A0A096NVV6_PAPAN Loading...

Synaptojanin-2-binding protein

AlphaFold DB , UniProt , Accession A0A096NVV6, Species PAPAN (Papio anubis, Olive baboon), Gene SYNJ2BP, Length 145 aa.

						>A0A096NVV6_PAPAN|A0A096NVV6|SYNJ2BP
MNGRVVYLVAEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWVFMRYRQQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.3	Very low	63.6	Low	241 Å²	241	116.5 Å²	116.5	100%	1.187	62%	0.618	S	S	*	*				0	105.4	0	-75.3	164.9	154.9	0	0	106.9	G3	M1-G3 PolarHBondContact O-N 3.49Å
2	N	39.7	Very low	66	Low	169 Å²	169	112.6 Å²	112.6	90%	0.904	59%	0.593	S	S	*	*			trans	-71.2	116.2	-175.3	-68	-18.1	0	0	0	109	R4	N2-R4 PolarHBondContact O-N 2.88Å
3	G	51.9	Low	68.4	Low	69 Å²	69	113 Å²	113	71%	0.711	59%	0.59	S	S	*	*			trans	-59.8	124	178.1	0	0	0	0	0	110.4	M1 V5	M1-G3 PolarHBondContact O-N 3.49Å; G3-V5 PolarHBondContact O-N 3.33Å
4	R	55.3	Low	70.4	Confident	229 Å²	229	104.9 Å²	104.9	86%	0.864	55%	0.548	S	S	*	.			trans	-75.3	104.1	171.4	-170.9	175.1	-178.9	168.3	-0.5	106.8	N2 V6	N2-R4 PolarHBondContact O-N 2.88Å; R4-V6 PolarHBondContact O-N 3.26Å; R4-V6 VanDerWaalsContact O-N 3.12Å
5	V	57.8	Low	72.2	Confident	72 Å²	72	104.3 Å²	104.3	44%	0.436	55%	0.546	S	S	.	.			trans	-61.7	115.8	171.1	-179.8	0	0	0	0	107.1	G3 Y7	G3-V5 PolarHBondContact O-N 3.33Å; V5-Y7 HydrophobicContact CB-CE2 4.15Å; V5-Y7 HydrophobicContact CG1-CD1 4.41Å; V5-Y7 HydrophobicContact CG1-CD2 4.42Å; V5-Y7 HydrophobicContact CG1-CE1 3.92Å; V5-Y7 HydrophobicContact CG1-CE2 3.92Å
6	V	64.3	Low	73.7	Confident	69 Å²	69	98.1 Å²	98.1	42%	0.418	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.6	118.5	174.7	-178.9	0	0	0	0	106.3	R4 V102	R4-V6 PolarHBondContact O-N 3.26Å; R4-V6 VanDerWaalsContact O-N 3.12Å; V6-V102 WeakPolarHBondContact O-CB 3.4Å; V6-V102 WeakPolarHBondContact O-CG2 3.36Å; V6-V102 PolarHBondContact O-N 3.33Å
7	Y	64	Low	75	Confident	89 Å²	89	98.2 Å²	98.2	35%	0.349	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	125.6	171.2	-61.4	-84.4	0	0	0	107.7	V5 R99 L100 Q101	V5-Y7 HydrophobicContact CB-CE2 4.15Å; V5-Y7 HydrophobicContact CG1-CD1 4.41Å; V5-Y7 HydrophobicContact CG1-CD2 4.42Å; V5-Y7 HydrophobicContact CG1-CE1 3.92Å; V5-Y7 HydrophobicContact CG1-CE2 3.92Å; Y7-R99 HydrophobicContact CD1-CG 3.82Å; Y7-R99 HydrophobicContact CE1-CG 4.42Å; Y7-R99 HydrophobicContact CG-CG 4.44Å; Y7-L100 WeakPolarHBondContact CA-O 3.3Å; Y7-Q101 HydrophobicContact CD1-CG 4.16Å; Y7-Q101 HydrophobicContact CE1-CB 4.39Å; Y7-Q101 HydrophobicContact CE1-CG 3.79Å
8	L	71.8	Confident	76.1	Confident	103 Å²	103	96.8 Å²	96.8	54%	0.539	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	133.6	164.4	-73.6	171.3	0	0	0	107.6	L100 V102	L8-L100 HydrophobicContact CB-CB 4.35Å; L8-L100 PolarHBondContact N-O 2.88Å; L8-L100 PolarHBondContact O-N 2.94Å; L8-L100 VanDerWaalsContact O-N 3.12Å; L8-V102 HydrophobicContact CB-CG2 3.96Å; L8-V102 HydrophobicContact CD1-CG2 3.39Å; L8-V102 HydrophobicContact CG-CG2 3.34Å
9	V	76.9	Confident	77	Confident	90 Å²	90	93.2 Å²	93.2	55%	0.545	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	111.5	178.2	-179	0	0	0	0	105.6	Q97	V9-Q97 HydrophobicContact CG1-CG 3.21Å
10	A	85.2	Confident	77.7	Confident	38 Å²	38	96.1 Å²	96.1	31%	0.314	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	130.1	174.5	0	0	0	0	0	108.4	Q97 H98 L100	A10-Q97 CarbonylContact O-C 3.29Å; A10-Q97 WeakPolarHBondContact O-CA 3.08Å; A10-H98 PolarHBondContact N-O 3.47Å; A10-H98 PolarHBondContact O-N 3.25Å; A10-L100 HydrophobicContact CB-CD1 4.25Å
11	E	92.6	Very high	78.2	Confident	113 Å²	113	95.5 Å²	95.5	53%	0.528	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	136.4	171	-66.1	-169.5	-168.8	0	0	109.6	L66 R95 V96 Q97	E11-L66 HydrophobicContact CG-CD1 3.89Å; E11-L66 WeakPolarHBondContact OE1-CD1 3.4Å; E11-L66 WeakPolarHBondContact OE2-CD1 3.26Å; E11-R95 IonicContact OE2-NH1 3.01Å; E11-V96 CarbonylContact C-O 3.53Å; E11-V96 WeakPolarHBondContact CA-O 3.29Å; E11-Q97 HydrophobicContact CG-CB 4.45Å; E11-Q97 HydrophobicContact CG-CG 4.44Å
12	E	92.8	Very high	80.7	Confident	69 Å²	69	84.8 Å²	84.8	32%	0.322	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.2	147.6	177.5	-175.5	171.8	166.8	0	0	110.6	I14 R58 R95 V96 H98	E12-I14 HydrophobicContact CG-CG1 4.16Å; E12-R58 WeakPolarHBondContact OE1-CD 3.25Å; E12-R58 IonicContact OE1-CZ 3.85Å; E12-R58 IonicContact OE1-NE 3.72Å; E12-R58 IonicContact OE1-NH1 2.88Å; E12-R58 PolarHBondContact OE1-NH1 3.43Å; E12-R95 WeakPolarHBondContact O-CA 3.46Å; E12-V96 HydrophobicContact CB-CG2 4.27Å; E12-V96 PolarHBondContact N-O 2.91Å; E12-V96 PolarHBondContact O-N 3.36Å; E12-H98 IonicContact OE2-NE2 2.91Å; E12-H98 PolarHBondContact OE2-NE2 3.3Å
13	E	96.4	Very high	83.4	Confident	118 Å²	118	77.3 Å²	77.3	55%	0.551	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.2	121.4	168.1	-168.8	178	179.4	0	0	110.9	R58 S93 L94	E13-R58 PolarHBondContact O-NH1 3.34Å; E13-S93 PolarHBondContact OE1-OG 2.84Å; E13-L94 CarbonylContact C-O 3.5Å; E13-L94 WeakPolarHBondContact CA-O 3.22Å
14	I	96.7	Very high	85.5	Confident	0 Å²	0	74.3 Å²	74.3	0%	0	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	120	-177.3	-56.9	178	0	0	0	108.8	E12 L16 R58 L59 L94 V96	E12-I14 HydrophobicContact CG-CG1 4.16Å; I14-L16 HydrophobicContact CG2-CD2 3.77Å; I14-L16 HydrophobicContact CG2-CG 3.93Å; I14-R58 HydrophobicContact CD1-CB 3.89Å; I14-R58 HydrophobicContact CG1-CB 4.28Å; I14-L59 HydrophobicContact CD1-CB 4.1Å; I14-L59 HydrophobicContact CD1-CD1 4.12Å; I14-L94 HydrophobicContact CB-CB 4.44Å; I14-L94 PolarHBondContact N-O 3.37Å; I14-L94 PolarHBondContact O-N 2.95Å; I14-V96 HydrophobicContact CD1-CG1 4.43Å; I14-V96 HydrophobicContact CD1-CG2 3.58Å; I14-V96 HydrophobicContact CG1-CG2 4.13Å
15	N	97.4	Very high	87.4	Confident	96 Å²	96	64.6 Å²	64.6	51%	0.513	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	113	176	-71.2	-67.9	0	0	0	109.4	V92 S93	N15-V92 WeakPolarHBondContact CA-O 3.35Å; N15-S93 VanDerWaalsContact OD1-CB 3.3Å; N15-S93 WeakPolarHBondContact OD1-CB 3.47Å
16	L	95.9	Very high	89.3	Confident	5 Å²	5	65.4 Å²	65.4	3%	0.026	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	141.1	178.6	-62.3	-179.2	0	0	0	110.8	I14 L23 F25 A53 D56 V92 L94	I14-L16 HydrophobicContact CG2-CD2 3.77Å; I14-L16 HydrophobicContact CG2-CG 3.93Å; L16-L23 HydrophobicContact CB-CD2 4.34Å; L16-F25 HydrophobicContact CD1-CE1 4.09Å; L16-A53 HydrophobicContact CD1-CB 4.01Å; L16-D56 HydrophobicContact CD2-CB 3.51Å; L16-V92 PolarHBondContact N-O 3.01Å; L16-V92 PolarHBondContact O-N 3.41Å; L16-L94 HydrophobicContact CD1-CD1 3.75Å; L16-L94 HydrophobicContact CG-CD1 4.45Å
17	T	96.4	Very high	90.8	Very high	99 Å²	99	63.4 Å²	63.4	61%	0.607	35%	0.354	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.7	127.7	166	-56.2	0	0	0	0	108.9	G19 A52 C90	T17-G19 PolarHBondContact O-N 3.01Å; T17-A52 WeakPolarHBondContact O-CB 3.35Å; T17-C90 CarbonylContact C-O 3.33Å
18	R	94.9	Very high	92.2	Very high	74 Å²	74	61 Å²	61	28%	0.279	35%	0.349	S	S	.	.			trans	-61.3	122.7	-180	-171.8	179.9	-63	-89.9	-6.5	110	L23 F85 G89 C90	R18-L23 HydrophobicContact CB-CD2 4.36Å; R18-F85 PolarHBondContact NH2-O 3.15Å; R18-G89 PolarHBondContact NE-O 3.2Å; R18-G89 PolarHBondContact NH2-O 2.83Å; R18-C90 WeakPolarHBondContact CB-O 3.43Å; R18-C90 PolarHBondContact N-O 3.04Å
19	G	93.4	Very high	93.3	Very high	27 Å²	27	56.2 Å²	56.2	28%	0.278	32%	0.324	S	S	.	.	B	Isolated β-bridge	trans	-87.3	-177.7	173.4	0	0	0	0	0	112.7	T17 S21 G22	T17-G19 PolarHBondContact O-N 3.01Å; G19-S21 PolarHBondContact O-N 3.45Å; G19-S21 VanDerWaalsContact O-N 3.13Å; G19-G22 PolarHBondContact N-O 2.98Å; G19-G22 PolarHBondContact O-N 3.24Å
20	P	90.3	Very high	94.1	Very high	152 Å²	152	51.9 Å²	51.9	99%	0.987	30%	0.298	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.9	-27.9	178.8	-23.9	33.5	0	0	0	114
21	S	87.8	Confident	94.4	Very high	84 Å²	84	52.7 Å²	52.7	59%	0.587	30%	0.299	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.2	14	176.7	-73.2	0	0	0	0	113.7	G19 K48	G19-S21 PolarHBondContact O-N 3.45Å; G19-S21 VanDerWaalsContact O-N 3.13Å; S21-K48 PolarHBondContact OG-NZ 3.02Å; S21-K48 VanDerWaalsContact OG-NZ 3.1Å
22	G	94.1	Very high	94.3	Very high	16 Å²	16	51.2 Å²	51.2	17%	0.165	30%	0.295	C	S	.	.	B	Isolated β-bridge	trans	89.1	-148.8	-174.1	0	0	0	0	0	113.2	G19	G19-G22 PolarHBondContact N-O 2.98Å; G19-G22 PolarHBondContact O-N 3.24Å
23	L	95.4	Very high	94.1	Very high	12 Å²	12	52.8 Å²	52.8	6%	0.063	30%	0.302	C	S	.	.	T	Hydrogen-bonded Turn	trans	-79.8	-16.8	-176.7	-61.8	174.4	0	0	0	113.7	L16 R18 F25 A53 F85 V92	L16-L23 HydrophobicContact CB-CD2 4.34Å; R18-L23 HydrophobicContact CB-CD2 4.36Å; L23-F25 HydrophobicContact CB-CD1 3.9Å; L23-F25 HydrophobicContact CB-CE1 3.46Å; L23-F25 VanDerWaalsContact CB-CE1 3.46Å; L23-F25 HydrophobicContact CB-CZ 4.18Å; L23-F25 HydrophobicContact CD1-CE1 4.01Å; L23-F25 HydrophobicContact CD1-CZ 4Å; L23-F25 HydrophobicContact CG-CE1 4.34Å; L23-A53 WeakPolarHBondContact O-CB 3.29Å; L23-A53 PolarHBondContact O-N 3.29Å; L23-F85 HydrophobicContact CD1-CB 4.45Å; L23-F85 HydrophobicContact CD1-CD1 3.83Å; L23-V92 HydrophobicContact CD1-CG1 4.34Å; L23-V92 HydrophobicContact CD1-CG2 4.36Å; L23-V92 HydrophobicContact CD2-CB 4.04Å; L23-V92 HydrophobicContact CD2-CG2 3.75Å
24	G	95.8	Very high	93.6	Very high	5 Å²	5	52.2 Å²	52.2	5%	0.052	30%	0.299	C	S	.	.	S	Bend	trans	82.1	30.1	172.1	0	0	0	0	0	115.3	K48	G24-K48 WeakPolarHBondContact O-CB 3.45Å; G24-K48 PolarHBondContact O-N 2.92Å
25	F	96.6	Very high	93	Very high	25 Å²	25	58.6 Å²	58.6	11%	0.11	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.2	161	171.1	61.3	-93.1	0	0	0	111.1	L16 L23 I27 V44 R46 I47 A53 L59 I65 F85 L94	L16-F25 HydrophobicContact CD1-CE1 4.09Å; L23-F25 HydrophobicContact CB-CD1 3.9Å; L23-F25 HydrophobicContact CB-CE1 3.46Å; L23-F25 VanDerWaalsContact CB-CE1 3.46Å; L23-F25 HydrophobicContact CB-CZ 4.18Å; L23-F25 HydrophobicContact CD1-CE1 4.01Å; L23-F25 HydrophobicContact CD1-CZ 4Å; L23-F25 HydrophobicContact CG-CE1 4.34Å; F25-I27 HydrophobicContact CD2-CG2 3.78Å; F25-I27 HydrophobicContact CE2-CG2 3.55Å; F25-V44 HydrophobicContact CB-CG1 4.3Å; F25-V44 HydrophobicContact CD2-CG2 4.49Å; F25-R46 CarbonylContact C-O 3.52Å; F25-R46 VanDerWaalsContact CA-O 3.23Å; F25-R46 WeakPolarHBondContact CA-O 3.18Å; F25-R46 WeakPolarHBondContact CB-O 3.48Å; F25-I47 HydrophobicContact CB-CD1 3.77Å; F25-A53 HydrophobicContact CB-CB 4.49Å; F25-A53 HydrophobicContact CD1-CB 3.85Å; F25-L59 HydrophobicContact CB-CD2 4.22Å; F25-L59 HydrophobicContact CD1-CD2 3.57Å; F25-L59 HydrophobicContact CD2-CD2 4.39Å; F25-L59 HydrophobicContact CE1-CD2 3.92Å; F25-L59 HydrophobicContact CG-CD2 3.82Å; F25-L59 HydrophobicContact CZ-CD2 4.49Å; F25-I65 HydrophobicContact CD2-CD1 4.45Å; F25-I65 HydrophobicContact CE2-CD1 3.69Å; F25-I65 HydrophobicContact CZ-CD1 4.17Å; F25-F85 HydrophobicContact CE2-CD1 4.38Å; F25-F85 HydrophobicContact CE2-CE1 4.02Å; F25-F85 HydrophobicContact CE2-CZ 4.3Å; F25-F85 AromaticContact CZ-CD1 3.96Å; F25-F85 HydrophobicContact CZ-CD1 3.96Å; F25-F85 AromaticContact CZ-CE1 3.69Å; F25-F85 HydrophobicContact CZ-CE1 3.69Å; F25-F85 HydrophobicContact CZ-CZ 4.4Å; F25-L94 HydrophobicContact CE1-CD1 3.97Å; F25-L94 HydrophobicContact CZ-CD1 4.01Å
26	N	95.6	Very high	92.4	Very high	90 Å²	90	56.5 Å²	56.5	48%	0.481	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	147.4	173.5	-67.2	-4.9	0	0	0	110	V44 S45 R46	N26-V44 WeakPolarHBondContact O-CA 3.39Å; N26-S45 VanDerWaalsContact CB-OG 3.31Å; N26-S45 WeakPolarHBondContact CB-OG 3.36Å; N26-S45 PolarHBondContact O-N 3.49Å; N26-S45 PolarHBondContact O-OG 3.32Å; N26-R46 HydrophobicContact CB-CB 4.18Å; N26-R46 PolarHBondContact N-O 2.84Å
27	I	95.8	Very high	91.8	Very high	26 Å²	26	61.4 Å²	61.4	13%	0.133	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	152.9	175.6	63.9	167.4	0	0	0	111.8	F25 I42 Y43 I65 A81 V82 F85	F25-I27 HydrophobicContact CD2-CG2 3.78Å; F25-I27 HydrophobicContact CE2-CG2 3.55Å; I27-I42 HydrophobicContact CB-CG2 3.85Å; I27-I42 HydrophobicContact CD1-CG2 3.93Å; I27-I42 HydrophobicContact CG1-CG2 4.48Å; I27-I42 HydrophobicContact CG2-CG2 4.03Å; I27-Y43 CarbonylContact C-O 3.54Å; I27-Y43 WeakPolarHBondContact CA-O 3.24Å; I27-I65 HydrophobicContact CG2-CD1 4.09Å; I27-A81 HydrophobicContact CD1-CB 4.27Å; I27-V82 HydrophobicContact CD1-CG2 3.82Å; I27-V82 HydrophobicContact CG1-CG2 4.32Å; I27-F85 HydrophobicContact CD1-CD2 3.81Å; I27-F85 HydrophobicContact CD1-CE2 3.8Å; I27-F85 HydrophobicContact CG2-CE2 4.07Å; I27-F85 HydrophobicContact CG2-CZ 4.39Å
28	V	95	Very high	91.2	Very high	39 Å²	39	64.3 Å²	64.3	24%	0.236	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	170.7	168.2	-68.3	0	0	0	0	108.5	Y35 Y43	V28-Y35 HydrophobicContact CB-CD2 4.26Å; V28-Y35 HydrophobicContact CB-CG 4.45Å; V28-Y35 HydrophobicContact CG2-CD1 3.99Å; V28-Y35 HydrophobicContact CG2-CD2 3.59Å; V28-Y35 HydrophobicContact CG2-CE1 4.34Å; V28-Y35 HydrophobicContact CG2-CE2 3.97Å; V28-Y35 HydrophobicContact CG2-CG 3.61Å; V28-Y43 PolarHBondContact N-O 3.2Å; V28-Y43 PolarHBondContact O-N 3.27Å
29	G	94.1	Very high	90.9	Very high	2 Å²	2	63 Å²	63	2%	0.021	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	98.3	-176.3	-175.7	0	0	0	0	0	112.4	Q33 G41 H78	G29-Q33 CarbonylContact C-O 3.57Å; G29-Q33 VanDerWaalsContact C-O 3.29Å; G29-Q33 WeakPolarHBondContact CA-O 3.32Å; G29-G41 VanDerWaalsContact CA-O 3.29Å; G29-G41 WeakPolarHBondContact CA-O 3.46Å; G29-H78 WeakPolarHBondContact O-CB 3.36Å; G29-H78 PolarHBondContact O-ND1 3.11Å
30	G	93.4	Very high	90.7	Very high	0 Å²	0	62.8 Å²	62.8	0%	0	35%	0.354	C	S	.	.			trans	119.2	162.3	-169.4	0	0	0	0	0	110.9	D32 Q33 Q34 G41 L76	G30-D32 PolarHBondContact O-N 3.1Å; G30-Q33 CarbonylContact O-C 3.48Å; G30-Q33 PolarHBondContact O-N 3.5Å; G30-Q34 PolarHBondContact O-N 3.05Å; G30-G41 PolarHBondContact N-O 3.18Å; G30-L76 CarbonylContact C-O 3.56Å; G30-L76 VanDerWaalsContact CA-O 3.28Å; G30-L76 WeakPolarHBondContact CA-O 3.49Å
31	T	91.4	Very high	90.9	Very high	54 Å²	54	55.7 Å²	55.7	33%	0.331	31%	0.309	S	S	.	.	S	Bend	trans	-65.6	-26.9	179.9	49.1	0	0	0	0	113.2	N75 L76 L77	T31-N75 VanDerWaalsContact CG2-C 3.43Å; T31-N75 HydrophobicContact CG2-CB 4.2Å; T31-N75 WeakPolarHBondContact CG2-O 3.4Å; T31-L76 PolarHBondContact N-O 3.28Å; T31-L76 PolarHBondContact OG1-O 2.99Å; T31-L77 WeakPolarHBondContact OG1-CD2 3.42Å
32	D	91	Very high	91.3	Very high	83 Å²	83	51.7 Å²	51.7	44%	0.444	28%	0.281	S	S	.	.	S	Bend	trans	-88.2	-20.4	176	61.5	-46.4	0	0	0	113.4	G30 L77 H78	G30-D32 PolarHBondContact O-N 3.1Å; D32-L77 HydrophobicContact CB-CD2 3.85Å; D32-L77 WeakPolarHBondContact OD1-CA 3.44Å; D32-H78 WeakPolarHBondContact OD1-CB 3.23Å; D32-H78 PolarHBondContact OD1-N 2.88Å
33	Q	88.9	Confident	91.4	Very high	102 Å²	102	51.7 Å²	51.7	48%	0.477	28%	0.276	S	S	.	.	S	Bend	trans	-135.7	62.2	-173.4	-69.7	176.7	53.4	0	0	111	G29 G30 Y35	G29-Q33 CarbonylContact C-O 3.57Å; G29-Q33 VanDerWaalsContact C-O 3.29Å; G29-Q33 WeakPolarHBondContact CA-O 3.32Å; G30-Q33 CarbonylContact O-C 3.48Å; G30-Q33 PolarHBondContact O-N 3.5Å; Q33-Y35 PolarHBondContact O-N 3.21Å; Q33-Y35 VanDerWaalsContact O-N 3.1Å
34	Q	84.9	Confident	91.4	Very high	105 Å²	105	51.1 Å²	51.1	49%	0.491	27%	0.273	S	S	.	.			trans	-59.1	116.4	-178.1	-69.3	-173.5	-14.8	0	0	111.7	G30 S40	G30-Q34 PolarHBondContact O-N 3.05Å; Q34-S40 PolarHBondContact NE2-OG 3.4Å
35	Y	85	Confident	91.3	Very high	134 Å²	134	52.9 Å²	52.9	53%	0.525	28%	0.284	S	S	.	.	S	Bend	trans	-84.4	-35.3	176.6	-179.3	-113.3	0	0	0	111.9	V28 Q33 Y43	V28-Y35 HydrophobicContact CB-CD2 4.26Å; V28-Y35 HydrophobicContact CB-CG 4.45Å; V28-Y35 HydrophobicContact CG2-CD1 3.99Å; V28-Y35 HydrophobicContact CG2-CD2 3.59Å; V28-Y35 HydrophobicContact CG2-CE1 4.34Å; V28-Y35 HydrophobicContact CG2-CE2 3.97Å; V28-Y35 HydrophobicContact CG2-CG 3.61Å; Q33-Y35 PolarHBondContact O-N 3.21Å; Q33-Y35 VanDerWaalsContact O-N 3.1Å; Y35-Y43 HydrophobicContact CD1-CD1 4.38Å; Y35-Y43 AromaticContact CD1-CD2 3.77Å; Y35-Y43 HydrophobicContact CD1-CD2 3.77Å; Y35-Y43 HydrophobicContact CD1-CE2 4.32Å; Y35-Y43 AromaticContact CD1-CG 3.8Å; Y35-Y43 HydrophobicContact CD1-CG 3.8Å; Y35-Y43 HydrophobicContact CE1-CG 4.45Å; Y35-Y43 HydrophobicContact CG-CD2 4.3Å
36	V	84.3	Confident	91.1	Very high	52 Å²	52	58.7 Å²	58.7	32%	0.315	31%	0.306	S	S	.	.	B	Isolated β-bridge	trans	-115.6	133.9	176.3	174.1	0	0	0	0	108.4	N38 D39 Y43	V36-N38 PolarHBondContact O-N 2.91Å; V36-D39 HydrophobicContact CB-CB 4Å; V36-D39 HydrophobicContact CG1-CB 4.01Å; V36-D39 PolarHBondContact O-N 2.64Å; V36-D39 VanDerWaalsContact O-O 3.14Å; V36-Y43 HydrophobicContact CB-CE2 4.46Å; V36-Y43 HydrophobicContact CG2-CE1 4.05Å; V36-Y43 HydrophobicContact CG2-CE2 4.12Å
37	S	82.6	Confident	91.1	Very high	108 Å²	108	55.8 Å²	55.8	76%	0.755	29%	0.29	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.7	126.2	-178.2	-54.7	0	0	0	0	111.4	D39	S37-D39 PolarHBondContact O-N 3.02Å
38	N	85.3	Confident	91	Very high	160 Å²	160	59.4 Å²	59.4	86%	0.856	31%	0.305	S	S	*	.	T	Hydrogen-bonded Turn	trans	63	21.7	-175.6	-52.2	-57.6	0	0	0	115.1	V36	V36-N38 PolarHBondContact O-N 2.91Å
39	D	87.4	Confident	90.9	Very high	47 Å²	47	64.9 Å²	64.9	25%	0.251	33%	0.327	S	S	.	.	B	Isolated β-bridge	trans	-131.2	116.1	172.6	-166.5	-15.5	0	0	0	110.4	V36 S37 G41 Y43 K64	V36-D39 HydrophobicContact CB-CB 4Å; V36-D39 HydrophobicContact CG1-CB 4.01Å; V36-D39 PolarHBondContact O-N 2.64Å; V36-D39 VanDerWaalsContact O-O 3.14Å; S37-D39 PolarHBondContact O-N 3.02Å; D39-G41 PolarHBondContact O-N 3.22Å; D39-G41 PolarHBondContact OD1-N 2.78Å; D39-Y43 WeakPolarHBondContact CB-OH 3.45Å; D39-Y43 PolarHBondContact OD1-OH 3.39Å; D39-Y43 PolarHBondContact OD2-OH 3.44Å; D39-K64 IonicContact OD1-NZ 3.11Å; D39-K64 PolarHBondContact OD1-NZ 3.26Å; D39-K64 IonicContact OD2-NZ 2.74Å; D39-K64 PolarHBondContact OD2-NZ 3.45Å
40	S	90.7	Very high	90.8	Very high	22 Å²	22	71.3 Å²	71.3	15%	0.154	36%	0.362	C	S	.	.			trans	-91	23.6	179.6	-55.2	0	0	0	0	112.6	Q34	Q34-S40 PolarHBondContact NE2-OG 3.4Å
41	G	93.8	Very high	90.7	Very high	4 Å²	4	71.6 Å²	71.6	4%	0.041	37%	0.365	C	S	.	.			trans	-73.1	167.6	179.1	0	0	0	0	0	114.2	G29 G30 D39 Y43	G29-G41 VanDerWaalsContact CA-O 3.29Å; G29-G41 WeakPolarHBondContact CA-O 3.46Å; G30-G41 PolarHBondContact N-O 3.18Å; D39-G41 PolarHBondContact O-N 3.22Å; D39-G41 PolarHBondContact OD1-N 2.78Å; G41-Y43 WeakPolarHBondContact O-CD2 3.44Å; G41-Y43 VanDerWaalsContact O-CE2 3.3Å; G41-Y43 WeakPolarHBondContact O-CE2 3.41Å
42	I	96.6	Very high	90.9	Very high	0 Å²	0	69.9 Å²	69.9	0%	0	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	132.9	172.4	-54.4	-57.6	0	0	0	109.2	I27 K64 I65 L73 A81 F85	I27-I42 HydrophobicContact CB-CG2 3.85Å; I27-I42 HydrophobicContact CD1-CG2 3.93Å; I27-I42 HydrophobicContact CG1-CG2 4.48Å; I27-I42 HydrophobicContact CG2-CG2 4.03Å; I42-K64 WeakPolarHBondContact O-CA 3.47Å; I42-I65 PolarHBondContact O-N 2.96Å; I42-L73 HydrophobicContact CB-CD1 4.12Å; I42-L73 HydrophobicContact CG1-CB 4.07Å; I42-L73 HydrophobicContact CG1-CD1 4.18Å; I42-L73 HydrophobicContact CG2-CD1 4.39Å; I42-A81 HydrophobicContact CD1-CB 3.61Å; I42-A81 HydrophobicContact CG1-CB 3.75Å; I42-F85 HydrophobicContact CG2-CE2 4.28Å
43	Y	95.2	Very high	91.1	Very high	16 Å²	16	66 Å²	66	6%	0.063	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	149.9	-176	-58.3	-95.5	0	0	0	111.3	I27 V28 Y35 V36 D39 G41 S45 D63 K64	I27-Y43 CarbonylContact C-O 3.54Å; I27-Y43 WeakPolarHBondContact CA-O 3.24Å; V28-Y43 PolarHBondContact N-O 3.2Å; V28-Y43 PolarHBondContact O-N 3.27Å; Y35-Y43 HydrophobicContact CD1-CD1 4.38Å; Y35-Y43 AromaticContact CD1-CD2 3.77Å; Y35-Y43 HydrophobicContact CD1-CD2 3.77Å; Y35-Y43 HydrophobicContact CD1-CE2 4.32Å; Y35-Y43 AromaticContact CD1-CG 3.8Å; Y35-Y43 HydrophobicContact CD1-CG 3.8Å; Y35-Y43 HydrophobicContact CE1-CG 4.45Å; Y35-Y43 HydrophobicContact CG-CD2 4.3Å; V36-Y43 HydrophobicContact CB-CE2 4.46Å; V36-Y43 HydrophobicContact CG2-CE1 4.05Å; V36-Y43 HydrophobicContact CG2-CE2 4.12Å; D39-Y43 WeakPolarHBondContact CB-OH 3.45Å; D39-Y43 PolarHBondContact OD1-OH 3.39Å; D39-Y43 PolarHBondContact OD2-OH 3.44Å; G41-Y43 WeakPolarHBondContact O-CD2 3.44Å; G41-Y43 VanDerWaalsContact O-CE2 3.3Å; G41-Y43 WeakPolarHBondContact O-CE2 3.41Å; Y43-S45 PolarHBondContact O-N 3.27Å; Y43-D63 CarbonylContact C-O 3.54Å; Y43-D63 VanDerWaalsContact CA-O 3.3Å; Y43-D63 WeakPolarHBondContact CA-O 3.43Å; Y43-K64 HydrophobicContact CD1-CB 3.81Å; Y43-K64 HydrophobicContact CD1-CG 4.17Å; Y43-K64 HydrophobicContact CE1-CB 3.72Å; Y43-K64 HydrophobicContact CE1-CD 4.01Å; Y43-K64 HydrophobicContact CE1-CG 3.84Å
44	V	95.5	Very high	91.4	Very high	0 Å²	0	63 Å²	63	0%	0	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.1	115.7	169.2	-179.1	0	0	0	0	108.7	F25 N26 I47 L59 Q60 G62 D63 I65	F25-V44 HydrophobicContact CB-CG1 4.3Å; F25-V44 HydrophobicContact CD2-CG2 4.49Å; N26-V44 WeakPolarHBondContact O-CA 3.39Å; V44-I47 HydrophobicContact CG1-CD1 3.6Å; V44-I47 HydrophobicContact CG1-CG1 4.25Å; V44-L59 HydrophobicContact CG2-CD1 3.93Å; V44-L59 HydrophobicContact CG2-CD2 3.96Å; V44-L59 HydrophobicContact CG2-CG 4.01Å; V44-Q60 WeakPolarHBondContact CB-O 3.4Å; V44-G62 PolarHBondContact O-N 3.49Å; V44-D63 HydrophobicContact CG2-CB 4.25Å; V44-D63 PolarHBondContact N-O 2.96Å; V44-I65 HydrophobicContact CG2-CD1 3.86Å; V44-I65 HydrophobicContact CG2-CG1 3.98Å
45	S	93.8	Very high	91.8	Very high	41 Å²	41	64.2 Å²	64.2	29%	0.287	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	-30.1	174.9	56	0	0	0	0	112.9	N26 Y43	N26-S45 VanDerWaalsContact CB-OG 3.31Å; N26-S45 WeakPolarHBondContact CB-OG 3.36Å; N26-S45 PolarHBondContact O-N 3.49Å; N26-S45 PolarHBondContact O-OG 3.32Å; Y43-S45 PolarHBondContact O-N 3.27Å
46	R	93.8	Very high	92.3	Very high	148 Å²	148	60.5 Å²	60.5	56%	0.558	33%	0.326	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-154.7	140.9	-178.1	-166.5	175.9	-179.4	-176.3	0.4	112.1	F25 N26 E61	F25-R46 CarbonylContact C-O 3.52Å; F25-R46 VanDerWaalsContact CA-O 3.23Å; F25-R46 WeakPolarHBondContact CA-O 3.18Å; F25-R46 WeakPolarHBondContact CB-O 3.48Å; N26-R46 HydrophobicContact CB-CB 4.18Å; N26-R46 PolarHBondContact N-O 2.84Å; R46-E61 VanDerWaalsContact CA-OE1 3.26Å; R46-E61 WeakPolarHBondContact CA-OE1 3.21Å; R46-E61 WeakPolarHBondContact CG-OE1 3.33Å
47	I	94.4	Very high	92.7	Very high	29 Å²	29	60.4 Å²	60.4	15%	0.149	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	129.1	166.3	-59.3	-61.3	0	0	0	109.2	F25 V44 A53 A54 L59 E61	F25-I47 HydrophobicContact CB-CD1 3.77Å; V44-I47 HydrophobicContact CG1-CD1 3.6Å; V44-I47 HydrophobicContact CG1-CG1 4.25Å; I47-A53 HydrophobicContact CD1-CB 4.3Å; I47-A54 HydrophobicContact CG2-CB 3.68Å; I47-L59 HydrophobicContact CD1-CB 4.24Å; I47-L59 HydrophobicContact CD1-CD2 3.79Å; I47-L59 HydrophobicContact CD1-CG 3.9Å; I47-E61 HydrophobicContact CB-CG 4.46Å; I47-E61 HydrophobicContact CG1-CG 3.96Å; I47-E61 PolarHBondContact N-OE1 2.95Å
48	K	93.9	Very high	93.3	Very high	102 Å²	102	59.1 Å²	59.1	44%	0.443	31%	0.314	S	S	.	.	P	Polyproline II helix	trans	-79.8	123.8	178.6	-173.1	-177.5	178.2	-179.1	0	109.3	S21 G24 N50 G51 A54	S21-K48 PolarHBondContact OG-NZ 3.02Å; S21-K48 VanDerWaalsContact OG-NZ 3.1Å; G24-K48 WeakPolarHBondContact O-CB 3.45Å; G24-K48 PolarHBondContact O-N 2.92Å; K48-N50 PolarHBondContact O-N 3.01Å; K48-G51 WeakPolarHBondContact O-CA 3.34Å; K48-G51 PolarHBondContact O-N 2.91Å; K48-A54 VanDerWaalsContact O-CB 3.25Å; K48-A54 WeakPolarHBondContact O-CB 3.35Å
49	E	92.3	Very high	93.7	Very high	153 Å²	153	51.9 Å²	51.9	72%	0.715	28%	0.275	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.2	135.8	172	-66.4	-179.5	174.3	0	0	111.2	G51	E49-G51 PolarHBondContact O-N 3.2Å
50	N	91.8	Very high	94	Very high	138 Å²	138	54.7 Å²	54.7	74%	0.738	29%	0.287	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.6	12.5	-176.7	-51.2	-57.8	0	0	0	114.8	K48	K48-N50 PolarHBondContact O-N 3.01Å
51	G	93	Very high	94.1	Very high	6 Å²	6	59.1 Å²	59.1	6%	0.062	31%	0.305	C	S	.	.	S	Bend	trans	-78.5	166.3	171.9	0	0	0	0	0	112.4	K48 E49 A53 A54 L55	K48-G51 WeakPolarHBondContact O-CA 3.34Å; K48-G51 PolarHBondContact O-N 2.91Å; E49-G51 PolarHBondContact O-N 3.2Å; G51-A53 VanDerWaalsContact C-N 3.32Å; G51-A53 PolarHBondContact O-N 3.07Å; G51-A54 PolarHBondContact O-N 2.69Å; G51-L55 WeakPolarHBondContact O-CG 3.29Å; G51-L55 PolarHBondContact O-N 3.33Å
52	A	95.2	Very high	94	Very high	18 Å²	18	60.6 Å²	60.6	15%	0.149	32%	0.32	C	S	.	.	H	α-helix	trans	-56.7	-44	-179	0	0	0	0	0	112.7	T17 A54 L55 D56	T17-A52 WeakPolarHBondContact O-CB 3.35Å; A52-A54 PolarHBondContact O-N 3.45Å; A52-L55 PolarHBondContact O-N 3.38Å; A52-D56 PolarHBondContact O-N 3.05Å
53	A	95	Very high	93.9	Very high	0 Å²	0	60.8 Å²	60.8	0%	0	32%	0.321	C	S	.	.	H	α-helix	trans	-63.6	-37.6	174.9	0	0	0	0	0	113.6	L16 L23 F25 I47 G51 G57 L59	L16-A53 HydrophobicContact CD1-CB 4.01Å; L23-A53 WeakPolarHBondContact O-CB 3.29Å; L23-A53 PolarHBondContact O-N 3.29Å; F25-A53 HydrophobicContact CB-CB 4.49Å; F25-A53 HydrophobicContact CD1-CB 3.85Å; I47-A53 HydrophobicContact CD1-CB 4.3Å; G51-A53 VanDerWaalsContact C-N 3.32Å; G51-A53 PolarHBondContact O-N 3.07Å; A53-G57 PolarHBondContact O-N 2.94Å; A53-L59 HydrophobicContact CB-CB 4.39Å; A53-L59 HydrophobicContact CB-CD2 3.95Å
54	A	94.5	Very high	93.9	Very high	39 Å²	39	61.5 Å²	61.5	32%	0.322	33%	0.325	S	S	.	.	H	α-helix	trans	-68.4	-37.3	176.8	0	0	0	0	0	112.4	I47 K48 G51 A52 G57	I47-A54 HydrophobicContact CG2-CB 3.68Å; K48-A54 VanDerWaalsContact O-CB 3.25Å; K48-A54 WeakPolarHBondContact O-CB 3.35Å; G51-A54 PolarHBondContact O-N 2.69Å; A52-A54 PolarHBondContact O-N 3.45Å; A54-G57 PolarHBondContact O-N 2.89Å
55	L	93.9	Very high	94	Very high	132 Å²	132	61.6 Å²	61.6	69%	0.691	33%	0.325	S	S	*	.	H	α-helix	trans	-71.9	-33.6	178.1	-66.7	172.5	0	0	0	112.3	G51 A52	G51-L55 WeakPolarHBondContact O-CG 3.29Å; G51-L55 PolarHBondContact O-N 3.33Å; A52-L55 PolarHBondContact O-N 3.38Å
56	D	94.9	Very high	94.1	Very high	55 Å²	55	60.1 Å²	60.1	29%	0.294	31%	0.314	S	S	.	.	H	α-helix	trans	-70.2	-41.3	170.3	178	-82.5	0	0	0	111.2	L16 A52 R58	L16-D56 HydrophobicContact CD2-CB 3.51Å; A52-D56 PolarHBondContact O-N 3.05Å; D56-R58 VanDerWaalsContact C-N 3.29Å; D56-R58 PolarHBondContact O-N 3.41Å; D56-R58 VanDerWaalsContact OD1-CB 3.29Å; D56-R58 WeakPolarHBondContact OD1-CB 3.47Å; D56-R58 WeakPolarHBondContact OD1-CG 3.2Å; D56-R58 IonicContact OD1-CZ 3.29Å; D56-R58 PolarHBondContact OD1-N 3.46Å; D56-R58 IonicContact OD1-NE 2.91Å; D56-R58 PolarHBondContact OD1-NE 3.04Å; D56-R58 IonicContact OD1-NH2 3.06Å; D56-R58 IonicContact OD2-CZ 3.49Å; D56-R58 IonicContact OD2-NE 3.66Å; D56-R58 PolarHBondContact OD2-NE 3.06Å; D56-R58 IonicContact OD2-NH2 3.67Å; D56-R58 PolarHBondContact OD2-NH2 2.91Å
57	G	93.9	Very high	94.3	Very high	50 Å²	50	53.5 Å²	53.5	52%	0.515	29%	0.29	S	S	.	.			trans	80.4	-3.1	169	0	0	0	0	0	115.9	A53 A54	A53-G57 PolarHBondContact O-N 2.94Å; A54-G57 PolarHBondContact O-N 2.89Å
58	R	94.4	Very high	94.4	Very high	82 Å²	82	52.4 Å²	52.4	31%	0.309	29%	0.285	S	S	.	.			trans	-87.6	-31.5	-179.4	-59.2	178.8	-65.6	156.8	-13.3	113.3	E12 E13 I14 D56 H98	E12-R58 WeakPolarHBondContact OE1-CD 3.25Å; E12-R58 IonicContact OE1-CZ 3.85Å; E12-R58 IonicContact OE1-NE 3.72Å; E12-R58 IonicContact OE1-NH1 2.88Å; E12-R58 PolarHBondContact OE1-NH1 3.43Å; E13-R58 PolarHBondContact O-NH1 3.34Å; I14-R58 HydrophobicContact CD1-CB 3.89Å; I14-R58 HydrophobicContact CG1-CB 4.28Å; D56-R58 VanDerWaalsContact C-N 3.29Å; D56-R58 PolarHBondContact O-N 3.41Å; D56-R58 VanDerWaalsContact OD1-CB 3.29Å; D56-R58 WeakPolarHBondContact OD1-CB 3.47Å; D56-R58 WeakPolarHBondContact OD1-CG 3.2Å; D56-R58 IonicContact OD1-CZ 3.29Å; D56-R58 PolarHBondContact OD1-N 3.46Å; D56-R58 IonicContact OD1-NE 2.91Å; D56-R58 PolarHBondContact OD1-NE 3.04Å; D56-R58 IonicContact OD1-NH2 3.06Å; D56-R58 IonicContact OD2-CZ 3.49Å; D56-R58 IonicContact OD2-NE 3.66Å; D56-R58 PolarHBondContact OD2-NE 3.06Å; D56-R58 IonicContact OD2-NH2 3.67Å; D56-R58 PolarHBondContact OD2-NH2 2.91Å; R58-H98 PolarHBondContact O-CE1 2.92Å
59	L	94.4	Very high	94.5	Very high	7 Å²	7	51.2 Å²	51.2	4%	0.037	28%	0.283	C	S	.	.			trans	-76.7	130.2	176.9	-168.8	70.8	0	0	0	110.8	I14 F25 V44 I47 A53 D63 V96	I14-L59 HydrophobicContact CD1-CB 4.1Å; I14-L59 HydrophobicContact CD1-CD1 4.12Å; F25-L59 HydrophobicContact CB-CD2 4.22Å; F25-L59 HydrophobicContact CD1-CD2 3.57Å; F25-L59 HydrophobicContact CD2-CD2 4.39Å; F25-L59 HydrophobicContact CE1-CD2 3.92Å; F25-L59 HydrophobicContact CG-CD2 3.82Å; F25-L59 HydrophobicContact CZ-CD2 4.49Å; V44-L59 HydrophobicContact CG2-CD1 3.93Å; V44-L59 HydrophobicContact CG2-CD2 3.96Å; V44-L59 HydrophobicContact CG2-CG 4.01Å; I47-L59 HydrophobicContact CD1-CB 4.24Å; I47-L59 HydrophobicContact CD1-CD2 3.79Å; I47-L59 HydrophobicContact CD1-CG 3.9Å; A53-L59 HydrophobicContact CB-CB 4.39Å; A53-L59 HydrophobicContact CB-CD2 3.95Å; L59-D63 HydrophobicContact CD1-CB 4.33Å; L59-V96 HydrophobicContact CD1-CB 4.37Å; L59-V96 HydrophobicContact CD1-CG1 3.71Å
60	Q	93.6	Very high	94.6	Very high	106 Å²	106	47.3 Å²	47.3	50%	0.495	28%	0.284	S	S	.	.			trans	-121.1	157.3	-176.7	-60	-179.1	24.1	0	0	112.1	V44 D63	V44-Q60 WeakPolarHBondContact CB-O 3.4Å; Q60-D63 PolarHBondContact N-OD2 3.36Å; Q60-D63 VanDerWaalsContact O-CB 3.31Å; Q60-D63 WeakPolarHBondContact O-CB 3.21Å; Q60-D63 VanDerWaalsContact O-CG 3.28Å; Q60-D63 PolarHBondContact O-N 3.06Å
61	E	92.9	Very high	94.8	Very high	116 Å²	116	45.7 Å²	45.7	54%	0.542	27%	0.272	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.1	136.2	172.4	-60.5	-174.2	169.4	0	0	110.5	R46 I47 D63	R46-E61 VanDerWaalsContact CA-OE1 3.26Å; R46-E61 WeakPolarHBondContact CA-OE1 3.21Å; R46-E61 WeakPolarHBondContact CG-OE1 3.33Å; I47-E61 HydrophobicContact CB-CG 4.46Å; I47-E61 HydrophobicContact CG1-CG 3.96Å; I47-E61 PolarHBondContact N-OE1 2.95Å; E61-D63 VanDerWaalsContact C-N 3.32Å
62	G	91.4	Very high	94.9	Very high	34 Å²	34	48.5 Å²	48.5	35%	0.351	29%	0.285	S	S	.	.	T	Hydrogen-bonded Turn	trans	87.4	-6.4	-174.2	0	0	0	0	0	114.6	V44	V44-G62 PolarHBondContact O-N 3.49Å
63	D	94	Very high	94.9	Very high	4 Å²	4	47.7 Å²	47.7	2%	0.021	28%	0.279	C	S	.	.	P	Polyproline II helix	trans	-63	140.4	172.5	-74	-15.9	0	0	0	111	Y43 V44 L59 Q60 E61 H98	Y43-D63 CarbonylContact C-O 3.54Å; Y43-D63 VanDerWaalsContact CA-O 3.3Å; Y43-D63 WeakPolarHBondContact CA-O 3.43Å; V44-D63 HydrophobicContact CG2-CB 4.25Å; V44-D63 PolarHBondContact N-O 2.96Å; L59-D63 HydrophobicContact CD1-CB 4.33Å; Q60-D63 PolarHBondContact N-OD2 3.36Å; Q60-D63 VanDerWaalsContact O-CB 3.31Å; Q60-D63 WeakPolarHBondContact O-CB 3.21Å; Q60-D63 VanDerWaalsContact O-CG 3.28Å; Q60-D63 PolarHBondContact O-N 3.06Å; E61-D63 VanDerWaalsContact C-N 3.32Å; D63-H98 WeakPolarHBondContact OD1-CA 3.3Å; D63-H98 IonicContact OD1-CE1 3.64Å; D63-H98 IonicContact OD1-CG 2.68Å; D63-H98 IonicContact OD1-ND1 3.15Å; D63-H98 PolarHBondContact OD1-ND1 3.32Å; D63-H98 IonicContact OD2-CE1 2.84Å; D63-H98 PolarHBondContact OD2-CE1 3.35Å; D63-H98 IonicContact OD2-ND1 3.86Å; D63-H98 PolarHBondContact OD2-ND1 3.37Å
64	K	95.3	Very high	94.7	Very high	32 Å²	32	53.2 Å²	53.2	14%	0.139	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	125.6	172.8	-176.7	179.5	-172.3	164.8	0	109.3	D39 I42 Y43 L66 V96 Q97	D39-K64 IonicContact OD1-NZ 3.11Å; D39-K64 PolarHBondContact OD1-NZ 3.26Å; D39-K64 IonicContact OD2-NZ 2.74Å; D39-K64 PolarHBondContact OD2-NZ 3.45Å; I42-K64 WeakPolarHBondContact O-CA 3.47Å; Y43-K64 HydrophobicContact CD1-CB 3.81Å; Y43-K64 HydrophobicContact CD1-CG 4.17Å; Y43-K64 HydrophobicContact CE1-CB 3.72Å; Y43-K64 HydrophobicContact CE1-CD 4.01Å; Y43-K64 HydrophobicContact CE1-CG 3.84Å; K64-L66 HydrophobicContact CD-CD2 4.06Å; K64-L66 HydrophobicContact CG-CD2 4.1Å; K64-V96 CarbonylContact O-C 3.59Å; K64-V96 VanDerWaalsContact O-CA 3.31Å; K64-V96 WeakPolarHBondContact O-CA 3.44Å; K64-Q97 HydrophobicContact CB-CB 4.22Å; K64-Q97 PolarHBondContact N-O 2.89Å; K64-Q97 PolarHBondContact O-N 2.93Å
65	I	97.1	Very high	94.5	Very high	2 Å²	2	57.2 Å²	57.2	1%	0.01	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	119.6	176.2	-48.5	175.5	0	0	0	108.2	F25 I27 I42 V44 V68 L73 F85 L94 V96	F25-I65 HydrophobicContact CD2-CD1 4.45Å; F25-I65 HydrophobicContact CE2-CD1 3.69Å; F25-I65 HydrophobicContact CZ-CD1 4.17Å; I27-I65 HydrophobicContact CG2-CD1 4.09Å; I42-I65 PolarHBondContact O-N 2.96Å; V44-I65 HydrophobicContact CG2-CD1 3.86Å; V44-I65 HydrophobicContact CG2-CG1 3.98Å; I65-V68 HydrophobicContact CG2-CG2 4.42Å; I65-L73 HydrophobicContact CB-CD1 4.01Å; I65-L73 HydrophobicContact CG2-CD1 3.7Å; I65-F85 HydrophobicContact CB-CZ 4.44Å; I65-F85 HydrophobicContact CD1-CE1 4.09Å; I65-F85 HydrophobicContact CD1-CE2 4.47Å; I65-F85 HydrophobicContact CD1-CZ 3.55Å; I65-F85 HydrophobicContact CG2-CE1 4.49Å; I65-F85 HydrophobicContact CG2-CZ 4.02Å; I65-L94 HydrophobicContact CG2-CD2 4.5Å; I65-V96 HydrophobicContact CG1-CG1 4.33Å; I65-V96 HydrophobicContact CG2-CG1 4.38Å
66	L	96.5	Very high	94.5	Very high	10 Å²	10	52.7 Å²	52.7	5%	0.052	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.5	-37.7	-176.5	-56	-179.5	0	0	0	112	E11 K64 L73 R95 Q97	E11-L66 HydrophobicContact CG-CD1 3.89Å; E11-L66 WeakPolarHBondContact OE1-CD1 3.4Å; E11-L66 WeakPolarHBondContact OE2-CD1 3.26Å; K64-L66 HydrophobicContact CD-CD2 4.06Å; K64-L66 HydrophobicContact CG-CD2 4.1Å; L66-L73 PolarHBondContact O-N 2.86Å; L66-R95 WeakPolarHBondContact CA-O 3.39Å; L66-R95 HydrophobicContact CB-CB 4.46Å; L66-R95 HydrophobicContact CB-CG 4.39Å; L66-R95 WeakPolarHBondContact CB-O 3.04Å; L66-R95 HydrophobicContact CD1-CG 4.31Å; L66-R95 PolarHBondContact N-O 2.92Å; L66-Q97 HydrophobicContact CD1-CB 4.08Å; L66-Q97 HydrophobicContact CD2-CB 4.26Å; L66-Q97 HydrophobicContact CG-CB 4.17Å
67	S	97.4	Very high	94.5	Very high	8 Å²	8	53.9 Å²	53.9	6%	0.056	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.5	158.1	177.2	54.1	0	0	0	0	113.3	Q71 L94 R95	S67-Q71 CarbonylContact C-O 3.51Å; S67-Q71 WeakPolarHBondContact CA-O 3.33Å; S67-Q71 WeakPolarHBondContact CB-O 3.44Å; S67-L94 WeakPolarHBondContact O-CA 3.08Å; S67-R95 PolarHBondContact N-O 3.15Å; S67-R95 PolarHBondContact O-N 2.88Å; S67-R95 VanDerWaalsContact OG-CB 3.23Å; S67-R95 WeakPolarHBondContact OG-CB 3.46Å; S67-R95 PolarHBondContact OG-NE 2.99Å; S67-R95 PolarHBondContact OG-NH2 2.77Å; S67-R95 VanDerWaalsContact OG-NH2 3.08Å
68	V	97.4	Very high	94.5	Very high	6 Å²	6	53 Å²	53	4%	0.036	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	122.6	174.9	-179.1	0	0	0	0	108.5	I65 G70 Q71 L73 F85 A88 V92 S93 L94	I65-V68 HydrophobicContact CG2-CG2 4.42Å; V68-G70 PolarHBondContact O-N 2.76Å; V68-G70 VanDerWaalsContact O-N 3.15Å; V68-Q71 PolarHBondContact N-O 2.97Å; V68-Q71 WeakPolarHBondContact O-CB 3.48Å; V68-Q71 PolarHBondContact O-N 3.26Å; V68-L73 HydrophobicContact CG2-CD1 3.81Å; V68-L73 HydrophobicContact CG2-CD2 4.14Å; V68-L73 HydrophobicContact CG2-CG 4.17Å; V68-F85 HydrophobicContact CB-CE1 4.48Å; V68-F85 HydrophobicContact CG1-CD1 4.33Å; V68-F85 HydrophobicContact CG1-CE1 4.47Å; V68-F85 HydrophobicContact CG2-CD1 3.76Å; V68-F85 HydrophobicContact CG2-CE1 3.2Å; V68-F85 HydrophobicContact CG2-CE2 4.21Å; V68-F85 HydrophobicContact CG2-CG 4.47Å; V68-F85 HydrophobicContact CG2-CZ 3.46Å; V68-F85 VanDerWaalsContact CG2-CZ 3.46Å; V68-A88 HydrophobicContact CG1-CB 3.72Å; V68-V92 HydrophobicContact CG1-CG1 3.71Å; V68-S93 CarbonylContact C-O 3.57Å; V68-S93 WeakPolarHBondContact CA-O 3.22Å; V68-L94 HydrophobicContact CB-CD2 4.37Å; V68-L94 HydrophobicContact CG1-CD2 4.23Å; V68-L94 HydrophobicContact CG2-CD2 3.79Å
69	N	96.3	Very high	94.6	Very high	78 Å²	78	53.3 Å²	53.3	42%	0.417	29%	0.288	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.4	37.8	-177.7	-64.6	-13	0	0	0	113.1	Q71 A88 V92 S93	N69-Q71 VanDerWaalsContact C-N 3.28Å; N69-Q71 PolarHBondContact O-N 2.78Å; N69-A88 PolarHBondContact ND2-O 2.83Å; N69-V92 VanDerWaalsContact OD1-CA 3.3Å; N69-V92 WeakPolarHBondContact OD1-CA 3.3Å; N69-S93 PolarHBondContact N-O 2.83Å; N69-S93 PolarHBondContact OD1-N 2.96Å
70	G	94.4	Very high	94.7	Very high	70 Å²	70	56.5 Å²	56.5	72%	0.722	31%	0.305	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.4	-7	-177.1	0	0	0	0	0	115.5	V68	V68-G70 PolarHBondContact O-N 2.76Å; V68-G70 VanDerWaalsContact O-N 3.15Å
71	Q	95.7	Very high	94.8	Very high	105 Å²	105	51.4 Å²	51.4	49%	0.491	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	122	175.3	-174.4	168.7	-15	0	0	111.2	S67 V68 N69 L84	S67-Q71 CarbonylContact C-O 3.51Å; S67-Q71 WeakPolarHBondContact CA-O 3.33Å; S67-Q71 WeakPolarHBondContact CB-O 3.44Å; V68-Q71 PolarHBondContact N-O 2.97Å; V68-Q71 WeakPolarHBondContact O-CB 3.48Å; V68-Q71 PolarHBondContact O-N 3.26Å; N69-Q71 VanDerWaalsContact C-N 3.28Å; N69-Q71 PolarHBondContact O-N 2.78Å; Q71-L84 VanDerWaalsContact CD-CD2 3.46Å; Q71-L84 HydrophobicContact CG-CD1 4.21Å; Q71-L84 VanDerWaalsContact OE1-CD2 3.24Å
72	D	95.4	Very high	94.9	Very high	64 Å²	64	47 Å²	47	34%	0.342	26%	0.262	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.8	137.2	178.9	-160.4	-28.7	0	0	0	110.7	K74	D72-K74 WeakPolarHBondContact OD1-CB 3.34Å; D72-K74 WeakPolarHBondContact OD1-CD 3.41Å; D72-K74 WeakPolarHBondContact OD1-CG 3.33Å; D72-K74 PolarHBondContact OD1-N 2.7Å; D72-K74 WeakPolarHBondContact OD2-CD 3.31Å; D72-K74 WeakPolarHBondContact OD2-CE 3.49Å; D72-K74 IonicContact OD2-NZ 3.92Å; D72-K74 PolarHBondContact OD2-NZ 2.86Å; D72-K74 VanDerWaalsContact OD2-NZ 3.15Å
73	L	94.7	Very high	95.2	Very high	2 Å²	2	48 Å²	48	1%	0.01	26%	0.26	C	S	.	.			trans	-96.6	1.3	177.9	-65.3	-175.2	0	0	0	113.5	I42 I65 L66 V68 L76 A81 L84 F85	I42-L73 HydrophobicContact CB-CD1 4.12Å; I42-L73 HydrophobicContact CG1-CB 4.07Å; I42-L73 HydrophobicContact CG1-CD1 4.18Å; I42-L73 HydrophobicContact CG2-CD1 4.39Å; I65-L73 HydrophobicContact CB-CD1 4.01Å; I65-L73 HydrophobicContact CG2-CD1 3.7Å; L66-L73 PolarHBondContact O-N 2.86Å; V68-L73 HydrophobicContact CG2-CD1 3.81Å; V68-L73 HydrophobicContact CG2-CD2 4.14Å; V68-L73 HydrophobicContact CG2-CG 4.17Å; L73-L76 HydrophobicContact CB-CD1 4.45Å; L73-L76 HydrophobicContact CD2-CD1 3.79Å; L73-A81 HydrophobicContact CD2-CB 4.5Å; L73-L84 HydrophobicContact CD2-CB 4.48Å; L73-L84 HydrophobicContact CD2-CD1 3.55Å; L73-F85 HydrophobicContact CD1-CE2 3.85Å; L73-F85 HydrophobicContact CD1-CZ 3.66Å
74	K	90.3	Very high	95.3	Very high	115 Å²	115	49.5 Å²	49.5	50%	0.5	27%	0.268	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.4	139.7	178.1	-75.1	169.3	-161.6	155.3	0	111.8	D72 L76	D72-K74 WeakPolarHBondContact OD1-CB 3.34Å; D72-K74 WeakPolarHBondContact OD1-CD 3.41Å; D72-K74 WeakPolarHBondContact OD1-CG 3.33Å; D72-K74 PolarHBondContact OD1-N 2.7Å; D72-K74 WeakPolarHBondContact OD2-CD 3.31Å; D72-K74 WeakPolarHBondContact OD2-CE 3.49Å; D72-K74 IonicContact OD2-NZ 3.92Å; D72-K74 PolarHBondContact OD2-NZ 2.86Å; D72-K74 VanDerWaalsContact OD2-NZ 3.15Å; K74-L76 PolarHBondContact O-N 3.12Å; K74-L76 VanDerWaalsContact O-N 3.16Å
75	N	90.1	Very high	95.3	Very high	124 Å²	124	48.8 Å²	48.8	66%	0.663	26%	0.264	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.4	23.9	173	-53.9	-45.2	0	0	0	114.4	T31	T31-N75 VanDerWaalsContact CG2-C 3.43Å; T31-N75 HydrophobicContact CG2-CB 4.2Å; T31-N75 WeakPolarHBondContact CG2-O 3.4Å
76	L	93.7	Very high	95.2	Very high	37 Å²	37	56 Å²	56	19%	0.194	29%	0.292	C	S	.	.			trans	-85.8	152.4	172.7	-64.2	-175.1	0	0	0	111.1	G30 T31 L73 K74 D80 L84	G30-L76 CarbonylContact C-O 3.56Å; G30-L76 VanDerWaalsContact CA-O 3.28Å; G30-L76 WeakPolarHBondContact CA-O 3.49Å; T31-L76 PolarHBondContact N-O 3.28Å; T31-L76 PolarHBondContact OG1-O 2.99Å; L73-L76 HydrophobicContact CB-CD1 4.45Å; L73-L76 HydrophobicContact CD2-CD1 3.79Å; K74-L76 PolarHBondContact O-N 3.12Å; K74-L76 VanDerWaalsContact O-N 3.16Å; L76-D80 HydrophobicContact CB-CB 4.32Å; L76-L84 HydrophobicContact CD1-CD1 3.5Å; L76-L84 VanDerWaalsContact CD1-CD1 3.5Å
77	L	95.5	Very high	95.1	Very high	79 Å²	79	62 Å²	62	41%	0.414	32%	0.324	S	S	.	.			trans	-65.8	153.6	163	-62.8	168.4	0	0	0	108.8	T31 D32 Q79 D80 A81	T31-L77 WeakPolarHBondContact OG1-CD2 3.42Å; D32-L77 HydrophobicContact CB-CD2 3.85Å; D32-L77 WeakPolarHBondContact OD1-CA 3.44Å; L77-Q79 PolarHBondContact O-N 3.01Å; L77-D80 HydrophobicContact CB-CB 4.43Å; L77-D80 WeakPolarHBondContact CB-OD2 3.49Å; L77-D80 PolarHBondContact O-N 3.12Å; L77-A81 PolarHBondContact O-N 3.38Å; L77-A81 VanDerWaalsContact O-N 3.11Å
78	H	94	Very high	94.9	Very high	33 Å²	33	62.1 Å²	62.1	15%	0.153	33%	0.326	C	S	.	.	H	α-helix	trans	-51.8	-46.3	175.4	-177.5	77.2	0	0	0	111.3	G29 D32 A81 V82	G29-H78 WeakPolarHBondContact O-CB 3.36Å; G29-H78 PolarHBondContact O-ND1 3.11Å; D32-H78 WeakPolarHBondContact OD1-CB 3.23Å; D32-H78 PolarHBondContact OD1-N 2.88Å; H78-A81 PolarHBondContact O-N 3.28Å; H78-V82 WeakPolarHBondContact O-CG2 3.3Å; H78-V82 PolarHBondContact O-N 2.77Å
79	Q	96.3	Very high	94.7	Very high	88 Å²	88	63.7 Å²	63.7	41%	0.411	34%	0.343	S	S	.	.	H	α-helix	trans	-66	-40	-177.7	-170.7	52.6	52.2	0	0	112.6	L77 A81 V82 D83	L77-Q79 PolarHBondContact O-N 3.01Å; Q79-A81 VanDerWaalsContact C-N 3.32Å; Q79-A81 PolarHBondContact O-N 2.79Å; Q79-V82 WeakPolarHBondContact O-CB 3.42Å; Q79-V82 PolarHBondContact O-N 3.31Å; Q79-D83 PolarHBondContact NE2-OD1 3.1Å; Q79-D83 PolarHBondContact NE2-OD2 2.83Å; Q79-D83 PolarHBondContact O-N 2.83Å
80	D	96.5	Very high	94.6	Very high	73 Å²	73	63.9 Å²	63.9	39%	0.39	35%	0.349	S	S	.	.	H	α-helix	trans	-62.5	-42.1	176.9	-63.1	-27.9	0	0	0	111	L76 L77 D83 L84	L76-D80 HydrophobicContact CB-CB 4.32Å; L77-D80 HydrophobicContact CB-CB 4.43Å; L77-D80 WeakPolarHBondContact CB-OD2 3.49Å; L77-D80 PolarHBondContact O-N 3.12Å; D80-D83 PolarHBondContact O-N 3.08Å; D80-L84 WeakPolarHBondContact O-CG 3.23Å; D80-L84 PolarHBondContact O-N 2.85Å
81	A	95.8	Very high	94.7	Very high	0 Å²	0	64.1 Å²	64.1	0%	0	35%	0.345	C	S	.	.	H	α-helix	trans	-62	-44.9	174.9	0	0	0	0	0	111.6	I27 I42 L73 L77 H78 Q79 D83 L84 F85	I27-A81 HydrophobicContact CD1-CB 4.27Å; I42-A81 HydrophobicContact CD1-CB 3.61Å; I42-A81 HydrophobicContact CG1-CB 3.75Å; L73-A81 HydrophobicContact CD2-CB 4.5Å; L77-A81 PolarHBondContact O-N 3.38Å; L77-A81 VanDerWaalsContact O-N 3.11Å; H78-A81 PolarHBondContact O-N 3.28Å; Q79-A81 VanDerWaalsContact C-N 3.32Å; Q79-A81 PolarHBondContact O-N 2.79Å; A81-D83 VanDerWaalsContact C-N 3.28Å; A81-D83 PolarHBondContact O-N 3.06Å; A81-L84 WeakPolarHBondContact O-CB 3.46Å; A81-L84 PolarHBondContact O-N 2.78Å; A81-F85 WeakPolarHBondContact O-CD2 3.31Å; A81-F85 PolarHBondContact O-N 3.13Å; A81-F85 VanDerWaalsContact O-N 3.11Å
82	V	95.8	Very high	94.8	Very high	23 Å²	23	59.2 Å²	59.2	14%	0.139	32%	0.322	C	S	.	.	H	α-helix	trans	-56	-44.5	175	169.4	0	0	0	0	111	I27 H78 Q79 L84 F85 R86	I27-V82 HydrophobicContact CD1-CG2 3.82Å; I27-V82 HydrophobicContact CG1-CG2 4.32Å; H78-V82 WeakPolarHBondContact O-CG2 3.3Å; H78-V82 PolarHBondContact O-N 2.77Å; Q79-V82 WeakPolarHBondContact O-CB 3.42Å; Q79-V82 PolarHBondContact O-N 3.31Å; V82-L84 VanDerWaalsContact C-N 3.34Å; V82-L84 PolarHBondContact O-N 2.94Å; V82-F85 PolarHBondContact O-N 3.04Å; V82-R86 HydrophobicContact CG1-CG 4.4Å; V82-R86 WeakPolarHBondContact O-CG 3.31Å; V82-R86 PolarHBondContact O-N 3Å
83	D	96.5	Very high	94.9	Very high	54 Å²	54	57.2 Å²	57.2	29%	0.289	31%	0.313	S	S	.	.	H	α-helix	trans	-69.1	-32.8	-178	-67.3	-28.1	0	0	0	112	Q79 D80 A81 R86 N87	Q79-D83 PolarHBondContact NE2-OD1 3.1Å; Q79-D83 PolarHBondContact NE2-OD2 2.83Å; Q79-D83 PolarHBondContact O-N 2.83Å; D80-D83 PolarHBondContact O-N 3.08Å; A81-D83 VanDerWaalsContact C-N 3.28Å; A81-D83 PolarHBondContact O-N 3.06Å; D83-R86 PolarHBondContact O-N 3.4Å; D83-R86 IonicContact OD1-NH1 3.56Å; D83-R86 PolarHBondContact OD1-NH1 2.94Å; D83-R86 VanDerWaalsContact OD1-NH1 3.11Å; D83-N87 VanDerWaalsContact O-CB 3.29Å; D83-N87 WeakPolarHBondContact O-CB 3.4Å; D83-N87 VanDerWaalsContact O-CG 3.23Å; D83-N87 PolarHBondContact O-N 3.28Å; D83-N87 PolarHBondContact O-ND2 2.76Å
84	L	96.1	Very high	95.1	Very high	36 Å²	36	57.1 Å²	57.1	19%	0.188	31%	0.312	C	S	.	.	H	α-helix	trans	-61.6	-47.4	169.3	-69.5	175.3	0	0	0	112.4	Q71 L73 L76 D80 A81 V82 R86 N87 A88	Q71-L84 VanDerWaalsContact CD-CD2 3.46Å; Q71-L84 HydrophobicContact CG-CD1 4.21Å; Q71-L84 VanDerWaalsContact OE1-CD2 3.24Å; L73-L84 HydrophobicContact CD2-CB 4.48Å; L73-L84 HydrophobicContact CD2-CD1 3.55Å; L76-L84 HydrophobicContact CD1-CD1 3.5Å; L76-L84 VanDerWaalsContact CD1-CD1 3.5Å; D80-L84 WeakPolarHBondContact O-CG 3.23Å; D80-L84 PolarHBondContact O-N 2.85Å; A81-L84 WeakPolarHBondContact O-CB 3.46Å; A81-L84 PolarHBondContact O-N 2.78Å; V82-L84 VanDerWaalsContact C-N 3.34Å; V82-L84 PolarHBondContact O-N 2.94Å; L84-R86 VanDerWaalsContact C-N 3.29Å; L84-R86 PolarHBondContact O-N 2.8Å; L84-N87 PolarHBondContact O-N 3.01Å; L84-A88 VanDerWaalsContact O-CB 3.3Å; L84-A88 WeakPolarHBondContact O-CB 3.5Å; L84-A88 PolarHBondContact O-N 2.93Å
85	F	95.8	Very high	95.4	Very high	17 Å²	17	55.3 Å²	55.3	8%	0.075	30%	0.302	C	S	.	.	H	α-helix	trans	-64.7	-33.2	177.1	-73.1	-72.3	0	0	0	113	R18 L23 F25 I27 I42 I65 V68 L73 A81 V82 L94	R18-F85 PolarHBondContact NH2-O 3.15Å; L23-F85 HydrophobicContact CD1-CB 4.45Å; L23-F85 HydrophobicContact CD1-CD1 3.83Å; F25-F85 HydrophobicContact CE2-CD1 4.38Å; F25-F85 HydrophobicContact CE2-CE1 4.02Å; F25-F85 HydrophobicContact CE2-CZ 4.3Å; F25-F85 AromaticContact CZ-CD1 3.96Å; F25-F85 HydrophobicContact CZ-CD1 3.96Å; F25-F85 AromaticContact CZ-CE1 3.69Å; F25-F85 HydrophobicContact CZ-CE1 3.69Å; F25-F85 HydrophobicContact CZ-CZ 4.4Å; I27-F85 HydrophobicContact CD1-CD2 3.81Å; I27-F85 HydrophobicContact CD1-CE2 3.8Å; I27-F85 HydrophobicContact CG2-CE2 4.07Å; I27-F85 HydrophobicContact CG2-CZ 4.39Å; I42-F85 HydrophobicContact CG2-CE2 4.28Å; I65-F85 HydrophobicContact CB-CZ 4.44Å; I65-F85 HydrophobicContact CD1-CE1 4.09Å; I65-F85 HydrophobicContact CD1-CE2 4.47Å; I65-F85 HydrophobicContact CD1-CZ 3.55Å; I65-F85 HydrophobicContact CG2-CE1 4.49Å; I65-F85 HydrophobicContact CG2-CZ 4.02Å; V68-F85 HydrophobicContact CB-CE1 4.48Å; V68-F85 HydrophobicContact CG1-CD1 4.33Å; V68-F85 HydrophobicContact CG1-CE1 4.47Å; V68-F85 HydrophobicContact CG2-CD1 3.76Å; V68-F85 HydrophobicContact CG2-CE1 3.2Å; V68-F85 HydrophobicContact CG2-CE2 4.21Å; V68-F85 HydrophobicContact CG2-CG 4.47Å; V68-F85 HydrophobicContact CG2-CZ 3.46Å; V68-F85 VanDerWaalsContact CG2-CZ 3.46Å; L73-F85 HydrophobicContact CD1-CE2 3.85Å; L73-F85 HydrophobicContact CD1-CZ 3.66Å; A81-F85 WeakPolarHBondContact O-CD2 3.31Å; A81-F85 PolarHBondContact O-N 3.13Å; A81-F85 VanDerWaalsContact O-N 3.11Å; V82-F85 PolarHBondContact O-N 3.04Å; F85-L94 HydrophobicContact CD1-CD2 4.43Å; F85-L94 HydrophobicContact CE1-CD2 3.74Å
86	R	94.5	Very high	95.7	Very high	154 Å²	154	49.4 Å²	49.4	58%	0.581	27%	0.271	S	S	*	.	H	α-helix	trans	-67.5	-42.7	174.8	-74.1	172.9	176.5	163.2	-2.8	111.4	V82 D83 L84	V82-R86 HydrophobicContact CG1-CG 4.4Å; V82-R86 WeakPolarHBondContact O-CG 3.31Å; V82-R86 PolarHBondContact O-N 3Å; D83-R86 PolarHBondContact O-N 3.4Å; D83-R86 IonicContact OD1-NH1 3.56Å; D83-R86 PolarHBondContact OD1-NH1 2.94Å; D83-R86 VanDerWaalsContact OD1-NH1 3.11Å; L84-R86 VanDerWaalsContact C-N 3.29Å; L84-R86 PolarHBondContact O-N 2.8Å
87	N	94.8	Very high	95.7	Very high	135 Å²	135	50 Å²	50	72%	0.722	27%	0.273	S	S	*	.	H	α-helix	trans	-87.7	-5.6	-175.5	-64.3	-33.2	0	0	0	114.2	D83 L84 G89	D83-N87 VanDerWaalsContact O-CB 3.29Å; D83-N87 WeakPolarHBondContact O-CB 3.4Å; D83-N87 VanDerWaalsContact O-CG 3.23Å; D83-N87 PolarHBondContact O-N 3.28Å; D83-N87 PolarHBondContact O-ND2 2.76Å; L84-N87 PolarHBondContact O-N 3.01Å; N87-G89 PolarHBondContact O-N 3.31Å
88	A	93.1	Very high	95.5	Very high	12 Å²	12	47 Å²	47	10%	0.099	26%	0.256	C	S	.	.	S	Bend	trans	-63.9	-1.2	-178.8	0	0	0	0	0	115.3	V68 N69 L84 V92	V68-A88 HydrophobicContact CG1-CB 3.72Å; N69-A88 PolarHBondContact ND2-O 2.83Å; L84-A88 VanDerWaalsContact O-CB 3.3Å; L84-A88 WeakPolarHBondContact O-CB 3.5Å; L84-A88 PolarHBondContact O-N 2.93Å; A88-V92 HydrophobicContact CB-CB 4.48Å; A88-V92 HydrophobicContact CB-CG1 4.04Å; A88-V92 HydrophobicContact CB-CG2 3.64Å
89	G	94	Very high	94.7	Very high	39 Å²	39	52.9 Å²	52.9	40%	0.402	28%	0.277	S	S	.	.			trans	75.2	-159.7	177.5	0	0	0	0	0	113.5	R18 N87	R18-G89 PolarHBondContact NE-O 3.2Å; R18-G89 PolarHBondContact NH2-O 2.83Å; N87-G89 PolarHBondContact O-N 3.31Å
90	C	94.6	Very high	93.3	Very high	81 Å²	81	52.6 Å²	52.6	55%	0.547	28%	0.278	S	S	.	.	S	Bend	trans	-81.9	-47.1	-176.1	-171.4	0	0	0	0	112.6	T17 R18	T17-C90 CarbonylContact C-O 3.33Å; R18-C90 WeakPolarHBondContact CB-O 3.43Å; R18-C90 PolarHBondContact N-O 3.04Å
91	A	95.9	Very high	91.5	Very high	76 Å²	76	55.4 Å²	55.4	63%	0.628	29%	0.289	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.4	124.7	174.3	0	0	0	0	0	109.2
92	V	97.4	Very high	89.6	Confident	2 Å²	2	57.1 Å²	57.1	1%	0.012	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	119.9	-175.8	-176.8	0	0	0	0	109.8	N15 L16 L23 V68 N69 A88 L94	N15-V92 WeakPolarHBondContact CA-O 3.35Å; L16-V92 PolarHBondContact N-O 3.01Å; L16-V92 PolarHBondContact O-N 3.41Å; L23-V92 HydrophobicContact CD1-CG1 4.34Å; L23-V92 HydrophobicContact CD1-CG2 4.36Å; L23-V92 HydrophobicContact CD2-CB 4.04Å; L23-V92 HydrophobicContact CD2-CG2 3.75Å; V68-V92 HydrophobicContact CG1-CG1 3.71Å; N69-V92 VanDerWaalsContact OD1-CA 3.3Å; N69-V92 WeakPolarHBondContact OD1-CA 3.3Å; A88-V92 HydrophobicContact CB-CB 4.48Å; A88-V92 HydrophobicContact CB-CG1 4.04Å; A88-V92 HydrophobicContact CB-CG2 3.64Å; V92-L94 HydrophobicContact CG1-CD2 3.6Å; V92-L94 HydrophobicContact CG1-CG 4.18Å
93	S	97.7	Very high	87.2	Confident	22 Å²	22	64.6 Å²	64.6	15%	0.154	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	122.3	168.8	169.7	0	0	0	0	109.1	E13 N15 V68 N69	E13-S93 PolarHBondContact OE1-OG 2.84Å; N15-S93 VanDerWaalsContact OD1-CB 3.3Å; N15-S93 WeakPolarHBondContact OD1-CB 3.47Å; V68-S93 CarbonylContact C-O 3.57Å; V68-S93 WeakPolarHBondContact CA-O 3.22Å; N69-S93 PolarHBondContact N-O 2.83Å; N69-S93 PolarHBondContact OD1-N 2.96Å
94	L	97.7	Very high	84.8	Confident	0 Å²	0	67.6 Å²	67.6	0%	0	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	133.4	175.2	-56.8	-177.8	0	0	0	108.6	E13 I14 L16 F25 I65 S67 V68 F85 V92 V96	E13-L94 CarbonylContact C-O 3.5Å; E13-L94 WeakPolarHBondContact CA-O 3.22Å; I14-L94 HydrophobicContact CB-CB 4.44Å; I14-L94 PolarHBondContact N-O 3.37Å; I14-L94 PolarHBondContact O-N 2.95Å; L16-L94 HydrophobicContact CD1-CD1 3.75Å; L16-L94 HydrophobicContact CG-CD1 4.45Å; F25-L94 HydrophobicContact CE1-CD1 3.97Å; F25-L94 HydrophobicContact CZ-CD1 4.01Å; I65-L94 HydrophobicContact CG2-CD2 4.5Å; S67-L94 WeakPolarHBondContact O-CA 3.08Å; V68-L94 HydrophobicContact CB-CD2 4.37Å; V68-L94 HydrophobicContact CG1-CD2 4.23Å; V68-L94 HydrophobicContact CG2-CD2 3.79Å; F85-L94 HydrophobicContact CD1-CD2 4.43Å; F85-L94 HydrophobicContact CE1-CD2 3.74Å; V92-L94 HydrophobicContact CG1-CD2 3.6Å; V92-L94 HydrophobicContact CG1-CG 4.18Å; L94-V96 HydrophobicContact CB-CG1 4.03Å
95	R	97.4	Very high	82.5	Confident	76 Å²	76	68.3 Å²	68.3	29%	0.287	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	121.9	162.6	-173.1	173.1	43.5	102.3	7.1	107.8	E11 E12 L66 S67	E11-R95 IonicContact OE2-NH1 3.01Å; E12-R95 WeakPolarHBondContact O-CA 3.46Å; L66-R95 WeakPolarHBondContact CA-O 3.39Å; L66-R95 HydrophobicContact CB-CB 4.46Å; L66-R95 HydrophobicContact CB-CG 4.39Å; L66-R95 WeakPolarHBondContact CB-O 3.04Å; L66-R95 HydrophobicContact CD1-CG 4.31Å; L66-R95 PolarHBondContact N-O 2.92Å; S67-R95 PolarHBondContact N-O 3.15Å; S67-R95 PolarHBondContact O-N 2.88Å; S67-R95 VanDerWaalsContact OG-CB 3.23Å; S67-R95 WeakPolarHBondContact OG-CB 3.46Å; S67-R95 PolarHBondContact OG-NE 2.99Å; S67-R95 PolarHBondContact OG-NH2 2.77Å; S67-R95 VanDerWaalsContact OG-NH2 3.08Å
96	V	96.6	Very high	80.2	Confident	0 Å²	0	73.7 Å²	73.7	0%	0	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	161.1	-173.4	-56.3	0	0	0	0	110.7	E11 E12 I14 L59 K64 I65 L94	E11-V96 CarbonylContact C-O 3.53Å; E11-V96 WeakPolarHBondContact CA-O 3.29Å; E12-V96 HydrophobicContact CB-CG2 4.27Å; E12-V96 PolarHBondContact N-O 2.91Å; E12-V96 PolarHBondContact O-N 3.36Å; I14-V96 HydrophobicContact CD1-CG1 4.43Å; I14-V96 HydrophobicContact CD1-CG2 3.58Å; I14-V96 HydrophobicContact CG1-CG2 4.13Å; L59-V96 HydrophobicContact CD1-CB 4.37Å; L59-V96 HydrophobicContact CD1-CG1 3.71Å; K64-V96 CarbonylContact O-C 3.59Å; K64-V96 VanDerWaalsContact O-CA 3.31Å; K64-V96 WeakPolarHBondContact O-CA 3.44Å; I65-V96 HydrophobicContact CG1-CG1 4.33Å; I65-V96 HydrophobicContact CG2-CG1 4.38Å; L94-V96 HydrophobicContact CB-CG1 4.03Å
97	Q	94.7	Very high	78.2	Confident	51 Å²	51	73.4 Å²	73.4	24%	0.238	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	112.4	178.3	-176.3	178.8	77.5	0	0	108.9	V9 A10 E11 K64 L66	V9-Q97 HydrophobicContact CG1-CG 3.21Å; A10-Q97 CarbonylContact O-C 3.29Å; A10-Q97 WeakPolarHBondContact O-CA 3.08Å; E11-Q97 HydrophobicContact CG-CB 4.45Å; E11-Q97 HydrophobicContact CG-CG 4.44Å; K64-Q97 HydrophobicContact CB-CB 4.22Å; K64-Q97 PolarHBondContact N-O 2.89Å; K64-Q97 PolarHBondContact O-N 2.93Å; L66-Q97 HydrophobicContact CD1-CB 4.08Å; L66-Q97 HydrophobicContact CD2-CB 4.26Å; L66-Q97 HydrophobicContact CG-CB 4.17Å
98	H	90.6	Very high	75.7	Confident	15 Å²	15	70.4 Å²	70.4	7%	0.069	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	134.5	178.8	-61.4	-63.6	0	0	0	110.9	A10 E12 R58 D63 L100	A10-H98 PolarHBondContact N-O 3.47Å; A10-H98 PolarHBondContact O-N 3.25Å; E12-H98 IonicContact OE2-NE2 2.91Å; E12-H98 PolarHBondContact OE2-NE2 3.3Å; R58-H98 PolarHBondContact O-CE1 2.92Å; D63-H98 WeakPolarHBondContact OD1-CA 3.3Å; D63-H98 IonicContact OD1-CE1 3.64Å; D63-H98 IonicContact OD1-CG 2.68Å; D63-H98 IonicContact OD1-ND1 3.15Å; D63-H98 PolarHBondContact OD1-ND1 3.32Å; D63-H98 IonicContact OD2-CE1 2.84Å; D63-H98 PolarHBondContact OD2-CE1 3.35Å; D63-H98 IonicContact OD2-ND1 3.86Å; D63-H98 PolarHBondContact OD2-ND1 3.37Å; H98-L100 HydrophobicContact CB-CD2 4.46Å; H98-L100 HydrophobicContact CB-CG 4.37Å; H98-L100 PolarHBondContact O-N 2.76Å
99	R	76.1	Confident	73.6	Confident	156 Å²	156	77.3 Å²	77.3	59%	0.589	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93	86.4	172.8	-170	176.4	-177.2	173.8	1	110.1	Y7	Y7-R99 HydrophobicContact CD1-CG 3.82Å; Y7-R99 HydrophobicContact CE1-CG 4.42Å; Y7-R99 HydrophobicContact CG-CG 4.44Å
100	L	68.6	Low	71.2	Confident	82 Å²	82	87.4 Å²	87.4	43%	0.429	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	120.8	175.8	-58.8	177.8	0	0	0	109.7	Y7 L8 A10 H98 V102	Y7-L100 WeakPolarHBondContact CA-O 3.3Å; L8-L100 HydrophobicContact CB-CB 4.35Å; L8-L100 PolarHBondContact N-O 2.88Å; L8-L100 PolarHBondContact O-N 2.94Å; L8-L100 VanDerWaalsContact O-N 3.12Å; A10-L100 HydrophobicContact CB-CD1 4.25Å; H98-L100 HydrophobicContact CB-CD2 4.46Å; H98-L100 HydrophobicContact CB-CG 4.37Å; H98-L100 PolarHBondContact O-N 2.76Å; L100-V102 PolarHBondContact O-N 2.67Å
101	Q	56.9	Low	68.7	Low	132 Å²	132	86.7 Å²	86.7	62%	0.617	47%	0.473	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.5	115.5	169.2	-50.7	-155.1	9.2	0	0	108.8	Y7 Q103	Y7-Q101 HydrophobicContact CD1-CG 4.16Å; Y7-Q101 HydrophobicContact CE1-CB 4.39Å; Y7-Q101 HydrophobicContact CE1-CG 3.79Å; Q101-Q103 PolarHBondContact O-N 3.47Å
102	V	55.9	Low	66.2	Low	36 Å²	36	92.7 Å²	92.7	22%	0.218	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	104.1	165	-167.7	0	0	0	0	107.4	V6 L8 L100 N104	V6-V102 WeakPolarHBondContact O-CB 3.4Å; V6-V102 WeakPolarHBondContact O-CG2 3.36Å; V6-V102 PolarHBondContact O-N 3.33Å; L8-V102 HydrophobicContact CB-CG2 3.96Å; L8-V102 HydrophobicContact CD1-CG2 3.39Å; L8-V102 HydrophobicContact CG-CG2 3.34Å; L100-V102 PolarHBondContact O-N 2.67Å; V102-N104 VanDerWaalsContact C-N 3.25Å; V102-N104 WeakPolarHBondContact CG1-ND2 3.48Å; V102-N104 VanDerWaalsContact CG1-OD1 3.29Å; V102-N104 WeakPolarHBondContact CG1-OD1 3.3Å; V102-N104 PolarHBondContact O-N 2.68Å
103	Q	46.6	Very low	63.7	Low	180 Å²	180	96.7 Å²	96.7	84%	0.841	53%	0.53	S	S	*	.			trans	-69.5	86.6	168.7	-76.1	-173.8	64.9	0	0	109.2	Q101 G105	Q101-Q103 PolarHBondContact O-N 3.47Å; Q103-G105 PolarHBondContact O-N 2.74Å
104	N	45.1	Very low	61.2	Low	117 Å²	117	101 Å²	101	63%	0.626	55%	0.551	S	S	*	*			trans	-94	79.7	169	-72.2	-31.3	0	0	0	109.2	V102	V102-N104 VanDerWaalsContact C-N 3.25Å; V102-N104 WeakPolarHBondContact CG1-ND2 3.48Å; V102-N104 VanDerWaalsContact CG1-OD1 3.29Å; V102-N104 WeakPolarHBondContact CG1-OD1 3.3Å; V102-N104 PolarHBondContact O-N 2.68Å
105	G	49.2	Very low	58.7	Low	51 Å²	51	107.5 Å²	107.5	53%	0.526	59%	0.593	S	S	.	*	S	Bend	trans	-158.7	149.4	171.2	0	0	0	0	0	110.1	Q103 I107	Q103-G105 PolarHBondContact O-N 2.74Å; G105-I107 PolarHBondContact O-N 3.02Å
106	P	46.2	Very low	56.6	Low	130 Å²	130	107.2 Å²	107.2	84%	0.844	60%	0.603	S	S	*	*			trans	-58.1	138.3	172.2	25.5	-31	0	0	0	108	G108	P106-G108 PolarHBondContact O-N 3.4Å
107	I	52.5	Low	54.2	Low	149 Å²	149	110 Å²	110	76%	0.764	63%	0.631	S	S	*	*			trans	-58.8	88.6	-178.8	-57.5	170.1	0	0	0	108.2	G105 H109	G105-I107 PolarHBondContact O-N 3.02Å; I107-H109 PolarHBondContact O-N 3.21Å
108	G	43.9	Very low	52.1	Low	71 Å²	71	111.9 Å²	111.9	73%	0.732	64%	0.642	S	S	*	*			trans	-84.4	88.4	177.9	0	0	0	0	0	108.1	P106 R110	P106-G108 PolarHBondContact O-N 3.4Å; G108-R110 PolarHBondContact O-N 2.87Å; G108-R110 VanDerWaalsContact O-N 3.07Å
109	H	48.7	Very low	49.9	Very low	158 Å²	158	115 Å²	115	73%	0.731	66%	0.664	S	S	*	*			trans	-55.6	111.3	166.4	-73.8	-89.2	0	0	0	109.2	I107	I107-H109 PolarHBondContact O-N 3.21Å
110	R	43.1	Very low	48.6	Very low	250 Å²	250	114 Å²	114	94%	0.943	67%	0.669	S	S	*	*			trans	-117.5	85.7	162.9	-159.5	170.3	-173.1	166	1.2	109	G108	G108-R110 PolarHBondContact O-N 2.87Å; G108-R110 VanDerWaalsContact O-N 3.07Å
111	G	41.4	Very low	47.7	Very low	67 Å²	67	118.6 Å²	118.6	69%	0.691	69%	0.686	S	S	*	*			trans	18.9	110.7	161.3	0	0	0	0	0	119.8
112	E	44.1	Very low	47.1	Very low	202 Å²	202	118.5 Å²	118.5	94%	0.944	69%	0.687	S	S	*	*				-149.9	96.4	128.1	-147.6	146.7	94	0	0	109.6	D114	E112-D114 PolarHBondContact O-N 3.2Å
113	G	45.5	Very low	46.8	Very low	86 Å²	86	120.8 Å²	120.8	89%	0.887	70%	0.701	S	S	*	*	S	Bend	trans	72.6	14.1	137.6	0	0	0	0	0	123.9
114	D	44.1	Very low	46.9	Very low	113 Å²	113	117.5 Å²	117.5	60%	0.604	69%	0.688	S	S	*	*			trans	-122.9	118.9	175.5	-170.4	44.4	0	0	0	114.2	E112 S116	E112-D114 PolarHBondContact O-N 3.2Å; D114-S116 PolarHBondContact O-N 3.01Å; D114-S116 PolarHBondContact OD2-OG 3.22Å
115	P	46.1	Very low	47.1	Very low	135 Å²	135	117.1 Å²	117.1	88%	0.877	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.9	10.5	-177.2	30.1	-34.5	0	0	0	115.4
116	S	52.6	Low	47	Very low	70 Å²	70	117.9 Å²	117.9	49%	0.49	69%	0.685	S	S	.	*	T	Hydrogen-bonded Turn	trans	-97.4	-15	-177.2	80.3	0	0	0	0	115.4	D114 I118	D114-S116 PolarHBondContact O-N 3.01Å; D114-S116 PolarHBondContact OD2-OG 3.22Å; S116-I118 PolarHBondContact O-N 3.37Å
117	G	45.6	Very low	47.2	Very low	58 Å²	58	115.7 Å²	115.7	60%	0.598	67%	0.669	S	S	*	*			trans	60.9	8	169.3	0	0	0	0	0	116.7
118	I	52.4	Low	47.1	Very low	91 Å²	91	115.3 Å²	115.3	47%	0.467	66%	0.663	S	S	.	*			trans	-98.4	119.7	176.5	-58.9	167.5	0	0	0	108	S116 I120 M122 V123	S116-I118 PolarHBondContact O-N 3.37Å; I118-I120 PolarHBondContact O-N 3.11Å; I118-M122 HydrophobicContact CG2-CB 3.97Å; I118-M122 HydrophobicContact CG2-CG 4.45Å; I118-M122 HydrophobicContact CG2-SD 4.45Å; I118-V123 HydrophobicContact CB-CG2 4.43Å; I118-V123 HydrophobicContact CG2-CG2 3.59Å
119	P	43.7	Very low	47.5	Very low	80 Å²	80	114.7 Å²	114.7	52%	0.519	65%	0.651	S	S	.	*			trans	-56.9	129	171	19.6	-28.2	0	0	0	109.6	F121 M122	P119-F121 PolarHBondContact O-N 2.96Å; P119-M122 HydrophobicContact CG-CB 4.04Å; P119-M122 HydrophobicContact CG-SD 4.17Å; P119-M122 WeakPolarHBondContact O-CA 3.4Å; P119-M122 WeakPolarHBondContact O-CB 3.29Å; P119-M122 PolarHBondContact O-N 3.48Å
120	I	48.9	Very low	47.7	Very low	135 Å²	135	113.1 Å²	113.1	69%	0.692	65%	0.647	S	S	*	*	H	α-helix	trans	-54	-31.2	-174.4	-63	172.2	0	0	0	112.1	I118 M122 V123 L124	I118-I120 PolarHBondContact O-N 3.11Å; I120-M122 PolarHBondContact O-N 3.25Å; I120-V123 PolarHBondContact O-N 2.89Å; I120-L124 PolarHBondContact O-N 3.02Å
121	F	49.3	Very low	48.5	Very low	180 Å²	180	105 Å²	105	79%	0.789	63%	0.625	S	S	*	*	H	α-helix	trans	-62.9	-18.5	174.7	-56.6	-82.9	0	0	0	114.1	P119 V125	P119-F121 PolarHBondContact O-N 2.96Å; F121-V125 WeakPolarHBondContact O-CG2 3.37Å
122	M	45.3	Very low	49.4	Very low	130 Å²	130	108.6 Å²	108.6	64%	0.64	63%	0.626	S	S	*	*	H	α-helix	trans	-88.3	-19.3	179.9	-161.2	172.4	172	0	0	112.8	I118 P119 I120 P126	I118-M122 HydrophobicContact CG2-CB 3.97Å; I118-M122 HydrophobicContact CG2-CG 4.45Å; I118-M122 HydrophobicContact CG2-SD 4.45Å; P119-M122 HydrophobicContact CG-CB 4.04Å; P119-M122 HydrophobicContact CG-SD 4.17Å; P119-M122 WeakPolarHBondContact O-CA 3.4Å; P119-M122 WeakPolarHBondContact O-CB 3.29Å; P119-M122 PolarHBondContact O-N 3.48Å; I120-M122 PolarHBondContact O-N 3.25Å; M122-P126 VanDerWaalsContact O-CD 3.24Å; M122-P126 WeakPolarHBondContact O-CD 3.36Å; M122-P126 WeakPolarHBondContact O-CG 3.48Å
123	V	49.5	Very low	50.3	Low	84 Å²	84	103.2 Å²	103.2	51%	0.509	61%	0.607	S	S	.	*	H	α-helix	trans	-89.8	-26	175.8	-171	0	0	0	0	111.6	I118 I120 V127	I118-V123 HydrophobicContact CB-CG2 4.43Å; I118-V123 HydrophobicContact CG2-CG2 3.59Å; I120-V123 PolarHBondContact O-N 2.89Å; V123-V127 WeakPolarHBondContact O-CG2 3.42Å
124	L	47.5	Very low	51.2	Low	111 Å²	111	102 Å²	102	58%	0.581	59%	0.588	S	S	*	*	H	α-helix	trans	-85.4	-27.3	-171.9	-142.8	118.4	0	0	0	114.2	I120	I120-L124 PolarHBondContact O-N 3.02Å
125	V	49.5	Very low	52.2	Low	109 Å²	109	99 Å²	99	66%	0.661	58%	0.579	S	S	*	*	H	α-helix	trans	-74.7	-37.9	-179.7	-178.9	0	0	0	0	113.2	F121	F121-V125 WeakPolarHBondContact O-CG2 3.37Å
126	P	46.4	Very low	53.2	Low	66 Å²	66	99.9 Å²	99.9	43%	0.429	57%	0.565	S	S	.	*	H	α-helix	trans	-69.7	-31.7	177.2	-20	32.3	0	0	0	114.2	M122 A129 L130	M122-P126 VanDerWaalsContact O-CD 3.24Å; M122-P126 WeakPolarHBondContact O-CD 3.36Å; M122-P126 WeakPolarHBondContact O-CG 3.48Å; P126-A129 PolarHBondContact O-N 2.98Å; P126-L130 WeakPolarHBondContact O-CB 3.37Å; P126-L130 PolarHBondContact O-N 3.25Å
127	V	50.5	Low	54.1	Low	84 Å²	84	100.2 Å²	100.2	51%	0.509	56%	0.563	S	S	.	*	H	α-helix	trans	-71.1	-37.1	-175.2	179.3	0	0	0	0	111.6	V123 T131	V123-V127 WeakPolarHBondContact O-CG2 3.42Å; V127-T131 WeakPolarHBondContact O-CG2 3.5Å; V127-T131 PolarHBondContact O-N 3.34Å; V127-T131 PolarHBondContact O-OG1 3.27Å
128	F	50.8	Low	55.3	Low	142 Å²	142	104.7 Å²	104.7	62%	0.623	57%	0.567	S	S	*	*	H	α-helix	trans	-73.6	-34.3	176.1	-95.4	-91.8	0	0	0	113.2	T131 M132	F128-T131 PolarHBondContact O-OG1 3.04Å; F128-T131 VanDerWaalsContact O-OG1 3.05Å; F128-M132 WeakPolarHBondContact O-CG 3.16Å; F128-M132 PolarHBondContact O-N 3.4Å
129	A	52.3	Low	56.1	Low	58 Å²	58	107.1 Å²	107.1	48%	0.479	58%	0.578	S	S	.	*	H	α-helix	trans	-69.3	-37.5	174.4	0	0	0	0	0	112.1	P126 V133	P126-A129 PolarHBondContact O-N 2.98Å; A129-V133 VanDerWaalsContact O-CG2 3.32Å; A129-V133 WeakPolarHBondContact O-CG2 3.41Å; A129-V133 PolarHBondContact O-N 2.93Å; A129-V133 VanDerWaalsContact O-N 3.11Å
130	L	53.4	Low	57.4	Low	124 Å²	124	111 Å²	111	65%	0.649	58%	0.582	S	S	*	*	H	α-helix	trans	-65.6	-39.1	176.9	-92.3	157	0	0	0	112.9	P126 A134	P126-L130 WeakPolarHBondContact O-CB 3.37Å; P126-L130 PolarHBondContact O-N 3.25Å; L130-A134 WeakPolarHBondContact O-CB 3.49Å; L130-A134 PolarHBondContact O-N 3.1Å
131	T	58.7	Low	57.8	Low	81 Å²	81	113 Å²	113	50%	0.497	58%	0.582	S	S	.	*	H	α-helix	trans	-70.8	-37.2	178.5	56.2	0	0	0	0	112.2	V127 F128 A134 A135	V127-T131 WeakPolarHBondContact O-CG2 3.5Å; V127-T131 PolarHBondContact O-N 3.34Å; V127-T131 PolarHBondContact O-OG1 3.27Å; F128-T131 PolarHBondContact O-OG1 3.04Å; F128-T131 VanDerWaalsContact O-OG1 3.05Å; T131-A134 PolarHBondContact O-N 3.23Å; T131-A135 WeakPolarHBondContact O-CB 3.44Å; T131-A135 PolarHBondContact O-N 3.35Å
132	M	60.3	Low	58.7	Low	141 Å²	141	114.2 Å²	114.2	70%	0.695	58%	0.582	S	S	*	*	H	α-helix	trans	-68.8	-36.9	176.3	-69.2	-163.6	80.9	0	0	112.8	F128 W136	F128-M132 WeakPolarHBondContact O-CG 3.16Å; F128-M132 PolarHBondContact O-N 3.4Å; M132-W136 WeakPolarHBondContact O-CB 3.29Å; M132-W136 PolarHBondContact O-N 3.19Å; M132-W136 VanDerWaalsContact O-N 3.1Å
133	V	64.3	Low	59.1	Low	90 Å²	90	116.6 Å²	116.6	55%	0.545	59%	0.591	S	S	.	*	H	α-helix	trans	-69.2	-40.9	174.2	174.7	0	0	0	0	111.2	A129 W136 V137	A129-V133 VanDerWaalsContact O-CG2 3.32Å; A129-V133 WeakPolarHBondContact O-CG2 3.41Å; A129-V133 PolarHBondContact O-N 2.93Å; A129-V133 VanDerWaalsContact O-N 3.11Å; V133-W136 PolarHBondContact O-N 2.91Å; V133-V137 HydrophobicContact CG1-CG2 4.29Å; V133-V137 WeakPolarHBondContact O-CB 3.28Å; V133-V137 VanDerWaalsContact O-CG2 3.29Å; V133-V137 WeakPolarHBondContact O-CG2 3.35Å; V133-V137 PolarHBondContact O-N 3.26Å
134	A	64.5	Low	59.5	Low	60 Å²	60	121 Å²	121	50%	0.496	61%	0.606	S	S	.	*	H	α-helix	trans	-63.6	-41.5	176.2	0	0	0	0	0	112.5	L130 T131 V137 F138	L130-A134 WeakPolarHBondContact O-CB 3.49Å; L130-A134 PolarHBondContact O-N 3.1Å; T131-A134 PolarHBondContact O-N 3.23Å; A134-V137 PolarHBondContact O-N 3.34Å; A134-F138 WeakPolarHBondContact O-CB 3.07Å; A134-F138 PolarHBondContact O-N 3.33Å
135	A	65.1	Low	59.7	Low	49 Å²	49	125.8 Å²	125.8	41%	0.405	63%	0.631	S	S	.	*	H	α-helix	trans	-64.3	-41.3	176	0	0	0	0	0	112.1	T131 M139	T131-A135 WeakPolarHBondContact O-CB 3.44Å; T131-A135 PolarHBondContact O-N 3.35Å; A135-M139 WeakPolarHBondContact O-CB 3.41Å; A135-M139 WeakPolarHBondContact O-CG 3.47Å; A135-M139 PolarHBondContact O-N 2.78Å
136	W	67.2	Low	60.2	Low	155 Å²	155	126.7 Å²	126.7	59%	0.587	63%	0.63	S	S	*	*	H	α-helix	trans	-67.1	-42.6	176.5	-174.9	82.8	0	0	0	112.5	M132 V133 R140	M132-W136 WeakPolarHBondContact O-CB 3.29Å; M132-W136 PolarHBondContact O-N 3.19Å; M132-W136 VanDerWaalsContact O-N 3.1Å; V133-W136 PolarHBondContact O-N 2.91Å; W136-R140 WeakPolarHBondContact O-CB 3.47Å; W136-R140 PolarHBondContact O-N 3.11Å
137	V	71.3	Confident	60.9	Low	76 Å²	76	129.8 Å²	129.8	46%	0.461	64%	0.641	S	S	.	*	H	α-helix	trans	-65.5	-42.5	175.8	172	0	0	0	0	111.2	V133 A134 R140 Y141	V133-V137 HydrophobicContact CG1-CG2 4.29Å; V133-V137 WeakPolarHBondContact O-CB 3.28Å; V133-V137 VanDerWaalsContact O-CG2 3.29Å; V133-V137 WeakPolarHBondContact O-CG2 3.35Å; V133-V137 PolarHBondContact O-N 3.26Å; A134-V137 PolarHBondContact O-N 3.34Å; V137-R140 PolarHBondContact O-N 2.94Å; V137-Y141 PolarHBondContact O-N 3.44Å
138	F	69.5	Low	61.5	Low	153 Å²	153	132.4 Å²	132.4	67%	0.671	65%	0.648	S	S	*	*	H	α-helix	trans	-65	-42.7	177.5	-177.1	-100.6	0	0	0	112.4	A134 R140 Y141 R142	A134-F138 WeakPolarHBondContact O-CB 3.07Å; A134-F138 PolarHBondContact O-N 3.33Å; F138-R140 VanDerWaalsContact C-N 3.29Å; F138-R140 PolarHBondContact O-N 3.11Å; F138-Y141 PolarHBondContact O-N 3.21Å; F138-R142 PolarHBondContact O-N 3.05Å
139	M	70.6	Confident	62.1	Low	142 Å²	142	131.8 Å²	131.8	70%	0.7	65%	0.649	S	S	*	*	H	α-helix	trans	-62.5	-37.7	173.7	-77	-168.1	-169.4	0	0	112.1	A135	A135-M139 WeakPolarHBondContact O-CB 3.41Å; A135-M139 WeakPolarHBondContact O-CG 3.47Å; A135-M139 PolarHBondContact O-N 2.78Å
140	R	69.7	Low	62.7	Low	160 Å²	160	136.4 Å²	136.4	60%	0.604	66%	0.66	S	S	*	*	H	α-helix	trans	-72.3	-32.2	179.1	-166.5	165.7	-176.8	153.3	1.2	113.1	W136 V137 F138	W136-R140 WeakPolarHBondContact O-CB 3.47Å; W136-R140 PolarHBondContact O-N 3.11Å; V137-R140 PolarHBondContact O-N 2.94Å; F138-R140 VanDerWaalsContact C-N 3.29Å; F138-R140 PolarHBondContact O-N 3.11Å
141	Y	58.8	Low	63.3	Low	179 Å²	179	137.3 Å²	137.3	70%	0.702	66%	0.661	S	S	*	*	H	α-helix	trans	-72.6	-27	177.9	-154	-96.2	0	0	0	112.8	V137 F138 Q143 Q144	V137-Y141 PolarHBondContact O-N 3.44Å; F138-Y141 PolarHBondContact O-N 3.21Å; Y141-Q143 VanDerWaalsContact C-N 3.26Å; Y141-Q143 PolarHBondContact O-N 3.16Å; Y141-Q144 PolarHBondContact O-N 3.34Å
142	R	67.8	Low	63.7	Low	204 Å²	204	141.3 Å²	141.3	77%	0.77	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.4	-10.5	178.7	-157.6	-177.7	-172.5	-177.3	4.1	114.5	F138	F138-R142 PolarHBondContact O-N 3.05Å
143	Q	53.8	Low	63.9	Low	180 Å²	180	141.3 Å²	141.3	84%	0.841	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.1	4.4	177.9	-74.2	-165.3	-23	0	0	114.2	Y141	Y141-Q143 VanDerWaalsContact C-N 3.26Å; Y141-Q143 PolarHBondContact O-N 3.16Å
144	Q	58.5	Low	63.9	Low	177 Å²	177	145.6 Å²	145.6	83%	0.827	68%	0.681	S	S	*	*			trans	-116.9	16.9	177.4	-64.8	-148.8	7.1	0	0	114.5	Y141	Y141-Q144 PolarHBondContact O-N 3.34Å
145	L	50.2	Low	63.9	Low	212 Å²	212	153.4 Å²	153.4	100%	1.11	70%	0.698	S	S	*	*			trans	-123.2	0	166.5	-78.1	167.8	0	0	0	110

Retrieved 145 of 145 residues in 229.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).