A0A096NX07_PAPAN Loading...

Somatoliberin

GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

AlphaFold DB , UniProt , Accession A0A096NX07, Species PAPAN (Papio anubis, Olive baboon), Gene GHRH, Length 108 aa.

						>A0A096NX07_PAPAN|A0A096NX07|GHRH
MPLWVFFFVILALSSSSHCSPSPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQERGARARLGRQVDSVWAEQKQMELESILVALLQKHSRNSQG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.3	Low	77.1	Confident	220 Å²	220	129.7 Å²	129.7	100%	1.084	64%	0.64	S	S	*	*				0	109.6	0	-63.7	-57.3	143.3	0	0	107.9	L3	M1-L3 PolarHBondContact O-N 2.89Å; M1-L3 VanDerWaalsContact O-N 3.11Å
2	P	72.1	Confident	76.8	Confident	97 Å²	97	123.6 Å²	123.6	63%	0.63	63%	0.625	S	S	*	*			trans	-75.3	102.7	-167.7	28.6	-31.7	0	0	0	110.8	W4 V5	P2-W4 PolarHBondContact O-N 3.41Å; P2-W4 VanDerWaalsContact O-N 3.1Å; P2-V5 HydrophobicContact CB-CG2 4.46Å; P2-V5 HydrophobicContact CG-CG2 4.05Å; P2-V5 WeakPolarHBondContact O-CG2 3.35Å; P2-V5 PolarHBondContact O-N 3.19Å
3	L	77.1	Confident	75.8	Confident	142 Å²	142	124.4 Å²	124.4	74%	0.743	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.2	-16.4	175.6	-69.9	166.6	0	0	0	113.3	M1 V5 F6 F7	M1-L3 PolarHBondContact O-N 2.89Å; M1-L3 VanDerWaalsContact O-N 3.11Å; L3-V5 VanDerWaalsContact C-N 3.31Å; L3-V5 PolarHBondContact O-N 2.96Å; L3-F6 WeakPolarHBondContact O-CB 3.39Å; L3-F6 PolarHBondContact O-N 3.48Å; L3-F6 VanDerWaalsContact O-N 3.13Å; L3-F7 PolarHBondContact O-N 2.99Å
4	W	80.2	Confident	74.8	Confident	189 Å²	189	119.5 Å²	119.5	72%	0.716	61%	0.614	S	S	*	*	H	α-helix	trans	-64.1	-31.5	-179.1	-168.4	65.2	0	0	0	113.6	P2 F6 F7 F8	P2-W4 PolarHBondContact O-N 3.41Å; P2-W4 VanDerWaalsContact O-N 3.1Å; W4-F6 VanDerWaalsContact C-N 3.34Å; W4-F6 PolarHBondContact O-N 3.49Å; W4-F7 PolarHBondContact O-N 2.91Å; W4-F8 HydrophobicContact CZ2-CD2 4.49Å; W4-F8 PolarHBondContact O-N 3.47Å
5	V	81	Confident	73.9	Confident	80 Å²	80	117.5 Å²	117.5	49%	0.485	61%	0.614	S	S	.	*	H	α-helix	trans	-68.8	-31.1	173.8	-90.1	0	0	0	0	112.5	P2 L3 F8 V9	P2-V5 HydrophobicContact CB-CG2 4.46Å; P2-V5 HydrophobicContact CG-CG2 4.05Å; P2-V5 WeakPolarHBondContact O-CG2 3.35Å; P2-V5 PolarHBondContact O-N 3.19Å; L3-V5 VanDerWaalsContact C-N 3.31Å; L3-V5 PolarHBondContact O-N 2.96Å; V5-F8 PolarHBondContact O-N 3.33Å; V5-V9 WeakPolarHBondContact O-CB 3.49Å; V5-V9 VanDerWaalsContact O-CG2 3.25Å; V5-V9 WeakPolarHBondContact O-CG2 3.37Å; V5-V9 PolarHBondContact O-N 3.49Å
6	F	79	Confident	73	Confident	142 Å²	142	116.7 Å²	116.7	62%	0.623	62%	0.622	S	S	*	*	H	α-helix	trans	-65.8	-41.1	173.1	-88	-84.8	0	0	0	111.4	L3 W4 F8 V9 I10	L3-F6 WeakPolarHBondContact O-CB 3.39Å; L3-F6 PolarHBondContact O-N 3.48Å; L3-F6 VanDerWaalsContact O-N 3.13Å; W4-F6 VanDerWaalsContact C-N 3.34Å; W4-F6 PolarHBondContact O-N 3.49Å; F6-F8 VanDerWaalsContact C-N 3.31Å; F6-F8 PolarHBondContact O-N 3.23Å; F6-V9 PolarHBondContact O-N 3.07Å; F6-I10 WeakPolarHBondContact O-CB 3.3Å; F6-I10 WeakPolarHBondContact O-CD1 3.29Å; F6-I10 WeakPolarHBondContact O-CG1 3.37Å; F6-I10 PolarHBondContact O-N 2.92Å
7	F	79.3	Confident	72	Confident	139 Å²	139	114.6 Å²	114.6	61%	0.61	62%	0.619	S	S	*	*	H	α-helix	trans	-62.1	-41.7	175.3	-162.4	-93.1	0	0	0	111.3	L3 W4 I10 L11	L3-F7 PolarHBondContact O-N 2.99Å; W4-F7 PolarHBondContact O-N 2.91Å; F7-I10 PolarHBondContact O-N 3.35Å; F7-L11 WeakPolarHBondContact O-CB 3.33Å; F7-L11 PolarHBondContact O-N 3.33Å
8	F	80.4	Confident	70.9	Confident	125 Å²	125	117.3 Å²	117.3	55%	0.548	63%	0.627	S	S	.	*	H	α-helix	trans	-67.2	-37.9	177.9	-146.7	-87.2	0	0	0	112.8	W4 V5 F6 L11 A12	W4-F8 HydrophobicContact CZ2-CD2 4.49Å; W4-F8 PolarHBondContact O-N 3.47Å; V5-F8 PolarHBondContact O-N 3.33Å; F6-F8 VanDerWaalsContact C-N 3.31Å; F6-F8 PolarHBondContact O-N 3.23Å; F8-L11 PolarHBondContact O-N 3.32Å; F8-A12 VanDerWaalsContact O-CB 3.28Å; F8-A12 WeakPolarHBondContact O-CB 3.21Å; F8-A12 PolarHBondContact O-N 3.32Å
9	V	80.1	Confident	69.6	Low	92 Å²	92	117.4 Å²	117.4	56%	0.558	64%	0.636	S	S	*	*	H	α-helix	trans	-68.1	-43.5	175.4	168.5	0	0	0	0	111.2	V5 F6 L11 A12 L13	V5-V9 WeakPolarHBondContact O-CB 3.49Å; V5-V9 VanDerWaalsContact O-CG2 3.25Å; V5-V9 WeakPolarHBondContact O-CG2 3.37Å; V5-V9 PolarHBondContact O-N 3.49Å; F6-V9 PolarHBondContact O-N 3.07Å; V9-L11 VanDerWaalsContact C-N 3.34Å; V9-A12 PolarHBondContact O-N 3.41Å; V9-L13 VanDerWaalsContact O-CB 3.3Å; V9-L13 WeakPolarHBondContact O-CB 3.49Å; V9-L13 PolarHBondContact O-N 2.92Å
10	I	77.8	Confident	68.8	Low	101 Å²	101	116.5 Å²	116.5	52%	0.518	64%	0.639	S	S	.	*	H	α-helix	trans	-65.3	-40.2	176.4	-66.9	165.9	0	0	0	110.5	F6 F7 L13 S14	F6-I10 WeakPolarHBondContact O-CB 3.3Å; F6-I10 WeakPolarHBondContact O-CD1 3.29Å; F6-I10 WeakPolarHBondContact O-CG1 3.37Å; F6-I10 PolarHBondContact O-N 2.92Å; F7-I10 PolarHBondContact O-N 3.35Å; I10-L13 PolarHBondContact O-N 3.47Å; I10-S14 VanDerWaalsContact O-CB 3.32Å; I10-S14 WeakPolarHBondContact O-CB 3.28Å; I10-S14 PolarHBondContact O-N 2.98Å; I10-S14 PolarHBondContact O-OG 2.91Å
11	L	76.2	Confident	68	Low	100 Å²	100	116.5 Å²	116.5	52%	0.524	64%	0.644	S	S	.	*	H	α-helix	trans	-67.3	-40.6	177.8	-169.7	65.8	0	0	0	112	F7 F8 V9 S14 S15	F7-L11 WeakPolarHBondContact O-CB 3.33Å; F7-L11 PolarHBondContact O-N 3.33Å; F8-L11 PolarHBondContact O-N 3.32Å; V9-L11 VanDerWaalsContact C-N 3.34Å; L11-S14 PolarHBondContact O-N 3.48Å; L11-S15 WeakPolarHBondContact O-CB 3.33Å; L11-S15 PolarHBondContact O-N 2.93Å
12	A	73.5	Confident	67.7	Low	56 Å²	56	109.9 Å²	109.9	46%	0.463	62%	0.62	S	S	.	*	H	α-helix	trans	-67.4	-38.4	175	0	0	0	0	0	112.2	F8 V9 S15 S16	F8-A12 VanDerWaalsContact O-CB 3.28Å; F8-A12 WeakPolarHBondContact O-CB 3.21Å; F8-A12 PolarHBondContact O-N 3.32Å; V9-A12 PolarHBondContact O-N 3.41Å; A12-S15 PolarHBondContact O-N 2.72Å; A12-S16 PolarHBondContact O-N 3.44Å
13	L	62.9	Low	67	Low	134 Å²	134	109.2 Å²	109.2	70%	0.702	62%	0.615	S	S	*	*	H	α-helix	trans	-70.6	-35.7	177.5	-154.7	70.8	0	0	0	112	V9 I10	V9-L13 VanDerWaalsContact O-CB 3.3Å; V9-L13 WeakPolarHBondContact O-CB 3.49Å; V9-L13 PolarHBondContact O-N 2.92Å; I10-L13 PolarHBondContact O-N 3.47Å
14	S	62.3	Low	66	Low	56 Å²	56	106 Å²	106	39%	0.392	60%	0.603	S	S	.	*	H	α-helix	trans	-72	-33.7	175.2	-53.6	0	0	0	0	112.3	I10 L11 S16 S17	I10-S14 VanDerWaalsContact O-CB 3.32Å; I10-S14 WeakPolarHBondContact O-CB 3.28Å; I10-S14 PolarHBondContact O-N 2.98Å; I10-S14 PolarHBondContact O-OG 2.91Å; L11-S14 PolarHBondContact O-N 3.48Å; S14-S16 VanDerWaalsContact C-N 3.28Å; S14-S16 PolarHBondContact O-N 3.34Å; S14-S17 PolarHBondContact O-N 2.93Å; S14-S17 PolarHBondContact O-OG 2.87Å; S14-S17 VanDerWaalsContact O-OG 3.08Å
15	S	62	Low	64.8	Low	89 Å²	89	103.1 Å²	103.1	62%	0.622	60%	0.601	S	S	*	*	H	α-helix	trans	-65.1	-31.2	176.3	-169.1	0	0	0	0	112.3	L11 A12 S17	L11-S15 WeakPolarHBondContact O-CB 3.33Å; L11-S15 PolarHBondContact O-N 2.93Å; A12-S15 PolarHBondContact O-N 2.72Å; S15-S17 PolarHBondContact O-N 3.49Å
16	S	58.4	Low	63.5	Low	105 Å²	105	104.2 Å²	104.2	73%	0.734	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.7	-8.1	178.3	-165.3	0	0	0	0	114.6	A12 S14	A12-S16 PolarHBondContact O-N 3.44Å; S14-S16 VanDerWaalsContact C-N 3.28Å; S14-S16 PolarHBondContact O-N 3.34Å
17	S	57.2	Low	62.3	Low	82 Å²	82	101.8 Å²	101.8	57%	0.573	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.6	10.8	-174.7	63.7	0	0	0	0	115	S14 S15 C19	S14-S17 PolarHBondContact O-N 2.93Å; S14-S17 PolarHBondContact O-OG 2.87Å; S14-S17 VanDerWaalsContact O-OG 3.08Å; S15-S17 PolarHBondContact O-N 3.49Å; S17-C19 PolarHBondContact O-N 3.45Å
18	H	51.4	Low	61.2	Low	163 Å²	163	103.8 Å²	103.8	76%	0.755	61%	0.605	S	S	*	*			trans	-81.5	45.6	170.8	-65.3	-66.5	0	0	0	112.3	S20	H18-S20 PolarHBondContact O-N 3.25Å
19	C	46.7	Very low	60.1	Low	118 Å²	118	104.6 Å²	104.6	80%	0.797	61%	0.612	S	S	*	*			trans	-80.4	84.4	161.3	-153.8	0	0	0	0	106.9	S17	S17-C19 PolarHBondContact O-N 3.45Å
20	S	53.2	Low	59.1	Low	100 Å²	100	108.8 Å²	108.8	70%	0.699	62%	0.617	S	S	*	*			trans	-50.6	129.5	169.6	-159.2	0	0	0	0	108.1	H18 S22	H18-S20 PolarHBondContact O-N 3.25Å; S20-S22 PolarHBondContact O-N 3.38Å
21	P	52.4	Low	58.3	Low	116 Å²	116	113 Å²	113	75%	0.753	63%	0.627	S	S	*	*			trans	-64	101.9	179	24.9	-29.6	0	0	0	107.4	P23	P21-P23 VanDerWaalsContact O-N 3.15Å
22	S	58.1	Low	57.7	Low	82 Å²	82	116 Å²	116	57%	0.573	63%	0.632	S	S	*	*	P	Polyproline II helix	trans	-47.3	122.9	166.7	144.6	0	0	0	0	107	S20	S20-S22 PolarHBondContact O-N 3.38Å
23	P	57.6	Low	57.4	Low	82 Å²	82	115.2 Å²	115.2	53%	0.532	63%	0.626	S	S	.	*	P	Polyproline II helix	trans	-55	137.3	178.6	22.6	-31.3	0	0	0	108.1	P21 L25	P21-P23 VanDerWaalsContact O-N 3.15Å; P23-L25 PolarHBondContact O-N 3.28Å
24	P	55.4	Low	57.8	Low	76 Å²	76	113.3 Å²	113.3	49%	0.494	62%	0.617	S	S	.	*	P	Polyproline II helix	trans	-54.4	131.6	-172.5	21.3	-32	0	0	0	108.7	T26 L27	P24-T26 PolarHBondContact O-N 2.97Å; P24-L27 HydrophobicContact CG-CD1 4.02Å; P24-L27 PolarHBondContact O-N 2.98Å
25	L	55.8	Low	58.4	Low	128 Å²	128	113.4 Å²	113.4	67%	0.67	62%	0.621	S	S	*	*	H	α-helix	trans	-49.3	-24.2	-173.9	-68.2	162.6	0	0	0	112.9	P23 R28 M29	P23-L25 PolarHBondContact O-N 3.28Å; L25-R28 PolarHBondContact O-N 3.08Å; L25-M29 PolarHBondContact O-N 3.45Å
26	T	53.4	Low	59	Low	103 Å²	103	113.1 Å²	113.1	63%	0.632	61%	0.611	S	S	*	*	H	α-helix	trans	-61.4	-38.5	174.3	59.1	0	0	0	0	114	P24 R30	P24-T26 PolarHBondContact O-N 2.97Å; T26-R30 WeakPolarHBondContact O-CB 3.4Å; T26-R30 PolarHBondContact O-N 3.32Å
27	L	54.8	Low	59.5	Low	90 Å²	90	115.1 Å²	115.1	47%	0.471	61%	0.607	S	S	.	*	H	α-helix	trans	-70.1	-33.8	175.9	-90.2	164.6	0	0	0	111.8	P24 R31	P24-L27 HydrophobicContact CG-CD1 4.02Å; P24-L27 PolarHBondContact O-N 2.98Å; L27-R31 WeakPolarHBondContact O-CG 3.49Å; L27-R31 PolarHBondContact O-N 2.92Å
28	R	56	Low	60.5	Low	182 Å²	182	114.8 Å²	114.8	69%	0.687	60%	0.602	S	S	*	*	H	α-helix	trans	-71.3	-42.2	177.4	-150.1	178.4	-160.6	152.9	2.6	111	L25 Y32	L25-R28 PolarHBondContact O-N 3.08Å; R28-Y32 PolarHBondContact O-N 3.28Å; R28-Y32 VanDerWaalsContact O-N 3.13Å
29	M	57.7	Low	61.9	Low	141 Å²	141	111 Å²	111	70%	0.695	59%	0.587	S	S	*	*	H	α-helix	trans	-66.3	-40.6	175.9	-125.9	71.8	-177.5	0	0	112.4	L25 R31 Y32 A33	L25-M29 PolarHBondContact O-N 3.45Å; M29-R31 PolarHBondContact O-N 3.44Å; M29-Y32 PolarHBondContact O-N 2.89Å; M29-A33 PolarHBondContact O-N 3.21Å
30	R	58.4	Low	63.6	Low	180 Å²	180	108.2 Å²	108.2	68%	0.679	57%	0.569	S	S	*	*	H	α-helix	trans	-60.1	-45.6	177.2	-171.5	80.7	-178.4	-169.1	1.5	112	T26 Y32 A33 D34	T26-R30 WeakPolarHBondContact O-CB 3.4Å; T26-R30 PolarHBondContact O-N 3.32Å; R30-Y32 VanDerWaalsContact C-N 3.32Å; R30-Y32 PolarHBondContact O-N 3.44Å; R30-A33 PolarHBondContact O-N 3.29Å; R30-D34 PolarHBondContact O-N 3.49Å; R30-D34 VanDerWaalsContact O-N 3.08Å
31	R	61.1	Low	65.1	Low	189 Å²	189	111.2 Å²	111.2	71%	0.713	57%	0.566	S	S	*	*	H	α-helix	trans	-67.6	-32.6	177.1	-69.2	-175.5	-171.5	-169	3.4	112.7	L27 M29 A35	L27-R31 WeakPolarHBondContact O-CG 3.49Å; L27-R31 PolarHBondContact O-N 2.92Å; M29-R31 PolarHBondContact O-N 3.44Å; R31-A35 WeakPolarHBondContact O-CB 3.45Å; R31-A35 PolarHBondContact O-N 2.98Å
32	Y	63.2	Low	66.6	Low	164 Å²	164	114.6 Å²	114.6	64%	0.643	56%	0.564	S	S	*	*	H	α-helix	trans	-67.6	-43.8	176.1	-162.2	-96.8	0	0	0	111.6	R28 M29 R30 A35 I36	R28-Y32 PolarHBondContact O-N 3.28Å; R28-Y32 VanDerWaalsContact O-N 3.13Å; M29-Y32 PolarHBondContact O-N 2.89Å; R30-Y32 VanDerWaalsContact C-N 3.32Å; R30-Y32 PolarHBondContact O-N 3.44Å; Y32-A35 PolarHBondContact O-N 2.96Å; Y32-I36 HydrophobicContact CD1-CG1 4.09Å; Y32-I36 HydrophobicContact CE1-CD1 4.07Å; Y32-I36 HydrophobicContact CE1-CG1 3.98Å; Y32-I36 WeakPolarHBondContact O-CG1 3.39Å; Y32-I36 PolarHBondContact O-N 2.96Å
33	A	66.7	Low	68.1	Low	40 Å²	40	116.8 Å²	116.8	33%	0.331	56%	0.563	S	S	.	*	H	α-helix	trans	-61.8	-48	175.1	0	0	0	0	0	111.8	M29 R30 A35 I36 F37	M29-A33 PolarHBondContact O-N 3.21Å; R30-A33 PolarHBondContact O-N 3.29Å; A33-A35 VanDerWaalsContact C-N 3.3Å; A33-A35 PolarHBondContact O-N 3.13Å; A33-I36 PolarHBondContact O-N 3.5Å; A33-F37 HydrophobicContact CB-CE2 4.43Å; A33-F37 WeakPolarHBondContact O-CD2 3.28Å; A33-F37 PolarHBondContact O-N 3.34Å
34	D	71.2	Confident	69.7	Low	94 Å²	94	117 Å²	117	50%	0.503	56%	0.563	S	S	.	*	H	α-helix	trans	-60.5	-38.9	177.4	-90.8	-12.9	0	0	0	112.3	R30 T38	R30-D34 PolarHBondContact O-N 3.49Å; R30-D34 VanDerWaalsContact O-N 3.08Å; D34-T38 WeakPolarHBondContact O-CB 3.46Å; D34-T38 PolarHBondContact O-N 3.26Å; D34-T38 PolarHBondContact O-OG1 2.7Å
35	A	76.1	Confident	71.2	Confident	58 Å²	58	117.2 Å²	117.2	48%	0.479	56%	0.559	S	S	.	*	H	α-helix	trans	-66.9	-39.5	176.8	0	0	0	0	0	112.6	R31 Y32 A33 N39	R31-A35 WeakPolarHBondContact O-CB 3.45Å; R31-A35 PolarHBondContact O-N 2.98Å; Y32-A35 PolarHBondContact O-N 2.96Å; A33-A35 VanDerWaalsContact C-N 3.3Å; A33-A35 PolarHBondContact O-N 3.13Å; A35-N39 WeakPolarHBondContact O-CB 3.49Å; A35-N39 PolarHBondContact O-N 3.41Å
36	I	73.8	Confident	72.8	Confident	82 Å²	82	112.9 Å²	112.9	42%	0.421	55%	0.545	S	S	.	.	H	α-helix	trans	-64.7	-48.6	177.7	-69	-83.7	0	0	0	110.8	Y32 A33 S40	Y32-I36 HydrophobicContact CD1-CG1 4.09Å; Y32-I36 HydrophobicContact CE1-CD1 4.07Å; Y32-I36 HydrophobicContact CE1-CG1 3.98Å; Y32-I36 WeakPolarHBondContact O-CG1 3.39Å; Y32-I36 PolarHBondContact O-N 2.96Å; A33-I36 PolarHBondContact O-N 3.5Å; I36-S40 VanDerWaalsContact O-CB 3.29Å; I36-S40 WeakPolarHBondContact O-CB 3.33Å; I36-S40 PolarHBondContact O-N 3.23Å; I36-S40 PolarHBondContact O-OG 2.93Å
37	F	68.9	Low	74.7	Confident	147 Å²	147	114 Å²	114	65%	0.645	54%	0.543	S	S	*	.	H	α-helix	trans	-69	-42.5	-179.6	-70.9	-63.4	0	0	0	111.6	A33 N39 S40 Y41	A33-F37 HydrophobicContact CB-CE2 4.43Å; A33-F37 WeakPolarHBondContact O-CD2 3.28Å; A33-F37 PolarHBondContact O-N 3.34Å; F37-N39 PolarHBondContact O-N 3.34Å; F37-S40 PolarHBondContact O-N 2.84Å; F37-Y41 WeakPolarHBondContact O-CB 3.49Å; F37-Y41 PolarHBondContact O-N 3.47Å
38	T	78.8	Confident	76.6	Confident	75 Å²	75	113.7 Å²	113.7	46%	0.46	54%	0.542	S	S	.	.	H	α-helix	trans	-63.1	-42.5	177.5	-60.2	0	0	0	0	111.8	D34 R42	D34-T38 WeakPolarHBondContact O-CB 3.46Å; D34-T38 PolarHBondContact O-N 3.26Å; D34-T38 PolarHBondContact O-OG1 2.7Å; T38-R42 WeakPolarHBondContact O-CB 3.34Å; T38-R42 VanDerWaalsContact O-CG 3.31Å; T38-R42 WeakPolarHBondContact O-CG 3.28Å; T38-R42 PolarHBondContact O-N 3.29Å
39	N	81.1	Confident	78.3	Confident	85 Å²	85	108.3 Å²	108.3	46%	0.455	53%	0.532	S	S	.	.	H	α-helix	trans	-66.5	-47.5	177.7	-173.2	-5.4	0	0	0	111.3	A35 F37 Y41 R42 K43	A35-N39 WeakPolarHBondContact O-CB 3.49Å; A35-N39 PolarHBondContact O-N 3.41Å; F37-N39 PolarHBondContact O-N 3.34Å; N39-Y41 PolarHBondContact O-N 3.45Å; N39-R42 PolarHBondContact O-N 3.07Å; N39-K43 WeakPolarHBondContact O-CG 3.38Å; N39-K43 PolarHBondContact O-N 2.97Å; N39-K43 WeakPolarHBondContact OD1-CE 3.48Å
40	S	82.1	Confident	80	Confident	59 Å²	59	103.8 Å²	103.8	41%	0.413	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-41.7	178.6	-57.4	0	0	0	0	112.2	I36 F37 K43 V44	I36-S40 VanDerWaalsContact O-CB 3.29Å; I36-S40 WeakPolarHBondContact O-CB 3.33Å; I36-S40 PolarHBondContact O-N 3.23Å; I36-S40 PolarHBondContact O-OG 2.93Å; F37-S40 PolarHBondContact O-N 2.84Å; S40-K43 WeakPolarHBondContact O-CB 3.48Å; S40-K43 PolarHBondContact O-N 3.47Å; S40-V44 WeakPolarHBondContact O-CG2 3.42Å; S40-V44 PolarHBondContact O-N 2.86Å
41	Y	84.1	Confident	81.6	Confident	162 Å²	162	103.6 Å²	103.6	64%	0.635	52%	0.516	S	S	*	.	H	α-helix	trans	-61.4	-45.7	176.8	-177.4	-109.7	0	0	0	111.8	F37 N39 K43 V44 L45	F37-Y41 WeakPolarHBondContact O-CB 3.49Å; F37-Y41 PolarHBondContact O-N 3.47Å; N39-Y41 PolarHBondContact O-N 3.45Å; Y41-K43 VanDerWaalsContact C-N 3.32Å; Y41-K43 PolarHBondContact O-N 2.76Å; Y41-V44 PolarHBondContact O-N 3.08Å; Y41-L45 HydrophobicContact CD1-CD1 3.64Å; Y41-L45 HydrophobicContact CD2-CD1 4.47Å; Y41-L45 HydrophobicContact CE1-CD1 3.2Å; Y41-L45 HydrophobicContact CE1-CG 4.41Å; Y41-L45 HydrophobicContact CE2-CD1 4.12Å; Y41-L45 HydrophobicContact CG-CD1 4.26Å; Y41-L45 VanDerWaalsContact CZ-CD1 3.46Å; Y41-L45 WeakPolarHBondContact O-CB 3.45Å; Y41-L45 PolarHBondContact O-N 2.89Å
42	R	84.5	Confident	83.1	Confident	188 Å²	188	100.7 Å²	100.7	71%	0.709	51%	0.509	S	S	*	.	H	α-helix	trans	-60.6	-39.1	174.1	-77.6	178.8	136.5	-176.5	-4.5	112.6	T38 N39 G46	T38-R42 WeakPolarHBondContact O-CB 3.34Å; T38-R42 VanDerWaalsContact O-CG 3.31Å; T38-R42 WeakPolarHBondContact O-CG 3.28Å; T38-R42 PolarHBondContact O-N 3.29Å; N39-R42 PolarHBondContact O-N 3.07Å; R42-G46 PolarHBondContact O-N 3.42Å
43	K	89.5	Confident	84.5	Confident	127 Å²	127	97.9 Å²	97.9	55%	0.552	50%	0.504	S	S	*	.	H	α-helix	trans	-65.4	-45	176.1	-75.1	175.4	174.9	178.7	0	112.2	N39 S40 Y41 G46 Q47	N39-K43 WeakPolarHBondContact O-CG 3.38Å; N39-K43 PolarHBondContact O-N 2.97Å; N39-K43 WeakPolarHBondContact OD1-CE 3.48Å; S40-K43 WeakPolarHBondContact O-CB 3.48Å; S40-K43 PolarHBondContact O-N 3.47Å; Y41-K43 VanDerWaalsContact C-N 3.32Å; Y41-K43 PolarHBondContact O-N 2.76Å; K43-G46 PolarHBondContact O-N 2.76Å; K43-Q47 WeakPolarHBondContact O-CG 3.41Å; K43-Q47 PolarHBondContact O-N 3.19Å
44	V	90.5	Very high	85.7	Confident	88 Å²	88	101 Å²	101	53%	0.533	52%	0.515	S	S	.	.	H	α-helix	trans	-64.4	-41.6	178	173.3	0	0	0	0	111	S40 Y41 Q47 L48	S40-V44 WeakPolarHBondContact O-CG2 3.42Å; S40-V44 PolarHBondContact O-N 2.86Å; Y41-V44 PolarHBondContact O-N 3.08Å; V44-Q47 PolarHBondContact O-N 2.91Å; V44-L48 WeakPolarHBondContact O-CB 3.33Å; V44-L48 PolarHBondContact O-N 2.77Å
45	L	88	Confident	86.7	Confident	80 Å²	80	103 Å²	103	42%	0.419	52%	0.521	S	S	.	.	H	α-helix	trans	-63.8	-40	173.1	-84.6	161.9	0	0	0	112.8	Y41 L48 S49	Y41-L45 HydrophobicContact CD1-CD1 3.64Å; Y41-L45 HydrophobicContact CD2-CD1 4.47Å; Y41-L45 HydrophobicContact CE1-CD1 3.2Å; Y41-L45 HydrophobicContact CE1-CG 4.41Å; Y41-L45 HydrophobicContact CE2-CD1 4.12Å; Y41-L45 HydrophobicContact CG-CD1 4.26Å; Y41-L45 VanDerWaalsContact CZ-CD1 3.46Å; Y41-L45 WeakPolarHBondContact O-CB 3.45Å; Y41-L45 PolarHBondContact O-N 2.89Å; L45-L48 PolarHBondContact O-N 3.5Å; L45-S49 WeakPolarHBondContact O-CB 3.17Å; L45-S49 PolarHBondContact O-N 2.85Å; L45-S49 PolarHBondContact O-OG 3.49Å
46	G	89.2	Confident	87.4	Confident	36 Å²	36	103.5 Å²	103.5	37%	0.371	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-44.3	173	0	0	0	0	0	112.1	R42 K43 S49 A50	R42-G46 PolarHBondContact O-N 3.42Å; K43-G46 PolarHBondContact O-N 2.76Å; G46-S49 WeakPolarHBondContact CA-OG 3.31Å; G46-S49 PolarHBondContact O-OG 3.23Å; G46-A50 VanDerWaalsContact O-CB 3.25Å; G46-A50 WeakPolarHBondContact O-CB 3.38Å; G46-A50 PolarHBondContact O-N 2.84Å
47	Q	93.2	Very high	88.2	Confident	126 Å²	126	104 Å²	104	59%	0.589	52%	0.519	S	S	*	.	H	α-helix	trans	-65.4	-41.3	175.2	-73.1	178.5	-27.4	0	0	112.3	K43 V44 R51	K43-Q47 WeakPolarHBondContact O-CG 3.41Å; K43-Q47 PolarHBondContact O-N 3.19Å; V44-Q47 PolarHBondContact O-N 2.91Å; Q47-R51 WeakPolarHBondContact O-CB 3.38Å; Q47-R51 VanDerWaalsContact O-CG 3.23Å; Q47-R51 WeakPolarHBondContact O-CG 3.46Å; Q47-R51 PolarHBondContact O-N 3.46Å
48	L	93.9	Very high	89	Confident	85 Å²	85	102.5 Å²	102.5	45%	0.445	52%	0.515	S	S	.	.	H	α-helix	trans	-68.5	-42.2	-179.9	-173.2	64	0	0	0	111.7	V44 L45 R51 K52	V44-L48 WeakPolarHBondContact O-CB 3.33Å; V44-L48 PolarHBondContact O-N 2.77Å; L45-L48 PolarHBondContact O-N 3.5Å; L48-R51 PolarHBondContact O-N 3.16Å; L48-K52 WeakPolarHBondContact O-CG 3.32Å; L48-K52 PolarHBondContact O-N 3.29Å
49	S	91.5	Very high	89.1	Confident	69 Å²	69	102.2 Å²	102.2	48%	0.483	52%	0.516	S	S	.	.	H	α-helix	trans	-66	-44.2	175.6	55.1	0	0	0	0	111.6	L45 G46 R51 K52 L53	L45-S49 WeakPolarHBondContact O-CB 3.17Å; L45-S49 PolarHBondContact O-N 2.85Å; L45-S49 PolarHBondContact O-OG 3.49Å; G46-S49 WeakPolarHBondContact CA-OG 3.31Å; G46-S49 PolarHBondContact O-OG 3.23Å; S49-R51 VanDerWaalsContact C-N 3.34Å; S49-R51 PolarHBondContact O-N 3.13Å; S49-K52 PolarHBondContact O-N 2.81Å; S49-L53 WeakPolarHBondContact O-CB 3.33Å; S49-L53 PolarHBondContact O-N 2.88Å
50	A	93.6	Very high	89.1	Confident	46 Å²	46	105.6 Å²	105.6	38%	0.38	52%	0.522	S	S	.	.	H	α-helix	trans	-59.7	-43.3	173.9	0	0	0	0	0	111.9	G46 L53 L54	G46-A50 VanDerWaalsContact O-CB 3.25Å; G46-A50 WeakPolarHBondContact O-CB 3.38Å; G46-A50 PolarHBondContact O-N 2.84Å; A50-L53 PolarHBondContact O-N 3.29Å; A50-L54 WeakPolarHBondContact O-CB 3.23Å; A50-L54 WeakPolarHBondContact O-CD1 3.47Å; A50-L54 WeakPolarHBondContact O-CG 3.33Å; A50-L54 PolarHBondContact O-N 2.97Å
51	R	92.9	Very high	88.9	Confident	175 Å²	175	107.3 Å²	107.3	66%	0.66	52%	0.524	S	S	*	.	H	α-helix	trans	-61.8	-45.3	175.5	-79.5	177.8	174.9	-147.9	-0.6	112.3	Q47 L48 S49 L53 L54 Q55	Q47-R51 WeakPolarHBondContact O-CB 3.38Å; Q47-R51 VanDerWaalsContact O-CG 3.23Å; Q47-R51 WeakPolarHBondContact O-CG 3.46Å; Q47-R51 PolarHBondContact O-N 3.46Å; L48-R51 PolarHBondContact O-N 3.16Å; S49-R51 VanDerWaalsContact C-N 3.34Å; S49-R51 PolarHBondContact O-N 3.13Å; R51-L53 VanDerWaalsContact C-N 3.34Å; R51-L54 PolarHBondContact O-N 2.91Å; R51-Q55 WeakPolarHBondContact O-CB 3.48Å; R51-Q55 WeakPolarHBondContact O-CG 3.27Å; R51-Q55 PolarHBondContact O-N 3.28Å
52	K	92.9	Very high	88.3	Confident	129 Å²	129	106 Å²	106	56%	0.561	52%	0.523	S	S	*	.	H	α-helix	trans	-63.3	-40.4	176.4	-76.2	179.2	178.5	177.8	0	111.8	L48 S49 Q55 D56	L48-K52 WeakPolarHBondContact O-CG 3.32Å; L48-K52 PolarHBondContact O-N 3.29Å; S49-K52 PolarHBondContact O-N 2.81Å; K52-Q55 PolarHBondContact O-N 2.89Å; K52-D56 WeakPolarHBondContact O-CB 3.26Å; K52-D56 PolarHBondContact O-N 3.38Å
53	L	91.6	Very high	87.7	Confident	105 Å²	105	98.9 Å²	98.9	55%	0.55	51%	0.509	S	S	.	.	H	α-helix	trans	-64.7	-46.5	176.5	-178.7	64	0	0	0	111.8	S49 A50 R51 Q55 D56 I57	S49-L53 WeakPolarHBondContact O-CB 3.33Å; S49-L53 PolarHBondContact O-N 2.88Å; A50-L53 PolarHBondContact O-N 3.29Å; R51-L53 VanDerWaalsContact C-N 3.34Å; L53-Q55 VanDerWaalsContact C-N 3.33Å; L53-Q55 PolarHBondContact O-N 3.33Å; L53-D56 PolarHBondContact O-N 2.88Å; L53-I57 HydrophobicContact CD1-CD1 4.16Å; L53-I57 HydrophobicContact CD1-CG1 4.46Å; L53-I57 HydrophobicContact CG-CD1 3.98Å; L53-I57 VanDerWaalsContact O-CG1 3.3Å; L53-I57 WeakPolarHBondContact O-CG1 3.34Å; L53-I57 PolarHBondContact O-N 2.91Å
54	L	92.4	Very high	86.7	Confident	105 Å²	105	99 Å²	99	55%	0.55	51%	0.511	S	S	.	.	H	α-helix	trans	-59.4	-44	174.8	-82.3	156.3	0	0	0	111.5	A50 R51 I57 M58	A50-L54 WeakPolarHBondContact O-CB 3.23Å; A50-L54 WeakPolarHBondContact O-CD1 3.47Å; A50-L54 WeakPolarHBondContact O-CG 3.33Å; A50-L54 PolarHBondContact O-N 2.97Å; R51-L54 PolarHBondContact O-N 2.91Å; L54-I57 PolarHBondContact O-N 3.47Å; L54-M58 WeakPolarHBondContact O-CB 3.14Å; L54-M58 VanDerWaalsContact O-CG 3.23Å; L54-M58 WeakPolarHBondContact O-CG 3.31Å; L54-M58 PolarHBondContact O-N 3.03Å
55	Q	91.4	Very high	85.4	Confident	135 Å²	135	101.7 Å²	101.7	63%	0.631	51%	0.512	S	S	*	.	H	α-helix	trans	-62.7	-41.9	175.2	-77.7	-179.9	-14.8	0	0	112.3	R51 K52 L53 M58 S59	R51-Q55 WeakPolarHBondContact O-CB 3.48Å; R51-Q55 WeakPolarHBondContact O-CG 3.27Å; R51-Q55 PolarHBondContact O-N 3.28Å; K52-Q55 PolarHBondContact O-N 2.89Å; L53-Q55 VanDerWaalsContact C-N 3.33Å; L53-Q55 PolarHBondContact O-N 3.33Å; Q55-M58 PolarHBondContact O-N 3.17Å; Q55-S59 WeakPolarHBondContact O-CB 3.48Å; Q55-S59 PolarHBondContact O-N 2.86Å; Q55-S59 PolarHBondContact O-OG 2.95Å
56	D	91.3	Very high	84.2	Confident	70 Å²	70	103.4 Å²	103.4	37%	0.374	52%	0.521	S	S	.	.	H	α-helix	trans	-61.3	-48.9	176.3	-172.3	61.6	0	0	0	110.9	K52 L53 M58 S59 R60	K52-D56 WeakPolarHBondContact O-CB 3.26Å; K52-D56 PolarHBondContact O-N 3.38Å; L53-D56 PolarHBondContact O-N 2.88Å; D56-M58 PolarHBondContact O-N 3.34Å; D56-S59 PolarHBondContact O-N 3.32Å; D56-S59 PolarHBondContact O-OG 3.45Å; D56-R60 WeakPolarHBondContact O-CB 3.37Å; D56-R60 VanDerWaalsContact O-CG 3.31Å; D56-R60 WeakPolarHBondContact O-CG 3.34Å; D56-R60 PolarHBondContact O-N 3.45Å; D56-R60 IonicContact OD1-NE 2.91Å; D56-R60 IonicContact OD2-CZ 2.89Å; D56-R60 IonicContact OD2-NE 3.87Å; D56-R60 PolarHBondContact OD2-NE 3.45Å; D56-R60 IonicContact OD2-NH2 3.81Å
57	I	90.4	Very high	83.2	Confident	93 Å²	93	109 Å²	109	48%	0.477	54%	0.538	S	S	.	.	H	α-helix	trans	-60.8	-46.2	178.1	-65.7	167.2	0	0	0	111.2	L53 L54 R60 Q61	L53-I57 HydrophobicContact CD1-CD1 4.16Å; L53-I57 HydrophobicContact CD1-CG1 4.46Å; L53-I57 HydrophobicContact CG-CD1 3.98Å; L53-I57 VanDerWaalsContact O-CG1 3.3Å; L53-I57 WeakPolarHBondContact O-CG1 3.34Å; L53-I57 PolarHBondContact O-N 2.91Å; L54-I57 PolarHBondContact O-N 3.47Å; I57-R60 PolarHBondContact O-N 2.88Å; I57-Q61 WeakPolarHBondContact O-CB 3.22Å; I57-Q61 PolarHBondContact O-N 2.87Å
58	M	86.5	Confident	81.8	Confident	114 Å²	114	107.8 Å²	107.8	56%	0.562	53%	0.532	S	S	*	.	H	α-helix	trans	-64.2	-40.9	177.6	-73.9	179.6	65.9	0	0	111.9	L54 Q55 D56 Q61 Q62	L54-M58 WeakPolarHBondContact O-CB 3.14Å; L54-M58 VanDerWaalsContact O-CG 3.23Å; L54-M58 WeakPolarHBondContact O-CG 3.31Å; L54-M58 PolarHBondContact O-N 3.03Å; Q55-M58 PolarHBondContact O-N 3.17Å; D56-M58 PolarHBondContact O-N 3.34Å; M58-Q61 PolarHBondContact O-N 2.82Å; M58-Q62 VanDerWaalsContact O-CB 3.26Å; M58-Q62 WeakPolarHBondContact O-CB 3.39Å; M58-Q62 PolarHBondContact O-N 3.04Å
59	S	80.8	Confident	80.5	Confident	69 Å²	69	112.7 Å²	112.7	48%	0.483	55%	0.545	S	S	.	.	H	α-helix	trans	-65.7	-40.9	178.8	75	0	0	0	0	112	Q55 D56 Q62 G63	Q55-S59 WeakPolarHBondContact O-CB 3.48Å; Q55-S59 PolarHBondContact O-N 2.86Å; Q55-S59 PolarHBondContact O-OG 2.95Å; D56-S59 PolarHBondContact O-N 3.32Å; D56-S59 PolarHBondContact O-OG 3.45Å; S59-Q62 PolarHBondContact O-N 2.94Å; S59-G63 PolarHBondContact O-N 3.44Å
60	R	80.3	Confident	79.5	Confident	156 Å²	156	110.9 Å²	110.9	59%	0.589	54%	0.537	S	S	*	.	H	α-helix	trans	-62.3	-51.4	173.6	-72.9	172.2	177.7	-96.1	-2.8	110.9	D56 I57 Q62 G63 E64	D56-R60 WeakPolarHBondContact O-CB 3.37Å; D56-R60 VanDerWaalsContact O-CG 3.31Å; D56-R60 WeakPolarHBondContact O-CG 3.34Å; D56-R60 PolarHBondContact O-N 3.45Å; D56-R60 IonicContact OD1-NE 2.91Å; D56-R60 IonicContact OD2-CZ 2.89Å; D56-R60 IonicContact OD2-NE 3.87Å; D56-R60 PolarHBondContact OD2-NE 3.45Å; D56-R60 IonicContact OD2-NH2 3.81Å; I57-R60 PolarHBondContact O-N 2.88Å; R60-Q62 VanDerWaalsContact C-N 3.27Å; R60-Q62 PolarHBondContact O-N 2.77Å; R60-G63 PolarHBondContact O-N 3.24Å; R60-G63 VanDerWaalsContact O-N 3.17Å; R60-E64 WeakPolarHBondContact O-CB 3.2Å; R60-E64 WeakPolarHBondContact O-CG 3.41Å; R60-E64 PolarHBondContact O-N 3.25Å
61	Q	78.3	Confident	78.5	Confident	95 Å²	95	111 Å²	111	44%	0.444	54%	0.538	S	S	.	.	H	α-helix	trans	-61.5	-36.6	-179.7	-170.2	179.3	59.2	0	0	112.3	I57 M58 R65	I57-Q61 WeakPolarHBondContact O-CB 3.22Å; I57-Q61 PolarHBondContact O-N 2.87Å; M58-Q61 PolarHBondContact O-N 2.82Å; Q61-R65 WeakPolarHBondContact O-CB 3.3Å; Q61-R65 VanDerWaalsContact O-CG 3.22Å; Q61-R65 WeakPolarHBondContact O-CG 3.41Å; Q61-R65 PolarHBondContact O-N 3.46Å
62	Q	71.8	Confident	77.5	Confident	134 Å²	134	110.7 Å²	110.7	63%	0.626	54%	0.537	S	S	*	.	H	α-helix	trans	-74.4	-38	177.3	-171.1	156.1	-18.6	0	0	112.2	M58 S59 R60 N66	M58-Q62 VanDerWaalsContact O-CB 3.26Å; M58-Q62 WeakPolarHBondContact O-CB 3.39Å; M58-Q62 PolarHBondContact O-N 3.04Å; S59-Q62 PolarHBondContact O-N 2.94Å; R60-Q62 VanDerWaalsContact C-N 3.27Å; R60-Q62 PolarHBondContact O-N 2.77Å; Q62-N66 WeakPolarHBondContact O-CB 3.23Å; Q62-N66 PolarHBondContact O-N 3.23Å
63	G	71	Confident	76.8	Confident	39 Å²	39	106.6 Å²	106.6	40%	0.402	53%	0.527	S	S	.	.	H	α-helix	trans	-61.4	-47.9	172.5	0	0	0	0	0	112.2	S59 R60 N66 Q67	S59-G63 PolarHBondContact O-N 3.44Å; R60-G63 PolarHBondContact O-N 3.24Å; R60-G63 VanDerWaalsContact O-N 3.17Å; G63-N66 PolarHBondContact O-N 3.45Å; G63-Q67 VanDerWaalsContact O-CB 3.31Å; G63-Q67 WeakPolarHBondContact O-CB 3.43Å; G63-Q67 PolarHBondContact O-N 2.88Å
64	E	68.9	Low	76.1	Confident	129 Å²	129	110.3 Å²	110.3	60%	0.603	53%	0.534	S	S	*	.	H	α-helix	trans	-63	-45.5	177.9	-71	175.3	132.9	0	0	111.8	R60 N66 Q67 E68	R60-E64 WeakPolarHBondContact O-CB 3.2Å; R60-E64 WeakPolarHBondContact O-CG 3.41Å; R60-E64 PolarHBondContact O-N 3.25Å; E64-N66 VanDerWaalsContact C-N 3.31Å; E64-N66 PolarHBondContact O-N 2.9Å; E64-Q67 PolarHBondContact O-N 2.88Å; E64-E68 WeakPolarHBondContact O-CB 3.35Å; E64-E68 PolarHBondContact O-N 3.34Å
65	R	64.2	Low	75.5	Confident	146 Å²	146	110 Å²	110	55%	0.551	53%	0.532	S	S	*	.	H	α-helix	trans	-62.6	-36.6	176.4	-77.5	176.4	175.5	-178.7	1.2	112.7	Q61 R69	Q61-R65 WeakPolarHBondContact O-CB 3.3Å; Q61-R65 VanDerWaalsContact O-CG 3.22Å; Q61-R65 WeakPolarHBondContact O-CG 3.41Å; Q61-R65 PolarHBondContact O-N 3.46Å; R65-R69 VanDerWaalsContact O-CB 3.23Å; R65-R69 WeakPolarHBondContact O-CB 3.49Å; R65-R69 WeakPolarHBondContact O-CG 3.32Å; R65-R69 PolarHBondContact O-N 2.94Å
66	N	62.1	Low	75.1	Confident	115 Å²	115	105 Å²	105	62%	0.615	52%	0.517	S	S	*	.	H	α-helix	trans	-75.8	-37.6	179.7	-148.7	-14.6	0	0	0	111.2	Q62 G63 E64 G70	Q62-N66 WeakPolarHBondContact O-CB 3.23Å; Q62-N66 PolarHBondContact O-N 3.23Å; G63-N66 PolarHBondContact O-N 3.45Å; E64-N66 VanDerWaalsContact C-N 3.31Å; E64-N66 PolarHBondContact O-N 2.9Å; N66-G70 PolarHBondContact O-N 3.44Å
67	Q	67.9	Low	74.8	Confident	153 Å²	153	109.3 Å²	109.3	72%	0.715	53%	0.528	S	S	*	.	H	α-helix	trans	-66.5	-43.4	174.1	-171.9	160	28.9	0	0	112	G63 E64 G70 A71	G63-Q67 VanDerWaalsContact O-CB 3.31Å; G63-Q67 WeakPolarHBondContact O-CB 3.43Å; G63-Q67 PolarHBondContact O-N 2.88Å; E64-Q67 PolarHBondContact O-N 2.88Å; Q67-G70 PolarHBondContact O-N 3.43Å; Q67-A71 WeakPolarHBondContact O-CB 3.25Å; Q67-A71 PolarHBondContact O-N 3.44Å
68	E	63.8	Low	74.7	Confident	102 Å²	102	110.3 Å²	110.3	48%	0.477	53%	0.53	S	S	.	.	H	α-helix	trans	-68.3	-40.7	176.4	-164.6	-169.2	163.5	0	0	111.4	E64 G70 A71 R72	E64-E68 WeakPolarHBondContact O-CB 3.35Å; E64-E68 PolarHBondContact O-N 3.34Å; E68-G70 VanDerWaalsContact C-N 3.32Å; E68-G70 PolarHBondContact O-N 3.4Å; E68-A71 PolarHBondContact O-N 3.28Å; E68-R72 HydrophobicContact CG-CG 4.36Å; E68-R72 VanDerWaalsContact O-CB 3.27Å; E68-R72 WeakPolarHBondContact O-CB 3.46Å; E68-R72 WeakPolarHBondContact O-CG 3.36Å; E68-R72 PolarHBondContact O-N 2.85Å; E68-R72 IonicContact OE1-CZ 2.76Å; E68-R72 IonicContact OE1-NE 3.55Å; E68-R72 PolarHBondContact OE1-NE 2.96Å; E68-R72 IonicContact OE1-NH2 3.6Å; E68-R72 PolarHBondContact OE1-NH2 2.87Å
69	R	67.6	Low	74.7	Confident	188 Å²	188	109.2 Å²	109.2	71%	0.709	53%	0.53	S	S	*	.	H	α-helix	trans	-62.1	-40	172.4	-77.8	175.8	177.5	-157.9	-1.2	111.8	R65 A73	R65-R69 VanDerWaalsContact O-CB 3.23Å; R65-R69 WeakPolarHBondContact O-CB 3.49Å; R65-R69 WeakPolarHBondContact O-CG 3.32Å; R65-R69 PolarHBondContact O-N 2.94Å; R69-A73 WeakPolarHBondContact O-CB 3.33Å; R69-A73 PolarHBondContact O-N 3.37Å
70	G	69.8	Low	75.2	Confident	31 Å²	31	111 Å²	111	32%	0.32	53%	0.534	S	S	.	.	H	α-helix	trans	-64.3	-41.7	174.2	0	0	0	0	0	112.8	N66 Q67 E68 R74	N66-G70 PolarHBondContact O-N 3.44Å; Q67-G70 PolarHBondContact O-N 3.43Å; E68-G70 VanDerWaalsContact C-N 3.32Å; E68-G70 PolarHBondContact O-N 3.4Å; G70-R74 VanDerWaalsContact O-CG 3.28Å; G70-R74 WeakPolarHBondContact O-CG 3.48Å; G70-R74 PolarHBondContact O-N 2.92Å; G70-R74 VanDerWaalsContact O-N 3.13Å
71	A	73	Confident	75.6	Confident	48 Å²	48	106.5 Å²	106.5	40%	0.397	53%	0.527	S	S	.	.	H	α-helix	trans	-69.6	-43.6	176.8	0	0	0	0	0	112.1	Q67 E68 R74 L75	Q67-A71 WeakPolarHBondContact O-CB 3.25Å; Q67-A71 PolarHBondContact O-N 3.44Å; E68-A71 PolarHBondContact O-N 3.28Å; A71-R74 WeakPolarHBondContact O-CB 3.23Å; A71-R74 PolarHBondContact O-N 2.89Å; A71-L75 PolarHBondContact O-N 2.97Å
72	R	71.9	Confident	76.4	Confident	168 Å²	168	106.1 Å²	106.1	63%	0.634	53%	0.53	S	S	*	.	H	α-helix	trans	-65.5	-36	174.3	-77	-175.1	175.7	-111	1.7	112.4	E68 R74 L75 G76	E68-R72 HydrophobicContact CG-CG 4.36Å; E68-R72 VanDerWaalsContact O-CB 3.27Å; E68-R72 WeakPolarHBondContact O-CB 3.46Å; E68-R72 WeakPolarHBondContact O-CG 3.36Å; E68-R72 PolarHBondContact O-N 2.85Å; E68-R72 IonicContact OE1-CZ 2.76Å; E68-R72 IonicContact OE1-NE 3.55Å; E68-R72 PolarHBondContact OE1-NE 2.96Å; E68-R72 IonicContact OE1-NH2 3.6Å; E68-R72 PolarHBondContact OE1-NH2 2.87Å; R72-R74 VanDerWaalsContact C-N 3.3Å; R72-R74 PolarHBondContact O-N 3.25Å; R72-L75 PolarHBondContact O-N 3.32Å; R72-G76 PolarHBondContact O-N 3.39Å
73	A	77.4	Confident	77.4	Confident	44 Å²	44	107.6 Å²	107.6	36%	0.364	53%	0.531	S	S	.	.	H	α-helix	trans	-66.3	-34	173.3	0	0	0	0	0	112.1	R69 R77	R69-A73 WeakPolarHBondContact O-CB 3.33Å; R69-A73 PolarHBondContact O-N 3.37Å; A73-R77 WeakPolarHBondContact O-CG 3.47Å; A73-R77 PolarHBondContact O-N 2.83Å
74	R	77.2	Confident	78.4	Confident	183 Å²	183	108.2 Å²	108.2	69%	0.691	53%	0.531	S	S	*	.	H	α-helix	trans	-70.5	-44.2	173.6	-70.9	170.4	-174.5	-135.6	2.2	111.7	G70 A71 R72 Q78	G70-R74 VanDerWaalsContact O-CG 3.28Å; G70-R74 WeakPolarHBondContact O-CG 3.48Å; G70-R74 PolarHBondContact O-N 2.92Å; G70-R74 VanDerWaalsContact O-N 3.13Å; A71-R74 WeakPolarHBondContact O-CB 3.23Å; A71-R74 PolarHBondContact O-N 2.89Å; R72-R74 VanDerWaalsContact C-N 3.3Å; R72-R74 PolarHBondContact O-N 3.25Å; R74-Q78 PolarHBondContact O-N 2.89Å; R74-Q78 VanDerWaalsContact O-N 3.08Å
75	L	80.8	Confident	79.6	Confident	98 Å²	98	107.2 Å²	107.2	51%	0.513	53%	0.527	S	S	.	.	H	α-helix	trans	-66	-40.6	175.9	-77.1	174.2	0	0	0	112.4	A71 R72 R77 Q78 V79	A71-L75 PolarHBondContact O-N 2.97Å; R72-L75 PolarHBondContact O-N 3.32Å; L75-R77 PolarHBondContact O-N 2.91Å; L75-Q78 PolarHBondContact O-N 2.96Å; L75-Q78 VanDerWaalsContact O-N 3.16Å; L75-V79 WeakPolarHBondContact O-CG2 3.11Å; L75-V79 PolarHBondContact O-N 2.95Å
76	G	82.1	Confident	81.1	Confident	30 Å²	30	105.7 Å²	105.7	31%	0.309	53%	0.526	S	S	.	.	H	α-helix	trans	-58.1	-50.1	175.9	0	0	0	0	0	111.3	R72 Q78 V79 D80	R72-G76 PolarHBondContact O-N 3.39Å; G76-Q78 VanDerWaalsContact C-N 3.28Å; G76-Q78 PolarHBondContact O-N 3.32Å; G76-V79 PolarHBondContact O-N 3.21Å; G76-D80 WeakPolarHBondContact O-CB 3.48Å; G76-D80 PolarHBondContact O-N 3.01Å
77	R	84.3	Confident	82.7	Confident	161 Å²	161	104.3 Å²	104.3	61%	0.608	51%	0.514	S	S	*	.	H	α-helix	trans	-59.3	-37.6	175	-73.1	-169	-65.2	-104.9	4.2	113.2	A73 L75 S81	A73-R77 WeakPolarHBondContact O-CG 3.47Å; A73-R77 PolarHBondContact O-N 2.83Å; L75-R77 PolarHBondContact O-N 2.91Å; R77-S81 WeakPolarHBondContact O-CB 3.41Å; R77-S81 PolarHBondContact O-N 3.07Å; R77-S81 PolarHBondContact O-OG 3.42Å
78	Q	89.3	Confident	84	Confident	113 Å²	113	102.6 Å²	102.6	53%	0.528	51%	0.506	S	S	.	.	H	α-helix	trans	-68.3	-46.6	177.7	-173.2	179.8	21.6	0	0	111.7	R74 L75 G76 D80 S81 V82	R74-Q78 PolarHBondContact O-N 2.89Å; R74-Q78 VanDerWaalsContact O-N 3.08Å; L75-Q78 PolarHBondContact O-N 2.96Å; L75-Q78 VanDerWaalsContact O-N 3.16Å; G76-Q78 VanDerWaalsContact C-N 3.28Å; G76-Q78 PolarHBondContact O-N 3.32Å; Q78-D80 VanDerWaalsContact C-N 3.33Å; Q78-D80 PolarHBondContact O-N 3.42Å; Q78-S81 WeakPolarHBondContact CA-OG 3.31Å; Q78-S81 PolarHBondContact O-N 3.49Å; Q78-S81 PolarHBondContact O-OG 2.81Å; Q78-V82 WeakPolarHBondContact O-CG2 3.36Å; Q78-V82 PolarHBondContact O-N 3.46Å
79	V	87.1	Confident	85.4	Confident	91 Å²	91	103 Å²	103	55%	0.552	51%	0.51	S	S	*	.	H	α-helix	trans	-61.8	-43	178.1	170.5	0	0	0	0	110.7	L75 G76 S81 V82 W83	L75-V79 WeakPolarHBondContact O-CG2 3.11Å; L75-V79 PolarHBondContact O-N 2.95Å; G76-V79 PolarHBondContact O-N 3.21Å; V79-S81 VanDerWaalsContact C-N 3.33Å; V79-S81 PolarHBondContact O-N 2.86Å; V79-V82 PolarHBondContact O-N 2.96Å; V79-W83 WeakPolarHBondContact O-CB 3.41Å; V79-W83 PolarHBondContact O-N 2.97Å
80	D	90.4	Very high	86.8	Confident	107 Å²	107	98.1 Å²	98.1	57%	0.572	50%	0.495	S	S	*	.	H	α-helix	trans	-62.8	-40.4	177	-66	-24	0	0	0	111.4	G76 Q78 W83 A84	G76-D80 WeakPolarHBondContact O-CB 3.48Å; G76-D80 PolarHBondContact O-N 3.01Å; Q78-D80 VanDerWaalsContact C-N 3.33Å; Q78-D80 PolarHBondContact O-N 3.42Å; D80-W83 PolarHBondContact O-N 2.81Å; D80-A84 WeakPolarHBondContact O-CB 3.11Å; D80-A84 PolarHBondContact O-N 2.69Å
81	S	89.7	Confident	88	Confident	62 Å²	62	101.8 Å²	101.8	43%	0.434	51%	0.507	S	S	.	.	H	α-helix	trans	-66.9	-40.9	175.5	67.4	0	0	0	0	113	R77 Q78 V79 W83 A84 E85	R77-S81 WeakPolarHBondContact O-CB 3.41Å; R77-S81 PolarHBondContact O-N 3.07Å; R77-S81 PolarHBondContact O-OG 3.42Å; Q78-S81 WeakPolarHBondContact CA-OG 3.31Å; Q78-S81 PolarHBondContact O-N 3.49Å; Q78-S81 PolarHBondContact O-OG 2.81Å; V79-S81 VanDerWaalsContact C-N 3.33Å; V79-S81 PolarHBondContact O-N 2.86Å; S81-W83 VanDerWaalsContact C-N 3.34Å; S81-A84 PolarHBondContact O-N 2.9Å; S81-E85 WeakPolarHBondContact O-CB 3.1Å; S81-E85 WeakPolarHBondContact O-CG 3.2Å; S81-E85 PolarHBondContact O-N 3.02Å
82	V	94.9	Very high	89	Confident	86 Å²	86	104.7 Å²	104.7	52%	0.521	51%	0.512	S	S	.	.	H	α-helix	trans	-66.4	-39.2	176.8	170.8	0	0	0	0	110.8	Q78 V79 E85 Q86	Q78-V82 WeakPolarHBondContact O-CG2 3.36Å; Q78-V82 PolarHBondContact O-N 3.46Å; V79-V82 PolarHBondContact O-N 2.96Å; V82-E85 PolarHBondContact O-N 3.08Å; V82-Q86 VanDerWaalsContact O-CB 3.28Å; V82-Q86 WeakPolarHBondContact O-CB 3.38Å; V82-Q86 PolarHBondContact O-N 3.13Å
83	W	92.8	Very high	90.2	Very high	166 Å²	166	99.9 Å²	99.9	63%	0.629	50%	0.504	S	S	*	.	H	α-helix	trans	-63	-43.9	174.9	175.4	-100.6	0	0	0	112	V79 D80 S81 Q86 K87	V79-W83 WeakPolarHBondContact O-CB 3.41Å; V79-W83 PolarHBondContact O-N 2.97Å; D80-W83 PolarHBondContact O-N 2.81Å; S81-W83 VanDerWaalsContact C-N 3.34Å; W83-Q86 PolarHBondContact O-N 3.24Å; W83-K87 HydrophobicContact CZ2-CG 4.34Å; W83-K87 WeakPolarHBondContact O-CB 3.29Å; W83-K87 PolarHBondContact O-N 3.03Å
84	A	91.9	Very high	91	Very high	51 Å²	51	101.7 Å²	101.7	42%	0.421	51%	0.507	S	S	.	.	H	α-helix	trans	-62.7	-46.5	176.9	0	0	0	0	0	111.7	D80 S81 K87 Q88	D80-A84 WeakPolarHBondContact O-CB 3.11Å; D80-A84 PolarHBondContact O-N 2.69Å; S81-A84 PolarHBondContact O-N 2.9Å; A84-K87 PolarHBondContact O-N 3.49Å; A84-Q88 WeakPolarHBondContact O-CB 3.42Å; A84-Q88 PolarHBondContact O-N 3.42Å
85	E	94.4	Very high	91.9	Very high	109 Å²	109	98.1 Å²	98.1	51%	0.509	50%	0.501	S	S	.	.	H	α-helix	trans	-62.2	-42.5	176.2	-75.8	-63.9	144	0	0	112.3	S81 V82 K87 Q88 M89	S81-E85 WeakPolarHBondContact O-CB 3.1Å; S81-E85 WeakPolarHBondContact O-CG 3.2Å; S81-E85 PolarHBondContact O-N 3.02Å; V82-E85 PolarHBondContact O-N 3.08Å; E85-K87 VanDerWaalsContact C-N 3.32Å; E85-K87 PolarHBondContact O-N 3.26Å; E85-Q88 PolarHBondContact O-N 3.48Å; E85-M89 HydrophobicContact CB-CE 4.32Å; E85-M89 PolarHBondContact O-N 3.01Å
86	Q	95.5	Very high	92.6	Very high	114 Å²	114	97.6 Å²	97.6	53%	0.533	50%	0.502	S	S	.	.	H	α-helix	trans	-60.2	-44.2	175.9	-177.5	67.7	31.3	0	0	111.3	V82 W83 Q88 M89 E90	V82-Q86 VanDerWaalsContact O-CB 3.28Å; V82-Q86 WeakPolarHBondContact O-CB 3.38Å; V82-Q86 PolarHBondContact O-N 3.13Å; W83-Q86 PolarHBondContact O-N 3.24Å; Q86-Q88 VanDerWaalsContact C-N 3.31Å; Q86-Q88 PolarHBondContact O-N 3.02Å; Q86-M89 PolarHBondContact O-N 2.98Å; Q86-E90 WeakPolarHBondContact O-CB 3.37Å; Q86-E90 PolarHBondContact O-N 3.03Å
87	K	95	Very high	93.2	Very high	85 Å²	85	98.8 Å²	98.8	37%	0.37	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-39.2	176.8	-83.7	-74.6	164.3	-153.5	0	111.7	W83 A84 E85 E90 L91	W83-K87 HydrophobicContact CZ2-CG 4.34Å; W83-K87 WeakPolarHBondContact O-CB 3.29Å; W83-K87 PolarHBondContact O-N 3.03Å; A84-K87 PolarHBondContact O-N 3.49Å; E85-K87 VanDerWaalsContact C-N 3.32Å; E85-K87 PolarHBondContact O-N 3.26Å; K87-E90 IonicContact NZ-OE2 3.32Å; K87-E90 PolarHBondContact NZ-OE2 3.21Å; K87-E90 PolarHBondContact O-N 3.29Å; K87-L91 WeakPolarHBondContact O-CG 3.1Å; K87-L91 PolarHBondContact O-N 2.8Å; K87-L91 VanDerWaalsContact O-N 3.13Å
88	Q	94.7	Very high	93.7	Very high	117 Å²	117	96 Å²	96	55%	0.547	51%	0.506	S	S	.	.	H	α-helix	trans	-66.7	-45.9	177.8	-159.7	142.4	-48.9	0	0	111.3	A84 E85 Q86 E90 L91 E92	A84-Q88 WeakPolarHBondContact O-CB 3.42Å; A84-Q88 PolarHBondContact O-N 3.42Å; E85-Q88 PolarHBondContact O-N 3.48Å; Q86-Q88 VanDerWaalsContact C-N 3.31Å; Q86-Q88 PolarHBondContact O-N 3.02Å; Q88-E90 VanDerWaalsContact C-N 3.32Å; Q88-E90 PolarHBondContact O-N 3.2Å; Q88-L91 PolarHBondContact O-N 3.36Å; Q88-E92 WeakPolarHBondContact O-CG 3.32Å; Q88-E92 PolarHBondContact O-N 3.35Å
89	M	93.6	Very high	93.8	Very high	112 Å²	112	96.8 Å²	96.8	55%	0.552	51%	0.512	S	S	*	.	H	α-helix	trans	-59.9	-38.8	173.8	-85	-175.8	-87.7	0	0	113.1	E85 Q86 E92 S93	E85-M89 HydrophobicContact CB-CE 4.32Å; E85-M89 PolarHBondContact O-N 3.01Å; Q86-M89 PolarHBondContact O-N 2.98Å; M89-E92 PolarHBondContact O-N 2.84Å; M89-S93 WeakPolarHBondContact O-CB 3.48Å; M89-S93 PolarHBondContact O-N 2.86Å; M89-S93 PolarHBondContact O-OG 3.49Å
90	E	96.3	Very high	93.8	Very high	85 Å²	85	98.1 Å²	98.1	40%	0.397	51%	0.513	S	S	.	.	H	α-helix	trans	-60.9	-48	176.6	-167.6	-174	-177.4	0	0	110.6	Q86 K87 Q88 S93 I94	Q86-E90 WeakPolarHBondContact O-CB 3.37Å; Q86-E90 PolarHBondContact O-N 3.03Å; K87-E90 IonicContact NZ-OE2 3.32Å; K87-E90 PolarHBondContact NZ-OE2 3.21Å; K87-E90 PolarHBondContact O-N 3.29Å; Q88-E90 VanDerWaalsContact C-N 3.32Å; Q88-E90 PolarHBondContact O-N 3.2Å; E90-S93 PolarHBondContact O-N 2.68Å; E90-S93 PolarHBondContact O-OG 3.3Å; E90-I94 HydrophobicContact CG-CD1 4.16Å; E90-I94 WeakPolarHBondContact O-CD1 3.21Å; E90-I94 VanDerWaalsContact O-CG1 3.28Å; E90-I94 WeakPolarHBondContact O-CG1 3.33Å; E90-I94 PolarHBondContact O-N 3.46Å; E90-I94 VanDerWaalsContact O-N 3.08Å
91	L	96	Very high	93.6	Very high	108 Å²	108	100 Å²	100	57%	0.565	52%	0.516	S	S	*	.	H	α-helix	trans	-63.5	-44.8	178.8	-68.7	176.9	0	0	0	112.5	K87 Q88 S93 I94 L95	K87-L91 WeakPolarHBondContact O-CG 3.1Å; K87-L91 PolarHBondContact O-N 2.8Å; K87-L91 VanDerWaalsContact O-N 3.13Å; Q88-L91 PolarHBondContact O-N 3.36Å; L91-S93 VanDerWaalsContact C-N 3.31Å; L91-S93 PolarHBondContact O-N 3.08Å; L91-I94 PolarHBondContact O-N 3.42Å; L91-L95 PolarHBondContact O-N 3.5Å
92	E	94.8	Very high	93.1	Very high	109 Å²	109	103.7 Å²	103.7	51%	0.509	53%	0.526	S	S	.	.	H	α-helix	trans	-61.4	-41.8	176.9	-68.7	-62.7	165	0	0	111.3	Q88 M89 I94 L95 V96	Q88-E92 WeakPolarHBondContact O-CG 3.32Å; Q88-E92 PolarHBondContact O-N 3.35Å; M89-E92 PolarHBondContact O-N 2.84Å; E92-I94 VanDerWaalsContact C-N 3.33Å; E92-I94 PolarHBondContact O-N 3Å; E92-L95 PolarHBondContact O-N 3.06Å; E92-V96 VanDerWaalsContact O-CG2 3.3Å; E92-V96 WeakPolarHBondContact O-CG2 3.43Å; E92-V96 PolarHBondContact O-N 2.87Å
93	S	95.1	Very high	92.2	Very high	67 Å²	67	103.2 Å²	103.2	47%	0.469	53%	0.526	S	S	.	.	H	α-helix	trans	-63.6	-38.9	178.3	77.7	0	0	0	0	112.5	M89 E90 L91 A97	M89-S93 WeakPolarHBondContact O-CB 3.48Å; M89-S93 PolarHBondContact O-N 2.86Å; M89-S93 PolarHBondContact O-OG 3.49Å; E90-S93 PolarHBondContact O-N 2.68Å; E90-S93 PolarHBondContact O-OG 3.3Å; L91-S93 VanDerWaalsContact C-N 3.31Å; L91-S93 PolarHBondContact O-N 3.08Å; S93-A97 VanDerWaalsContact O-CB 3.29Å; S93-A97 WeakPolarHBondContact O-CB 3.21Å; S93-A97 PolarHBondContact O-N 3.46Å
94	I	96.1	Very high	90.9	Very high	82 Å²	82	104.4 Å²	104.4	42%	0.421	53%	0.531	S	S	.	.	H	α-helix	trans	-68.5	-43.4	178	-67.9	164.4	0	0	0	110.2	E90 L91 E92 A97 L98	E90-I94 HydrophobicContact CG-CD1 4.16Å; E90-I94 WeakPolarHBondContact O-CD1 3.21Å; E90-I94 VanDerWaalsContact O-CG1 3.28Å; E90-I94 WeakPolarHBondContact O-CG1 3.33Å; E90-I94 PolarHBondContact O-N 3.46Å; E90-I94 VanDerWaalsContact O-N 3.08Å; L91-I94 PolarHBondContact O-N 3.42Å; E92-I94 VanDerWaalsContact C-N 3.33Å; E92-I94 PolarHBondContact O-N 3Å; I94-A97 PolarHBondContact O-N 2.9Å; I94-L98 HydrophobicContact CG2-CD1 4.01Å; I94-L98 WeakPolarHBondContact O-CB 3.33Å; I94-L98 WeakPolarHBondContact O-CG 3.3Å; I94-L98 PolarHBondContact O-N 2.96Å
95	L	95.2	Very high	89.7	Confident	107 Å²	107	107.8 Å²	107.8	56%	0.56	54%	0.542	S	S	*	.	H	α-helix	trans	-59.4	-47.9	175.7	-88.6	162.1	0	0	0	111.6	L91 E92 A97 L98 L99	L91-L95 PolarHBondContact O-N 3.5Å; E92-L95 PolarHBondContact O-N 3.06Å; L95-A97 PolarHBondContact O-N 2.89Å; L95-L98 PolarHBondContact O-N 3.49Å; L95-L99 WeakPolarHBondContact O-CB 3.44Å; L95-L99 PolarHBondContact O-N 2.92Å
96	V	95.3	Very high	87.9	Confident	87 Å²	87	107.3 Å²	107.3	53%	0.527	55%	0.55	S	S	.	*	H	α-helix	trans	-62.1	-43.6	177.3	172.5	0	0	0	0	111	E92 L98 L99 Q100	E92-V96 VanDerWaalsContact O-CG2 3.3Å; E92-V96 WeakPolarHBondContact O-CG2 3.43Å; E92-V96 PolarHBondContact O-N 2.87Å; V96-L98 PolarHBondContact O-N 2.91Å; V96-L99 PolarHBondContact O-N 3.43Å; V96-Q100 WeakPolarHBondContact O-CB 3.28Å; V96-Q100 PolarHBondContact O-N 3.35Å
97	A	94.8	Very high	86.1	Confident	56 Å²	56	110.2 Å²	110.2	46%	0.463	56%	0.564	S	S	.	*	H	α-helix	trans	-63	-41.2	178	0	0	0	0	0	112.4	S93 I94 L95 K101	S93-A97 VanDerWaalsContact O-CB 3.29Å; S93-A97 WeakPolarHBondContact O-CB 3.21Å; S93-A97 PolarHBondContact O-N 3.46Å; I94-A97 PolarHBondContact O-N 2.9Å; L95-A97 PolarHBondContact O-N 2.89Å; A97-K101 WeakPolarHBondContact O-CB 3.16Å; A97-K101 PolarHBondContact O-N 3.43Å
98	L	94.6	Very high	84	Confident	103 Å²	103	112.3 Å²	112.3	54%	0.539	61%	0.609	S	S	.	*	H	α-helix	trans	-67	-42.4	176.1	-77	170.3	0	0	0	112.1	I94 L95 V96 K101 H102	I94-L98 HydrophobicContact CG2-CD1 4.01Å; I94-L98 WeakPolarHBondContact O-CB 3.33Å; I94-L98 WeakPolarHBondContact O-CG 3.3Å; I94-L98 PolarHBondContact O-N 2.96Å; L95-L98 PolarHBondContact O-N 3.49Å; V96-L98 PolarHBondContact O-N 2.91Å; L98-K101 PolarHBondContact O-N 3.36Å; L98-H102 PolarHBondContact O-N 3.06Å
99	L	91.2	Very high	83.4	Confident	128 Å²	128	112.1 Å²	112.1	67%	0.67	61%	0.612	S	S	*	*	H	α-helix	trans	-62.7	-45.8	177.1	-174.9	65	0	0	0	111.1	L95 V96 K101 H102 S103	L95-L99 WeakPolarHBondContact O-CB 3.44Å; L95-L99 PolarHBondContact O-N 2.92Å; V96-L99 PolarHBondContact O-N 3.43Å; L99-K101 VanDerWaalsContact C-N 3.34Å; L99-K101 PolarHBondContact O-N 3.13Å; L99-H102 PolarHBondContact O-N 3.49Å; L99-S103 WeakPolarHBondContact O-CB 3.25Å; L99-S103 PolarHBondContact O-N 3.34Å
100	Q	86.9	Confident	82.9	Confident	119 Å²	119	112.1 Å²	112.1	56%	0.556	62%	0.616	S	S	*	*	H	α-helix	trans	-64.9	-39.2	177.1	-163.9	-178.3	1.5	0	0	111.4	V96 H102 S103 R104	V96-Q100 WeakPolarHBondContact O-CB 3.28Å; V96-Q100 PolarHBondContact O-N 3.35Å; Q100-H102 PolarHBondContact O-N 3.34Å; Q100-S103 PolarHBondContact O-N 3.31Å; Q100-R104 WeakPolarHBondContact O-CB 3.45Å; Q100-R104 PolarHBondContact O-N 3.46Å
101	K	87.6	Confident	82.1	Confident	146 Å²	146	113.6 Å²	113.6	64%	0.635	63%	0.628	S	S	*	*	H	α-helix	trans	-61.4	-42.5	175.8	-177.3	179.4	179.7	-173.7	0	111.9	A97 L98 L99 R104 N105	A97-K101 WeakPolarHBondContact O-CB 3.16Å; A97-K101 PolarHBondContact O-N 3.43Å; L98-K101 PolarHBondContact O-N 3.36Å; L99-K101 VanDerWaalsContact C-N 3.34Å; L99-K101 PolarHBondContact O-N 3.13Å; K101-R104 PolarHBondContact O-N 2.9Å; K101-N105 WeakPolarHBondContact O-CB 2.96Å; K101-N105 PolarHBondContact O-N 3.11Å
102	H	79.3	Confident	81.3	Confident	141 Å²	141	113.9 Å²	113.9	65%	0.653	63%	0.631	S	S	*	*	H	α-helix	trans	-72.1	-40.2	179.7	-164.5	-162.6	0	0	0	112.1	L98 L99 Q100 R104 N105 S106	L98-H102 PolarHBondContact O-N 3.06Å; L99-H102 PolarHBondContact O-N 3.49Å; Q100-H102 PolarHBondContact O-N 3.34Å; H102-R104 VanDerWaalsContact C-N 3.3Å; H102-R104 PolarHBondContact O-N 3.34Å; H102-N105 PolarHBondContact O-N 3.44Å; H102-S106 PolarHBondContact O-N 3.1Å
103	S	74.4	Confident	80.5	Confident	76 Å²	76	114.2 Å²	114.2	53%	0.531	64%	0.639	S	S	.	*	H	α-helix	trans	-60	-39.8	173	174.6	0	0	0	0	112.2	L99 Q100	L99-S103 WeakPolarHBondContact O-CB 3.25Å; L99-S103 PolarHBondContact O-N 3.34Å; Q100-S103 PolarHBondContact O-N 3.31Å
104	R	66.1	Low	79.5	Confident	190 Å²	190	117.3 Å²	117.3	72%	0.717	65%	0.65	S	S	*	*	H	α-helix	trans	-69.7	-33.5	176.7	-128.7	177.6	166.5	133.6	-1.5	113.3	Q100 K101 H102 S106	Q100-R104 WeakPolarHBondContact O-CB 3.45Å; Q100-R104 PolarHBondContact O-N 3.46Å; K101-R104 PolarHBondContact O-N 2.9Å; H102-R104 VanDerWaalsContact C-N 3.3Å; H102-R104 PolarHBondContact O-N 3.34Å; R104-S106 VanDerWaalsContact C-N 3.31Å
105	N	66.8	Low	78.3	Confident	123 Å²	123	119.9 Å²	119.9	66%	0.658	67%	0.667	S	S	*	*	H	α-helix	trans	-81.3	-10.4	-178.4	-154.5	9.4	0	0	0	113.2	K101 H102	K101-N105 WeakPolarHBondContact O-CB 2.96Å; K101-N105 PolarHBondContact O-N 3.11Å; H102-N105 PolarHBondContact O-N 3.44Å
106	S	57.5	Low	77	Confident	98 Å²	98	120.8 Å²	120.8	69%	0.685	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	-2.3	175.2	-168.8	0	0	0	0	113.5	H102 R104	H102-S106 PolarHBondContact O-N 3.1Å; R104-S106 VanDerWaalsContact C-N 3.31Å
107	Q	56.4	Low	75.5	Confident	176 Å²	176	123.7 Å²	123.7	82%	0.822	69%	0.687	S	S	*	*			trans	-107.9	6.3	179.5	-77.6	-169.7	-25.6	0	0	114
108	G	50.7	Low	73.8	Confident	128 Å²	128	129.8 Å²	129.8	100%	1.32	71%	0.708	S	S	*	*			trans	-117.2	0	172.4	0	0	0	0	0	110.6

Retrieved 108 of 108 residues in 73.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).