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.4	-8.6	176.8	-60.3	0	0	0	0	113.4	C23 W24 G25	C23-S27 PolarHBondContact O-N 2.96Å; W24-S27 WeakPolarHBondContact O-CB 3.49Å; W24-S27 PolarHBondContact O-N 3.3Å; G25-S27 VanDerWaalsContact C-N 3.31Å
28	G	93.5	Very high	87.3	Confident	3 Å²	3	93 Å²	93	3%	0.031	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	167.2	176.6	0	0	0	0	0	113.9	K22 C23 C51	K22-G28 WeakPolarHBondContact CA-O 3.43Å; C23-G28 PolarHBondContact N-O 3.14Å; C23-G28 WeakPolarHBondContact O-CA 3.44Å; C23-G28 PolarHBondContact O-N 3.15Å; G28-C51 CarbonylContact C-O 3.59Å; G28-C51 VanDerWaalsContact CA-O 3.26Å; G28-C51 WeakPolarHBondContact CA-O 3.24Å
29	R	93.6	Very high	89.1	Confident	127 Å²	127	91 Å²	91	48%	0.479	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	137.9	174.5	-64.3	174.9	-170.1	-149.9	11.4	110.4	V20 C23 C51	V20-R29 HydrophobicContact CG1-CB 3.9Å; V20-R29 HydrophobicContact CG1-CG 3.58Å; C23-R29 PolarHBondContact SG-N 3.34Å; C23-R29 VanDerWaalsContact SG-N 3.42Å; R29-C51 PolarHBondContact N-O 3.33Å; R29-C51 PolarHBondContact O-N 3.31Å
30	C	93.1	Very high	90.7	Very high	18 Å²	18	92 Å²	92	12%	0.122	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	130.4	172.9	-55.8	0	0	0	0	110.6	T21 C44 A48 K49	T21-C30 PolarHBondContact O-N 2.84Å; T21-C30 PolarHBondContact O-SG 3.43Å; T21-C30 WeakPolarHBondContact OG1-CB 3.46Å; T21-C30 PolarHBondContact OG1-SG 2.02Å; C30-C44 HydrophobicContact CB-CB 3.81Å; C30-C44 WeakPolarHBondContact CB-SG 3Å; C30-C44 WeakPolarHBondContact SG-CB 3.42Å; C30-C44 CovalentContact SG-SG 2.02Å; C30-C44 PolarHBondContact SG-SG 2.02Å; C30-A48 HydrophobicContact CB-CB 4.17Å; C30-K49 CarbonylContact C-O 3.59Å; C30-K49 WeakPolarHBondContact CA-O 3.28Å
31	R	91.7	Very high	91.9	Very high	66 Å²	66	93 Å²	93	25%	0.249	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147	154	178.8	-57.4	-179.1	177.5	-73.5	-3.4	110	T33 E38 K49	R31-T33 VanDerWaalsContact C-N 3.26Å; R31-T33 WeakPolarHBondContact CB-O 3.06Å; R31-T33 PolarHBondContact O-N 3.27Å; R31-E38 IonicContact NE-OE1 3.83Å; R31-E38 IonicContact NE-OE2 3.63Å; R31-K49 PolarHBondContact N-O 3.24Å; R31-K49 WeakPolarHBondContact O-CA 3.48Å; R31-K49 WeakPolarHBondContact O-CB 3.42Å; R31-K49 PolarHBondContact O-N 3Å
32	T	91.8	Very high	92.3	Very high	118 Å²	118	94.6 Å²	94.6	72%	0.724	46%	0.458	S	S	*	.	S	Bend	trans	-61.5	-40.6	170.7	-41.8	0	0	0	0	111.2	K49	T32-K49 PolarHBondContact O-NZ 2.94Å
33	T	92	Very high	92.4	Very high	102 Å²	102	92.2 Å²	92.2	63%	0.626	45%	0.452	S	S	*	.	S	Bend	trans	-135	134.2	179.5	-50.2	0	0	0	0	109.9	R31	R31-T33 VanDerWaalsContact C-N 3.26Å; R31-T33 WeakPolarHBondContact CB-O 3.06Å; R31-T33 PolarHBondContact O-N 3.27Å
34	C	93	Very high	92.5	Very high	30 Å²	30	92.2 Å²	92.2	20%	0.203	45%	0.452	C	S	.	.			trans	-74.6	151.5	176.3	-60.2	0	0	0	0	111.6	E38 C51	C34-E38 HydrophobicContact CB-CB 4.13Å; C34-C51 WeakPolarHBondContact CA-SG 3.38Å; C34-C51 HydrophobicContact CB-CB 3.71Å; C34-C51 WeakPolarHBondContact CB-SG 2.98Å; C34-C51 WeakPolarHBondContact SG-CB 3.42Å; C34-C51 CovalentContact SG-SG 2.04Å; C34-C51 PolarHBondContact SG-SG 3.47Å
35	K	94	Very high	92.3	Very high	125 Å²	125	98.8 Å²	98.8	54%	0.543	48%	0.483	S	S	.	.			trans	-68.9	158.2	171.6	-64.1	-179.4	176.5	-173.5	0	110.1	R37 E38	K35-R37 PolarHBondContact O-N 2.91Å; K35-E38 HydrophobicContact CB-CB 4.48Å; K35-E38 HydrophobicContact CB-CG 4.1Å; K35-E38 WeakPolarHBondContact CB-OE2 3.47Å; K35-E38 PolarHBondContact N-OE2 2.99Å; K35-E38 PolarHBondContact O-N 2.8Å
36	K	93	Very high	92.2	Very high	222 Å²	222	99.7 Å²	99.7	97%	0.965	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.8	-24.6	179.2	-67.3	-174.7	179.2	-177.8	0	115
37	R	92.1	Very high	92.2	Very high	224 Å²	224	99.6 Å²	99.6	85%	0.845	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104	6.2	-179.9	-60	-173.8	-177.6	-163.9	0.4	113.5	K35 P54	K35-R37 PolarHBondContact O-N 2.91Å; R37-P54 WeakPolarHBondContact O-CD 3.38Å
38	E	94.6	Very high	92.3	Very high	41 Å²	41	97.9 Å²	97.9	19%	0.192	46%	0.464	C	S	.	.			trans	-107.6	149.1	176.5	-67.9	170.6	163	0	0	108.8	R31 C34 K35 C51 V52	R31-E38 IonicContact NE-OE1 3.83Å; R31-E38 IonicContact NE-OE2 3.63Å; C34-E38 HydrophobicContact CB-CB 4.13Å; K35-E38 HydrophobicContact CB-CB 4.48Å; K35-E38 HydrophobicContact CB-CG 4.1Å; K35-E38 WeakPolarHBondContact CB-OE2 3.47Å; K35-E38 PolarHBondContact N-OE2 2.99Å; K35-E38 PolarHBondContact O-N 2.8Å; E38-C51 HydrophobicContact CB-CB 3.97Å; E38-C51 HydrophobicContact CG-CB 4.38Å; E38-C51 VanDerWaalsContact OE2-CB 3.28Å; E38-C51 WeakPolarHBondContact OE2-CB 3.45Å; E38-V52 CarbonylContact C-O 3.56Å; E38-V52 WeakPolarHBondContact CA-O 3.06Å
39	V	93.9	Very high	92.3	Very high	59 Å²	59	101.9 Å²	101.9	36%	0.358	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	146.4	172.2	-69.1	0	0	0	0	110.3	C51 V52 P54 V57	V39-C51 WeakPolarHBondContact O-CA 2.96Å; V39-V52 WeakPolarHBondContact CG2-O 3.33Å; V39-V52 PolarHBondContact N-O 2.9Å; V39-V52 PolarHBondContact O-N 2.94Å; V39-P54 HydrophobicContact CG1-CG 4.07Å; V39-V57 HydrophobicContact CG2-CG2 3.85Å
40	Y	94	Very high	92.3	Very high	120 Å²	120	95.8 Å²	95.8	47%	0.471	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.8	125.7	168.6	167.8	-107.2	0	0	0	109.2	I42 L43 K49	Y40-I42 VanDerWaalsContact CE2-O 3.24Å; Y40-I42 WeakPolarHBondContact CE2-O 3.44Å; Y40-L43 HydrophobicContact CE2-CD2 4.06Å; Y40-L43 HydrophobicContact CE2-CG 4.48Å; Y40-L43 WeakPolarHBondContact OH-CG 3.36Å; Y40-L43 PolarHBondContact OH-N 2.99Å; Y40-K49 HydrophobicContact CD2-CB 3.74Å; Y40-K49 HydrophobicContact CD2-CD 4.1Å; Y40-K49 HydrophobicContact CD2-CG 3.85Å; Y40-K49 HydrophobicContact CE2-CB 4.16Å; Y40-K49 HydrophobicContact CE2-CG 4.08Å
41	Y	91.5	Very high	92.4	Very high	88 Å²	88	95 Å²	95	35%	0.345	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	-51.7	177.6	-168.6	-82.9	0	0	0	112.6	W24 C50 V57	W24-Y41 HydrophobicContact CD2-CD1 4.17Å; W24-Y41 HydrophobicContact CD2-CD2 4.37Å; W24-Y41 HydrophobicContact CD2-CE1 4.31Å; W24-Y41 HydrophobicContact CD2-CE2 4.45Å; W24-Y41 HydrophobicContact CD2-CG 4.24Å; W24-Y41 AromaticContact CE3-CD1 3.42Å; W24-Y41 HydrophobicContact CE3-CD1 3.42Å; W24-Y41 VanDerWaalsContact CE3-CD1 3.42Å; W24-Y41 HydrophobicContact CE3-CD2 4.28Å; W24-Y41 AromaticContact CE3-CE1 3.34Å; W24-Y41 HydrophobicContact CE3-CE1 3.34Å; W24-Y41 HydrophobicContact CE3-CE2 4.17Å; W24-Y41 AromaticContact CE3-CG 3.95Å; W24-Y41 HydrophobicContact CE3-CG 3.95Å; W24-Y41 AromaticContact CE3-CZ 3.74Å; W24-Y41 HydrophobicContact CH2-CD1 4.28Å; W24-Y41 HydrophobicContact CH2-CD2 4.22Å; W24-Y41 AromaticContact CH2-CE1 3.52Å; W24-Y41 HydrophobicContact CH2-CE1 3.52Å; W24-Y41 AromaticContact CH2-CE2 3.39Å; W24-Y41 HydrophobicContact CH2-CE2 3.39Å; W24-Y41 AromaticContact CH2-CZ 2.99Å; W24-Y41 WeakPolarHBondContact CH2-OH 3.01Å; W24-Y41 HydrophobicContact CZ2-CD2 4.21Å; W24-Y41 HydrophobicContact CZ2-CE1 4.39Å; W24-Y41 AromaticContact CZ2-CE2 3.63Å; W24-Y41 HydrophobicContact CZ2-CE2 3.63Å; W24-Y41 AromaticContact CZ2-CZ 3.76Å; W24-Y41 AromaticContact CZ3-CD1 3.55Å; W24-Y41 HydrophobicContact CZ3-CD1 3.55Å; W24-Y41 HydrophobicContact CZ3-CD2 4.26Å; W24-Y41 AromaticContact CZ3-CE1 2.9Å; W24-Y41 HydrophobicContact CZ3-CE1 2.9Å; W24-Y41 AromaticContact CZ3-CE2 3.69Å; W24-Y41 HydrophobicContact CZ3-CE2 3.69Å; W24-Y41 HydrophobicContact CZ3-CG 4.21Å; W24-Y41 AromaticContact CZ3-CZ 2.99Å; W24-Y41 VanDerWaalsContact CZ3-OH 3.24Å; W24-Y41 WeakPolarHBondContact CZ3-OH 3.01Å; Y41-C50 PolarHBondContact N-O 2.98Å; Y41-V57 HydrophobicContact CD2-CG1 4.3Å; Y41-V57 HydrophobicContact CD2-CG2 4.41Å; Y41-V57 HydrophobicContact CE2-CG1 4.3Å
42	I	92.6	Very high	92.6	Very high	95 Å²	95	91.9 Å²	91.9	49%	0.487	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.1	166.5	-178.2	-165	164.4	0	0	0	110.6	Y40 C50	Y40-I42 VanDerWaalsContact CE2-O 3.24Å; Y40-I42 WeakPolarHBondContact CE2-O 3.44Å; I42-C50 HydrophobicContact CG2-CB 3.81Å; I42-C50 WeakPolarHBondContact O-CA 3.15Å; I42-C50 WeakPolarHBondContact O-CB 3.02Å; I42-C50 PolarHBondContact O-N 2.85Å
43	L	94.4	Very high	92.6	Very high	97 Å²	97	88.8 Å²	88.8	51%	0.508	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.2	141.4	167	-64.8	176.3	0	0	0	111.4	Y40 A48	Y40-L43 HydrophobicContact CE2-CD2 4.06Å; Y40-L43 HydrophobicContact CE2-CG 4.48Å; Y40-L43 WeakPolarHBondContact OH-CG 3.36Å; Y40-L43 PolarHBondContact OH-N 2.99Å; L43-A48 CarbonylContact C-O 3.54Å; L43-A48 WeakPolarHBondContact CA-O 3.2Å
44	C	92.3	Very high	92.6	Very high	18 Å²	18	86.9 Å²	86.9	12%	0.122	41%	0.409	C	S	.	.			trans	-80.3	167.3	168.5	-62.7	0	0	0	0	110.6	C30 T46 E47 A48	C30-C44 HydrophobicContact CB-CB 3.81Å; C30-C44 WeakPolarHBondContact CB-SG 3Å; C30-C44 WeakPolarHBondContact SG-CB 3.42Å; C30-C44 CovalentContact SG-SG 2.02Å; C30-C44 PolarHBondContact SG-SG 2.02Å; C44-T46 PolarHBondContact O-N 3.42Å; C44-T46 VanDerWaalsContact O-N 3.08Å; C44-E47 WeakPolarHBondContact O-CA 3.04Å; C44-E47 PolarHBondContact O-N 3.48Å; C44-A48 PolarHBondContact N-O 2.9Å
45	K	88.1	Confident	92.4	Very high	223 Å²	223	91.9 Å²	91.9	97%	0.97	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.7	-25	175.1	-68.1	-173.9	177.5	-175	0	113.7	E47	K45-E47 PolarHBondContact O-N 3.09Å
46	T	87.4	Confident	92.1	Very high	95 Å²	95	91.7 Å²	91.7	58%	0.583	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.3	13.5	177.3	63.2	0	0	0	0	112.7	C44 A48	C44-T46 PolarHBondContact O-N 3.42Å; C44-T46 VanDerWaalsContact O-N 3.08Å; T46-A48 PolarHBondContact O-N 2.98Å; T46-A48 WeakPolarHBondContact OG1-CB 3.26Å
47	E	88.8	Confident	91.8	Very high	167 Å²	167	82.8 Å²	82.8	78%	0.78	39%	0.388	S	S	*	.	S	Bend	trans	61.3	5.3	-175.5	-53.6	-178.1	133.1	0	0	115	C44 K45	C44-E47 WeakPolarHBondContact O-CA 3.04Å; C44-E47 PolarHBondContact O-N 3.48Å; K45-E47 PolarHBondContact O-N 3.09Å
48	A	92.4	Very high	91.3	Very high	18 Å²	18	76.6 Å²	76.6	15%	0.149	38%	0.377	C	S	.	.			trans	-71.9	156	170.9	0	0	0	0	0	111	C30 L43 C44 T46	C30-A48 HydrophobicContact CB-CB 4.17Å; L43-A48 CarbonylContact C-O 3.54Å; L43-A48 WeakPolarHBondContact CA-O 3.2Å; C44-A48 PolarHBondContact N-O 2.9Å; T46-A48 PolarHBondContact O-N 2.98Å; T46-A48 WeakPolarHBondContact OG1-CB 3.26Å
49	K	93.9	Very high	90.4	Very high	86 Å²	86	81.1 Å²	81.1	37%	0.374	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.9	127.2	174.7	-63.8	-171.2	-173	83.6	0	110.4	C30 R31 T32 Y40 C51	C30-K49 CarbonylContact C-O 3.59Å; C30-K49 WeakPolarHBondContact CA-O 3.28Å; R31-K49 PolarHBondContact N-O 3.24Å; R31-K49 WeakPolarHBondContact O-CA 3.48Å; R31-K49 WeakPolarHBondContact O-CB 3.42Å; R31-K49 PolarHBondContact O-N 3Å; T32-K49 PolarHBondContact O-NZ 2.94Å; Y40-K49 HydrophobicContact CD2-CB 3.74Å; Y40-K49 HydrophobicContact CD2-CD 4.1Å; Y40-K49 HydrophobicContact CD2-CG 3.85Å; Y40-K49 HydrophobicContact CE2-CB 4.16Å; Y40-K49 HydrophobicContact CE2-CG 4.08Å; K49-C51 PolarHBondContact O-N 2.91Å; K49-C51 PolarHBondContact O-SG 2.98Å
50	C	94.6	Very high	88.9	Confident	0 Å²	0	88.7 Å²	88.7	0%	0	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76	107.7	165.2	179	0	0	0	0	108.7	C23 Y41 I42	C23-C50 HydrophobicContact CB-CB 3.87Å; C23-C50 WeakPolarHBondContact CB-SG 3.24Å; C23-C50 WeakPolarHBondContact SG-CA 3.49Å; C23-C50 WeakPolarHBondContact SG-CB 3.32Å; C23-C50 CovalentContact SG-SG 2.02Å; C23-C50 PolarHBondContact SG-SG 3.43Å; Y41-C50 PolarHBondContact N-O 2.98Å; I42-C50 HydrophobicContact CG2-CB 3.81Å; I42-C50 WeakPolarHBondContact O-CA 3.15Å; I42-C50 WeakPolarHBondContact O-CB 3.02Å; I42-C50 PolarHBondContact O-N 2.85Å
51	C	95.1	Very high	87	Confident	1 Å²	1	87.9 Å²	87.9	1%	0.007	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	125	-178.4	-53.8	0	0	0	0	109.3	G28 R29 C34 E38 V39 K49	G28-C51 CarbonylContact C-O 3.59Å; G28-C51 VanDerWaalsContact CA-O 3.26Å; G28-C51 WeakPolarHBondContact CA-O 3.24Å; R29-C51 PolarHBondContact N-O 3.33Å; R29-C51 PolarHBondContact O-N 3.31Å; C34-C51 WeakPolarHBondContact CA-SG 3.38Å; C34-C51 HydrophobicContact CB-CB 3.71Å; C34-C51 WeakPolarHBondContact CB-SG 2.98Å; C34-C51 WeakPolarHBondContact SG-CB 3.42Å; C34-C51 CovalentContact SG-SG 2.04Å; C34-C51 PolarHBondContact SG-SG 3.47Å; E38-C51 HydrophobicContact CB-CB 3.97Å; E38-C51 HydrophobicContact CG-CB 4.38Å; E38-C51 VanDerWaalsContact OE2-CB 3.28Å; E38-C51 WeakPolarHBondContact OE2-CB 3.45Å; V39-C51 WeakPolarHBondContact O-CA 2.96Å; K49-C51 PolarHBondContact O-N 2.91Å; K49-C51 PolarHBondContact O-SG 2.98Å
52	V	94.9	Very high	85	Confident	0 Å²	0	92.1 Å²	92.1	0%	0	46%	0.462	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	142	-175.3	-170.1	0	0	0	0	109.1	W24 E38 V39 V57	W24-V52 HydrophobicContact CB-CG2 3.72Å; W24-V52 VanDerWaalsContact CD1-CG1 3.42Å; W24-V52 HydrophobicContact CG-CG1 4.14Å; W24-V52 HydrophobicContact CG-CG2 3.76Å; E38-V52 CarbonylContact C-O 3.56Å; E38-V52 WeakPolarHBondContact CA-O 3.06Å; V39-V52 WeakPolarHBondContact CG2-O 3.33Å; V39-V52 PolarHBondContact N-O 2.9Å; V39-V52 PolarHBondContact O-N 2.94Å; V52-V57 HydrophobicContact CB-CG2 3.94Å; V52-V57 HydrophobicContact CG1-CG2 3.66Å
53	D	93.1	Very high	83.2	Confident	54 Å²	54	94.1 Å²	94.1	29%	0.289	47%	0.472	S	S	.	.			trans	-66.8	127.4	169.7	-172.2	-46.2	0	0	0	108.9	K55 Y56	D53-K55 HydrophobicContact CB-CD 4.5Å; D53-K55 HydrophobicContact CB-CG 4.29Å; D53-K55 VanDerWaalsContact CG-CE 3.5Å; D53-K55 PolarHBondContact O-N 2.99Å; D53-K55 VanDerWaalsContact OD1-CD 3.26Å; D53-K55 WeakPolarHBondContact OD1-CD 3.26Å; D53-K55 WeakPolarHBondContact OD1-CG 3.22Å; D53-K55 PolarHBondContact OD1-N 3.15Å; D53-K55 WeakPolarHBondContact OD2-CE 3.16Å; D53-K55 IonicContact OD2-NZ 2.76Å; D53-K55 PolarHBondContact OD2-NZ 2.76Å; D53-Y56 HydrophobicContact CB-CD2 3.75Å; D53-Y56 HydrophobicContact CB-CE2 4.01Å; D53-Y56 PolarHBondContact O-N 2.95Å
54	P	90.9	Very high	80.9	Confident	62 Å²	62	93.8 Å²	93.8	40%	0.403	48%	0.475	S	S	.	.	G	3₁₀ helix	trans	-49.7	-30.6	-178.6	-24.4	27.5	0	0	0	114	R37 V39 Y56 V57	R37-P54 WeakPolarHBondContact O-CD 3.38Å; V39-P54 HydrophobicContact CG1-CG 4.07Å; P54-Y56 PolarHBondContact O-N 3.06Å; P54-Y56 VanDerWaalsContact O-N 3.17Å; P54-V57 PolarHBondContact O-N 2.82Å
55	K	89.8	Confident	78.9	Confident	135 Å²	135	99.2 Å²	99.2	59%	0.587	50%	0.502	S	S	*	.	G	3₁₀ helix	trans	-64.2	-19	179.6	78	-160.3	177.3	-151.7	0	114.3	D53	D53-K55 HydrophobicContact CB-CD 4.5Å; D53-K55 HydrophobicContact CB-CG 4.29Å; D53-K55 VanDerWaalsContact CG-CE 3.5Å; D53-K55 PolarHBondContact O-N 2.99Å; D53-K55 VanDerWaalsContact OD1-CD 3.26Å; D53-K55 WeakPolarHBondContact OD1-CD 3.26Å; D53-K55 WeakPolarHBondContact OD1-CG 3.22Å; D53-K55 PolarHBondContact OD1-N 3.15Å; D53-K55 WeakPolarHBondContact OD2-CE 3.16Å; D53-K55 IonicContact OD2-NZ 2.76Å; D53-K55 PolarHBondContact OD2-NZ 2.76Å
56	Y	87.1	Confident	77.2	Confident	120 Å²	120	93.1 Å²	93.1	47%	0.471	48%	0.484	S	S	.	.	G	3₁₀ helix	trans	-102.9	-0.8	177.6	-55.8	-54.9	0	0	0	112.9	W24 D53 P54	W24-Y56 PolarHBondContact NE1-O 2.78Å; D53-Y56 HydrophobicContact CB-CD2 3.75Å; D53-Y56 HydrophobicContact CB-CE2 4.01Å; D53-Y56 PolarHBondContact O-N 2.95Å; P54-Y56 PolarHBondContact O-N 3.06Å; P54-Y56 VanDerWaalsContact O-N 3.17Å
57	V	85.8	Confident	75.4	Confident	35 Å²	35	95.5 Å²	95.5	21%	0.212	49%	0.493	C	S	.	.	S	Bend	trans	-96.1	116.2	173.8	-177.5	0	0	0	0	106.5	V39 Y41 V52 P54 V59	V39-V57 HydrophobicContact CG2-CG2 3.85Å; Y41-V57 HydrophobicContact CD2-CG1 4.3Å; Y41-V57 HydrophobicContact CD2-CG2 4.41Å; Y41-V57 HydrophobicContact CE2-CG1 4.3Å; V52-V57 HydrophobicContact CB-CG2 3.94Å; V52-V57 HydrophobicContact CG1-CG2 3.66Å; P54-V57 PolarHBondContact O-N 2.82Å; V57-V59 PolarHBondContact O-N 2.81Å; V57-V59 VanDerWaalsContact O-N 3.14Å
58	P	82.9	Confident	73.7	Confident	95 Å²	95	94.7 Å²	94.7	62%	0.617	50%	0.5	S	S	*	.			trans	-55.5	124.9	172.1	-20.5	31.3	0	0	0	108.1	R60	P58-R60 PolarHBondContact O-N 3.08Å
59	V	74.4	Confident	71.9	Confident	135 Å²	135	98.8 Å²	98.8	82%	0.818	53%	0.527	S	S	*	.			trans	-62.1	108.9	168.3	-175.2	0	0	0	0	104.6	V57 S61	V57-V59 PolarHBondContact O-N 2.81Å; V57-V59 VanDerWaalsContact O-N 3.14Å; V59-S61 PolarHBondContact O-N 2.76Å
60	R	63.4	Low	70.1	Confident	218 Å²	218	102.2 Å²	102.2	82%	0.823	55%	0.549	S	S	*	.			trans	-60.4	103.1	161.3	-74.2	-169.2	-177.9	-168.8	0.7	103.8	P58 K62	P58-R60 PolarHBondContact O-N 3.08Å; R60-K62 PolarHBondContact O-N 2.68Å
61	S	52.8	Low	67.7	Low	103 Å²	103	110.2 Å²	110.2	72%	0.72	59%	0.586	S	S	*	*			trans	-48.2	119.7	155.4	41.2	0	0	0	0	103.6	V59 L63	V59-S61 PolarHBondContact O-N 2.76Å; S61-L63 PolarHBondContact O-N 3.01Å
62	K	51.3	Low	65.4	Low	178 Å²	178	116.5 Å²	116.5	77%	0.774	63%	0.63	S	S	*	*			trans	-52.3	98.9	174.6	-168.6	-173.4	-174.6	-149.9	0	104.3	R60 T64	R60-K62 PolarHBondContact O-N 2.68Å; K62-T64 PolarHBondContact O-N 2.84Å; K62-T64 PolarHBondContact O-OG1 2.94Å; K62-T64 VanDerWaalsContact O-OG1 3.08Å
63	L	53.2	Low	63.2	Low	137 Å²	137	122 Å²	122	72%	0.717	66%	0.664	S	S	*	*			trans	-58.7	104.5	163.4	-171.3	78.6	0	0	0	100.8	S61 D65	S61-L63 PolarHBondContact O-N 3.01Å; L63-D65 VanDerWaalsContact CD2-OD1 3.22Å; L63-D65 WeakPolarHBondContact CD2-OD1 2.96Å; L63-D65 PolarHBondContact O-N 3.14Å
64	T	47.3	Very low	61.3	Low	90 Å²	90	124.6 Å²	124.6	55%	0.552	69%	0.686	S	S	*	*			trans	-76.1	79.7	-178.6	-66.2	0	0	0	0	102	K62 T66	K62-T64 PolarHBondContact O-N 2.84Å; K62-T64 PolarHBondContact O-OG1 2.94Å; K62-T64 VanDerWaalsContact O-OG1 3.08Å; T64-T66 WeakPolarHBondContact CG2-OG1 3.22Å; T64-T66 PolarHBondContact O-N 3.17Å
65	D	50.4	Low	59	Low	132 Å²	132	125.7 Å²	125.7	71%	0.706	70%	0.701	S	S	*	*			trans	-70.7	65.3	159.9	-66.5	-29.8	0	0	0	105.8	L63 N67	L63-D65 VanDerWaalsContact CD2-OD1 3.22Å; L63-D65 WeakPolarHBondContact CD2-OD1 2.96Å; L63-D65 PolarHBondContact O-N 3.14Å; D65-N67 PolarHBondContact O-N 3.07Å
66	T	51	Low	56.9	Low	95 Å²	95	129.9 Å²	129.9	58%	0.583	74%	0.737	S	S	*	*			trans	-68	119.1	155.3	-63.9	0	0	0	0	104.3	T64	T64-T66 WeakPolarHBondContact CG2-OG1 3.22Å; T64-T66 PolarHBondContact O-N 3.17Å
67	N	50.4	Low	55.4	Low	144 Å²	144	130.4 Å²	130.4	77%	0.77	75%	0.751	S	S	*	*			trans	104.6	67.7	169	-47.8	-25.1	0	0	0	115.9	D65	D65-N67 PolarHBondContact O-N 3.07Å
68	T	51.9	Low	53.8	Low	151 Å²	151	135.4 Å²	135.4	93%	0.926	78%	0.779	S	S	*	*			trans	-129	85.1	132.4	-61.5	0	0	0	0	108.4
69	S	55.5	Low	52.2	Low	104 Å²	104	137.7 Å²	137.7	73%	0.727	79%	0.788	S	S	*	*	S	Bend	trans	-145.7	107.7	157.1	-178.4	0	0	0	0	107
70	L	57	Low	50.9	Low	157 Å²	157	137.8 Å²	137.8	82%	0.822	79%	0.786	S	S	*	*			trans	46.1	105.5	166.7	-84.7	82.7	0	0	0	117.8
71	E	42.6	Very low	50.1	Low	169 Å²	169	132.8 Å²	132.8	79%	0.79	78%	0.784	S	S	*	*				-162.5	85.5	125.9	-158.5	107.5	114.9	0	0	108.3
72	S	47.6	Very low	49.9	Very low	133 Å²	133	134.8 Å²	134.8	93%	0.93	79%	0.788	S	S	*	*			trans	-97.6	77.5	155.7	-71.4	0	0	0	0	106.9
73	T	48.4	Very low	49.8	Very low	114 Å²	114	131.7 Å²	131.7	70%	0.699	79%	0.789	S	S	*	*			trans	-100.6	113.8	165.3	-45.7	0	0	0	0	107.9
74	S	52.8	Low	49.6	Very low	109 Å²	109	131.3 Å²	131.3	76%	0.762	80%	0.795	S	S	*	*			trans	-69.9	142.4	179.7	-167.8	0	0	0	0	111.7
75	A	44.2	Very low	49.7	Very low	86 Å²	86	134.8 Å²	134.8	71%	0.711	82%	0.815	S	S	*	*			trans	53.9	118.7	143.5	0	0	0	0	0	120.6
76	V	45.1	Very low	49.7	Very low	223 Å²	223	135 Å²	135	100%	1.352	83%	0.825	S	S	*	*				-130.2	0	128.5	-175.7	0	0	0	0	107.8

Retrieved 76 of 76 residues in 245.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).