A0A096NXU3_PAPAN Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A096NXU3, Species PAPAN (Papio anubis, Olive baboon), Gene GNG4, Length 75 aa.

						>A0A096NXU3_PAPAN|A0A096NXU3|GNG4
IKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	48.7	Very low	58.9	Low	223 Å²	223	130.5 Å²	130.5	100%	1.144	72%	0.72	S	S	*	*				0	130.2	0	-61.9	168.1	0	0	0	107.1
2	K	48.8	Very low	61.6	Low	199 Å²	199	125 Å²	125	87%	0.865	70%	0.697	S	S	*	*			trans	96.9	69	-174.9	-66.9	-175.6	169.9	179.2	0	116.4
3	E	47.3	Very low	64	Low	204 Å²	204	122.2 Å²	122.2	95%	0.953	68%	0.678	S	S	*	*			trans	-126.5	131.9	133	-74.3	-155.6	150	0	0	106.9
4	G	52.4	Low	66	Low	76 Å²	76	118.1 Å²	118.1	78%	0.784	66%	0.662	S	S	*	*			trans	129.9	47.4	175.8	0	0	0	0	0	117
5	M	51.3	Low	67.9	Low	179 Å²	179	118.5 Å²	118.5	88%	0.882	66%	0.657	S	S	*	*			trans	-148.3	122.1	160.8	-128.3	105.8	78	0	0	104.2
6	S	54.8	Low	69.6	Low	59 Å²	59	114.6 Å²	114.6	41%	0.413	64%	0.644	S	S	.	*			cis	-169.3	96.2	34.5	-51.2	0	0	0	0	109.5	N8 S9	S6-N8 PolarHBondContact O-N 3.48Å; S6-S9 WeakPolarHBondContact CB-OG 3.3Å; S6-S9 PolarHBondContact O-N 3.42Å
7	N	58.5	Low	71.2	Confident	138 Å²	138	118 Å²	118	74%	0.738	65%	0.645	S	S	*	*	H	α-helix	trans	-69.8	-15.7	175.1	-48.7	-6.1	0	0	0	111.5	T10 T11	N7-T10 PolarHBondContact O-OG1 3.45Å; N7-T11 PolarHBondContact O-OG1 3.33Å
8	N	61.9	Low	72.7	Confident	135 Å²	135	120.8 Å²	120.8	72%	0.722	65%	0.65	S	S	*	*	H	α-helix	trans	-74.7	-27.8	177.2	-72.7	17.2	0	0	0	112.9	S6 S12	S6-N8 PolarHBondContact O-N 3.48Å; N8-S12 WeakPolarHBondContact O-CB 3.49Å; N8-S12 PolarHBondContact O-N 3.1Å; N8-S12 PolarHBondContact O-OG 3.26Å
9	S	66.3	Low	73.9	Confident	57 Å²	57	117.1 Å²	117.1	40%	0.399	64%	0.637	S	S	.	*	H	α-helix	trans	-72.4	-36.1	-175.8	-54.6	0	0	0	0	112.3	S6 S12 I13	S6-S9 WeakPolarHBondContact CB-OG 3.3Å; S6-S9 PolarHBondContact O-N 3.42Å; S9-S12 WeakPolarHBondContact CA-OG 3.23Å; S9-S12 PolarHBondContact O-OG 3.36Å; S9-I13 WeakPolarHBondContact O-CB 3.31Å; S9-I13 WeakPolarHBondContact O-CD1 3.49Å; S9-I13 WeakPolarHBondContact O-CG1 3.29Å; S9-I13 PolarHBondContact O-N 2.74Å; S9-I13 VanDerWaalsContact O-N 3.15Å
10	T	76.1	Confident	75.1	Confident	96 Å²	96	114.8 Å²	114.8	59%	0.589	63%	0.627	S	S	*	*	H	α-helix	trans	-72.7	-36	176.7	52.4	0	0	0	0	111.6	N7 I13 S14	N7-T10 PolarHBondContact O-OG1 3.45Å; T10-I13 PolarHBondContact O-N 2.97Å; T10-S14 PolarHBondContact O-N 3.39Å
11	T	82.1	Confident	76.2	Confident	70 Å²	70	114.5 Å²	114.5	43%	0.429	62%	0.621	S	S	.	*	H	α-helix	trans	-69.6	-41	175.9	-55.7	0	0	0	0	111.9	N7 I13 S14 Q15	N7-T11 PolarHBondContact O-OG1 3.33Å; T11-I13 VanDerWaalsContact C-N 3.33Å; T11-I13 PolarHBondContact O-N 3.36Å; T11-S14 PolarHBondContact O-N 3.03Å; T11-S14 PolarHBondContact O-OG 3.22Å; T11-Q15 WeakPolarHBondContact O-CB 3.37Å; T11-Q15 VanDerWaalsContact O-CG 3.3Å; T11-Q15 WeakPolarHBondContact O-CG 3.41Å; T11-Q15 PolarHBondContact O-N 3.35Å
12	S	90.6	Very high	78.6	Confident	64 Å²	64	108.3 Å²	108.3	45%	0.448	59%	0.587	S	S	.	*	H	α-helix	trans	-66	-37.6	175.2	64.3	0	0	0	0	111.8	N8 S9 A16	N8-S12 WeakPolarHBondContact O-CB 3.49Å; N8-S12 PolarHBondContact O-N 3.1Å; N8-S12 PolarHBondContact O-OG 3.26Å; S9-S12 WeakPolarHBondContact CA-OG 3.23Å; S9-S12 PolarHBondContact O-OG 3.36Å; S12-A16 WeakPolarHBondContact O-CB 3.35Å; S12-A16 PolarHBondContact O-N 3.48Å
13	I	92.9	Very high	80.9	Confident	88 Å²	88	103.9 Å²	103.9	45%	0.451	57%	0.573	S	S	.	*	H	α-helix	trans	-64.9	-42.6	174.3	-69.6	164	0	0	0	111.4	S9 T10 T11 A16 R17	S9-I13 WeakPolarHBondContact O-CB 3.31Å; S9-I13 WeakPolarHBondContact O-CD1 3.49Å; S9-I13 WeakPolarHBondContact O-CG1 3.29Å; S9-I13 PolarHBondContact O-N 2.74Å; S9-I13 VanDerWaalsContact O-N 3.15Å; T10-I13 PolarHBondContact O-N 2.97Å; T11-I13 VanDerWaalsContact C-N 3.33Å; T11-I13 PolarHBondContact O-N 3.36Å; I13-A16 PolarHBondContact O-N 3.22Å; I13-R17 VanDerWaalsContact O-CG 3.31Å; I13-R17 WeakPolarHBondContact O-CG 3.34Å; I13-R17 PolarHBondContact O-N 3.28Å
14	S	92.2	Very high	83.3	Confident	65 Å²	65	99.8 Å²	99.8	46%	0.455	55%	0.552	S	S	.	*	H	α-helix	trans	-67.2	-39.1	179.2	68.8	0	0	0	0	112.1	T10 T11 R17 K18	T10-S14 PolarHBondContact O-N 3.39Å; T11-S14 PolarHBondContact O-N 3.03Å; T11-S14 PolarHBondContact O-OG 3.22Å; S14-R17 PolarHBondContact O-N 2.86Å; S14-K18 PolarHBondContact O-N 3.42Å
15	Q	94.9	Very high	85.5	Confident	125 Å²	125	102.4 Å²	102.4	58%	0.584	55%	0.545	S	S	*	.	H	α-helix	trans	-62.6	-46.1	172.6	-73	174.8	-18.2	0	0	112	T11 R17 K18 A19	T11-Q15 WeakPolarHBondContact O-CB 3.37Å; T11-Q15 VanDerWaalsContact O-CG 3.3Å; T11-Q15 WeakPolarHBondContact O-CG 3.41Å; T11-Q15 PolarHBondContact O-N 3.35Å; Q15-R17 VanDerWaalsContact C-N 3.32Å; Q15-R17 PolarHBondContact O-N 3.47Å; Q15-K18 PolarHBondContact O-N 3.4Å; Q15-A19 PolarHBondContact O-N 3.49Å
16	A	95.6	Very high	87.6	Confident	55 Å²	55	97.9 Å²	97.9	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-60.7	-41.6	177.5	0	0	0	0	0	111.7	S12 I13 A19 V20	S12-A16 WeakPolarHBondContact O-CB 3.35Å; S12-A16 PolarHBondContact O-N 3.48Å; I13-A16 PolarHBondContact O-N 3.22Å; A16-A19 PolarHBondContact O-N 3.29Å; A16-V20 WeakPolarHBondContact O-CG2 3.2Å; A16-V20 PolarHBondContact O-N 2.91Å
17	R	96.6	Very high	89.7	Confident	173 Å²	173	98.1 Å²	98.1	65%	0.653	53%	0.528	S	S	*	.	H	α-helix	trans	-60.9	-45.8	174.4	-73.4	173.2	-176.2	-86.3	0.3	111.7	I13 S14 Q15 A19 V20 E21	I13-R17 VanDerWaalsContact O-CG 3.31Å; I13-R17 WeakPolarHBondContact O-CG 3.34Å; I13-R17 PolarHBondContact O-N 3.28Å; S14-R17 PolarHBondContact O-N 2.86Å; Q15-R17 VanDerWaalsContact C-N 3.32Å; Q15-R17 PolarHBondContact O-N 3.47Å; R17-A19 VanDerWaalsContact C-N 3.31Å; R17-A19 PolarHBondContact O-N 3.02Å; R17-V20 PolarHBondContact O-N 3.31Å; R17-E21 WeakPolarHBondContact O-CG 3.1Å; R17-E21 PolarHBondContact O-N 3.22Å
18	K	96.9	Very high	91.4	Very high	169 Å²	169	96.6 Å²	96.6	74%	0.735	53%	0.526	S	S	*	.	H	α-helix	trans	-59.8	-42.7	176.7	-172.6	179.7	178.1	-177.2	0	111.7	S14 Q15 E21 Q22	S14-K18 PolarHBondContact O-N 3.42Å; Q15-K18 PolarHBondContact O-N 3.4Å; K18-E21 PolarHBondContact O-N 3.3Å; K18-Q22 PolarHBondContact O-N 3.42Å
19	A	97.3	Very high	93.1	Very high	50 Å²	50	95.8 Å²	95.8	41%	0.413	52%	0.52	S	S	.	.	H	α-helix	trans	-63.6	-40.9	176.7	0	0	0	0	0	112.1	Q15 A16 R17 Q22 L23	Q15-A19 PolarHBondContact O-N 3.49Å; A16-A19 PolarHBondContact O-N 3.29Å; R17-A19 VanDerWaalsContact C-N 3.31Å; R17-A19 PolarHBondContact O-N 3.02Å; A19-Q22 PolarHBondContact O-N 2.93Å; A19-L23 WeakPolarHBondContact O-CB 3.19Å; A19-L23 VanDerWaalsContact O-CG 3.29Å; A19-L23 WeakPolarHBondContact O-CG 3.49Å; A19-L23 PolarHBondContact O-N 3.2Å
20	V	97.9	Very high	94.5	Very high	70 Å²	70	101.1 Å²	101.1	42%	0.424	54%	0.544	S	S	.	.	H	α-helix	trans	-62.2	-44	176.4	167.8	0	0	0	0	111.5	A16 R17 Q22 L23 K24	A16-V20 WeakPolarHBondContact O-CG2 3.2Å; A16-V20 PolarHBondContact O-N 2.91Å; R17-V20 PolarHBondContact O-N 3.31Å; V20-Q22 VanDerWaalsContact C-N 3.33Å; V20-Q22 PolarHBondContact O-N 3.06Å; V20-L23 PolarHBondContact O-N 2.95Å; V20-K24 HydrophobicContact CG1-CD 4.23Å; V20-K24 VanDerWaalsContact O-CG 3.3Å; V20-K24 WeakPolarHBondContact O-CG 3.44Å; V20-K24 PolarHBondContact O-N 3.42Å
21	E	97.7	Very high	95.5	Very high	109 Å²	109	105.3 Å²	105.3	51%	0.509	55%	0.549	S	S	.	.	H	α-helix	trans	-64.5	-37.9	177.5	-64.3	-48.6	126.1	0	0	112	R17 K18 K24 M25	R17-E21 WeakPolarHBondContact O-CG 3.1Å; R17-E21 PolarHBondContact O-N 3.22Å; K18-E21 PolarHBondContact O-N 3.3Å; E21-K24 IonicContact OE1-NZ 2.74Å; E21-K24 PolarHBondContact OE1-NZ 3.4Å; E21-K24 IonicContact OE2-NZ 3.69Å; E21-M25 PolarHBondContact O-N 2.93Å
22	Q	97.9	Very high	96.3	Very high	93 Å²	93	107.2 Å²	107.2	44%	0.435	56%	0.56	S	S	.	*	H	α-helix	trans	-62.1	-49.4	173.1	-178.1	62.3	26.3	0	0	111.9	K18 A19 V20 K24 M25 E26	K18-Q22 PolarHBondContact O-N 3.42Å; A19-Q22 PolarHBondContact O-N 2.93Å; V20-Q22 VanDerWaalsContact C-N 3.33Å; V20-Q22 PolarHBondContact O-N 3.06Å; Q22-K24 VanDerWaalsContact C-N 3.3Å; Q22-K24 PolarHBondContact O-N 2.97Å; Q22-M25 WeakPolarHBondContact O-CB 3.47Å; Q22-M25 PolarHBondContact O-N 3.01Å; Q22-M25 VanDerWaalsContact O-N 3.1Å; Q22-E26 WeakPolarHBondContact CG-OE1 3.45Å; Q22-E26 PolarHBondContact NE2-OE1 3Å; Q22-E26 PolarHBondContact O-N 3.34Å
23	L	98.1	Very high	96.6	Very high	107 Å²	107	112 Å²	112	56%	0.56	57%	0.573	S	S	*	*	H	α-helix	trans	-63.9	-35.1	-178.7	-71.4	170.4	0	0	0	112.3	A19 V20 M25 E26 A27	A19-L23 WeakPolarHBondContact O-CB 3.19Å; A19-L23 VanDerWaalsContact O-CG 3.29Å; A19-L23 WeakPolarHBondContact O-CG 3.49Å; A19-L23 PolarHBondContact O-N 3.2Å; V20-L23 PolarHBondContact O-N 2.95Å; L23-M25 VanDerWaalsContact C-N 3.32Å; L23-M25 PolarHBondContact O-N 3.03Å; L23-E26 PolarHBondContact O-N 3.41Å; L23-A27 VanDerWaalsContact O-CB 3.23Å; L23-A27 WeakPolarHBondContact O-CB 3.3Å; L23-A27 PolarHBondContact O-N 3.15Å
24	K	97.9	Very high	96.9	Very high	118 Å²	118	113.7 Å²	113.7	51%	0.513	59%	0.587	S	S	.	*	H	α-helix	trans	-61	-41.7	173.3	-75.5	171.4	-178.6	171.1	0	111.8	V20 E21 Q22 C28	V20-K24 HydrophobicContact CG1-CD 4.23Å; V20-K24 VanDerWaalsContact O-CG 3.3Å; V20-K24 WeakPolarHBondContact O-CG 3.44Å; V20-K24 PolarHBondContact O-N 3.42Å; E21-K24 IonicContact OE1-NZ 2.74Å; E21-K24 PolarHBondContact OE1-NZ 3.4Å; E21-K24 IonicContact OE2-NZ 3.69Å; Q22-K24 VanDerWaalsContact C-N 3.3Å; Q22-K24 PolarHBondContact O-N 2.97Å; K24-C28 PolarHBondContact O-N 3.49Å
25	M	97.4	Very high	97.2	Very high	131 Å²	131	114.7 Å²	114.7	65%	0.645	59%	0.594	S	S	*	*	H	α-helix	trans	-63.7	-48.7	176.1	-173.4	-173	-63.8	0	0	111.1	E21 Q22 L23 A27 C28	E21-M25 PolarHBondContact O-N 2.93Å; Q22-M25 WeakPolarHBondContact O-CB 3.47Å; Q22-M25 PolarHBondContact O-N 3.01Å; Q22-M25 VanDerWaalsContact O-N 3.1Å; L23-M25 VanDerWaalsContact C-N 3.32Å; L23-M25 PolarHBondContact O-N 3.03Å; M25-A27 VanDerWaalsContact C-N 3.33Å; M25-A27 PolarHBondContact O-N 3.49Å; M25-C28 PolarHBondContact O-N 2.95Å
26	E	96.9	Very high	97.3	Very high	83 Å²	83	113.3 Å²	113.3	39%	0.388	59%	0.588	S	S	.	*	H	α-helix	trans	-65.8	-33.3	179.9	-69.2	175.3	-168.1	0	0	113.1	Q22 L23 C28 M29 R31	Q22-E26 WeakPolarHBondContact CG-OE1 3.45Å; Q22-E26 PolarHBondContact NE2-OE1 3Å; Q22-E26 PolarHBondContact O-N 3.34Å; L23-E26 PolarHBondContact O-N 3.41Å; E26-C28 VanDerWaalsContact C-N 3.29Å; E26-C28 PolarHBondContact O-N 3.17Å; E26-M29 PolarHBondContact O-N 3.25Å; E26-R31 PolarHBondContact O-NH2 3.39Å
27	A	97.2	Very high	97.5	Very high	65 Å²	65	112.4 Å²	112.4	54%	0.537	58%	0.58	S	S	.	*	H	α-helix	trans	-64.1	-37.1	176.1	0	0	0	0	0	111.6	L23 M25 M29 R31	L23-A27 VanDerWaalsContact O-CB 3.23Å; L23-A27 WeakPolarHBondContact O-CB 3.3Å; L23-A27 PolarHBondContact O-N 3.15Å; M25-A27 VanDerWaalsContact C-N 3.33Å; M25-A27 PolarHBondContact O-N 3.49Å; A27-M29 VanDerWaalsContact C-N 3.28Å; A27-M29 PolarHBondContact O-N 3.11Å; A27-R31 PolarHBondContact O-NH1 3.23Å
28	C	95.9	Very high	97.6	Very high	105 Å²	105	106.7 Å²	106.7	71%	0.709	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.9	1.8	-178.6	-160.5	0	0	0	0	114.1	K24 M25 E26 D30	K24-C28 PolarHBondContact O-N 3.49Å; M25-C28 PolarHBondContact O-N 2.95Å; E26-C28 VanDerWaalsContact C-N 3.29Å; E26-C28 PolarHBondContact O-N 3.17Å; C28-D30 PolarHBondContact O-N 3.39Å
29	M	96.3	Very high	97.6	Very high	119 Å²	119	101 Å²	101	59%	0.586	55%	0.554	S	S	*	*			trans	-68.3	132.6	176.3	-67.8	-178.8	67.5	0	0	111.3	E26 A27 R31	E26-M29 PolarHBondContact O-N 3.25Å; A27-M29 VanDerWaalsContact C-N 3.28Å; A27-M29 PolarHBondContact O-N 3.11Å; M29-R31 PolarHBondContact O-N 2.95Å; M29-R31 PolarHBondContact O-NH1 2.89Å
30	D	97.1	Very high	97.7	Very high	168 Å²	168	102.8 Å²	102.8	90%	0.898	56%	0.557	S	S	*	*			trans	-65.6	131.4	172.3	-68.1	-45	0	0	0	110.5	C28	C28-D30 PolarHBondContact O-N 3.39Å
31	R	96.8	Very high	97.7	Very high	185 Å²	185	105.1 Å²	105.1	70%	0.698	57%	0.566	S	S	*	*			trans	-114.3	140.5	-179.4	-65.3	176.4	-178.7	78.8	2.1	109.7	E26 A27 M29	E26-R31 PolarHBondContact O-NH2 3.39Å; A27-R31 PolarHBondContact O-NH1 3.23Å; M29-R31 PolarHBondContact O-N 2.95Å; M29-R31 PolarHBondContact O-NH1 2.89Å
32	V	97.6	Very high	97.7	Very high	110 Å²	110	104.7 Å²	104.7	67%	0.667	57%	0.567	S	S	*	*			trans	-89.1	158.1	167.6	-61.7	0	0	0	0	110.3	A37	V32-A37 HydrophobicContact CG2-CB 4.09Å
33	K	98.3	Very high	97.8	Very high	163 Å²	163	102.9 Å²	102.9	71%	0.709	57%	0.568	S	S	*	*			trans	-64.1	138.9	172.7	-67.4	-178.1	-178	174	0	109.5	S35 Q36 A37	K33-S35 PolarHBondContact O-N 3.26Å; K33-Q36 HydrophobicContact CB-CB 4.34Å; K33-Q36 WeakPolarHBondContact O-CB 3.4Å; K33-Q36 PolarHBondContact O-N 2.9Å; K33-A37 PolarHBondContact O-N 3.06Å
34	V	98.3	Very high	97.8	Very high	125 Å²	125	104.8 Å²	104.8	76%	0.758	57%	0.569	S	S	*	*	H	α-helix	trans	-57.1	-37.6	176.1	178.2	0	0	0	0	111.2	Q36 A37 A38	V34-Q36 VanDerWaalsContact C-N 3.3Å; V34-Q36 PolarHBondContact O-N 3.2Å; V34-A37 PolarHBondContact O-N 2.77Å; V34-A38 VanDerWaalsContact O-CB 3.3Å; V34-A38 WeakPolarHBondContact O-CB 3.3Å; V34-A38 PolarHBondContact O-N 2.91Å
35	S	98.3	Very high	97.8	Very high	86 Å²	86	103 Å²	103	60%	0.601	57%	0.57	S	S	*	*	H	α-helix	trans	-62.4	-35.3	175.9	60.7	0	0	0	0	113	K33 A39	K33-S35 PolarHBondContact O-N 3.26Å; S35-A39 WeakPolarHBondContact O-CB 3.41Å; S35-A39 PolarHBondContact O-N 2.77Å; S35-A39 VanDerWaalsContact O-N 3.11Å
36	Q	98.3	Very high	97.8	Very high	96 Å²	96	102.8 Å²	102.8	45%	0.449	57%	0.567	S	S	.	*	H	α-helix	trans	-70.4	-51	176.2	-176.6	61.6	49.5	0	0	110.3	K33 V34 A38 A39 D40	K33-Q36 HydrophobicContact CB-CB 4.34Å; K33-Q36 WeakPolarHBondContact O-CB 3.4Å; K33-Q36 PolarHBondContact O-N 2.9Å; V34-Q36 VanDerWaalsContact C-N 3.3Å; V34-Q36 PolarHBondContact O-N 3.2Å; Q36-A38 PolarHBondContact O-N 2.92Å; Q36-A39 WeakPolarHBondContact O-CB 3.44Å; Q36-A39 PolarHBondContact O-N 2.96Å; Q36-D40 PolarHBondContact NE2-OD1 3.4Å; Q36-D40 VanDerWaalsContact O-CG 3.24Å; Q36-D40 PolarHBondContact O-N 3.33Å
37	A	98.4	Very high	97.8	Very high	36 Å²	36	101.9 Å²	101.9	30%	0.298	57%	0.574	S	S	.	*	H	α-helix	trans	-57.7	-39.6	178.3	0	0	0	0	0	111.9	V32 K33 V34 D40 L41	V32-A37 HydrophobicContact CG2-CB 4.09Å; K33-A37 PolarHBondContact O-N 3.06Å; V34-A37 PolarHBondContact O-N 2.77Å; A37-D40 PolarHBondContact O-N 3.35Å; A37-L41 VanDerWaalsContact O-CG 3.25Å; A37-L41 WeakPolarHBondContact O-CG 3.47Å; A37-L41 PolarHBondContact O-N 2.98Å
38	A	98.4	Very high	97.8	Very high	53 Å²	53	102.4 Å²	102.4	44%	0.438	57%	0.566	S	S	.	*	H	α-helix	trans	-64.9	-41.3	175.6	0	0	0	0	0	112.5	V34 Q36 L41 L42	V34-A38 VanDerWaalsContact O-CB 3.3Å; V34-A38 WeakPolarHBondContact O-CB 3.3Å; V34-A38 PolarHBondContact O-N 2.91Å; Q36-A38 PolarHBondContact O-N 2.92Å; A38-L41 PolarHBondContact O-N 3.17Å; A38-L42 WeakPolarHBondContact O-CB 3.49Å; A38-L42 PolarHBondContact O-N 3.05Å
39	A	98.5	Very high	97.8	Very high	49 Å²	49	100 Å²	100	41%	0.405	55%	0.547	S	S	.	.	H	α-helix	trans	-64.6	-41.2	176.1	0	0	0	0	0	111.7	S35 Q36 L42 A43	S35-A39 WeakPolarHBondContact O-CB 3.41Å; S35-A39 PolarHBondContact O-N 2.77Å; S35-A39 VanDerWaalsContact O-N 3.11Å; Q36-A39 WeakPolarHBondContact O-CB 3.44Å; Q36-A39 PolarHBondContact O-N 2.96Å; A39-L42 PolarHBondContact O-N 3.46Å; A39-A43 WeakPolarHBondContact O-CB 3.25Å; A39-A43 PolarHBondContact O-N 3.46Å
40	D	98.3	Very high	97.7	Very high	87 Å²	87	104.4 Å²	104.4	47%	0.465	56%	0.557	S	S	.	*	H	α-helix	trans	-64.2	-42.9	177.9	-61.9	-24.8	0	0	0	111.3	Q36 A37 A43 Y44	Q36-D40 PolarHBondContact NE2-OD1 3.4Å; Q36-D40 VanDerWaalsContact O-CG 3.24Å; Q36-D40 PolarHBondContact O-N 3.33Å; A37-D40 PolarHBondContact O-N 3.35Å; D40-A43 PolarHBondContact O-N 2.89Å; D40-Y44 WeakPolarHBondContact O-CB 3.36Å; D40-Y44 PolarHBondContact O-N 3.01Å
41	L	98.4	Very high	97.6	Very high	119 Å²	119	103.5 Å²	103.5	62%	0.623	55%	0.548	S	S	*	.	H	α-helix	trans	-62.8	-43.8	174.8	-71.3	173	0	0	0	111.8	A37 A38 Y44 C45	A37-L41 VanDerWaalsContact O-CG 3.25Å; A37-L41 WeakPolarHBondContact O-CG 3.47Å; A37-L41 PolarHBondContact O-N 2.98Å; A38-L41 PolarHBondContact O-N 3.17Å; L41-Y44 PolarHBondContact O-N 3.43Å; L41-C45 PolarHBondContact O-N 3.41Å; L41-C45 PolarHBondContact O-SG 2.86Å
42	L	98.1	Very high	97.6	Very high	101 Å²	101	97.6 Å²	97.6	53%	0.529	53%	0.53	S	S	.	.	H	α-helix	trans	-61.5	-49.1	177.3	-172.9	78.4	0	0	0	110.8	A38 A39 Y44 C45 E46	A38-L42 WeakPolarHBondContact O-CB 3.49Å; A38-L42 PolarHBondContact O-N 3.05Å; A39-L42 PolarHBondContact O-N 3.46Å; L42-Y44 VanDerWaalsContact C-N 3.28Å; L42-Y44 PolarHBondContact O-N 3.31Å; L42-C45 PolarHBondContact O-N 3.38Å; L42-C45 VanDerWaalsContact O-N 3.16Å; L42-E46 HydrophobicContact CG-CG 4.39Å; L42-E46 WeakPolarHBondContact O-CG 3.4Å; L42-E46 PolarHBondContact O-N 3.16Å
43	A	98.4	Very high	97.4	Very high	54 Å²	54	95.8 Å²	95.8	45%	0.446	52%	0.521	S	S	.	.	H	α-helix	trans	-59.4	-40.5	179.6	0	0	0	0	0	111.7	A39 D40 E46 A47	A39-A43 WeakPolarHBondContact O-CB 3.25Å; A39-A43 PolarHBondContact O-N 3.46Å; D40-A43 PolarHBondContact O-N 2.89Å; A43-E46 PolarHBondContact O-N 3.03Å; A43-A47 WeakPolarHBondContact O-CB 3.45Å; A43-A47 PolarHBondContact O-N 3.32Å
44	Y	98.4	Very high	97.2	Very high	148 Å²	148	95.7 Å²	95.7	58%	0.58	53%	0.527	S	S	*	.	H	α-helix	trans	-62	-48.3	175.1	-178.6	-91.8	0	0	0	111.8	D40 L41 L42 A47 H48	D40-Y44 WeakPolarHBondContact O-CB 3.36Å; D40-Y44 PolarHBondContact O-N 3.01Å; L41-Y44 PolarHBondContact O-N 3.43Å; L42-Y44 VanDerWaalsContact C-N 3.28Å; L42-Y44 PolarHBondContact O-N 3.31Å; Y44-A47 PolarHBondContact O-N 3.19Å; Y44-H48 AromaticContact CD2-CE1 3.66Å; Y44-H48 AromaticContact CD2-ND1 3.75Å; Y44-H48 AromaticContact CE2-CE1 3.4Å; Y44-H48 WeakPolarHBondContact CE2-CE1 3.3Å; Y44-H48 AromaticContact CE2-ND1 3.65Å; Y44-H48 AromaticContact CZ-CE1 3.93Å; Y44-H48 AromaticContact CZ-ND1 3.84Å; Y44-H48 PolarHBondContact O-N 2.81Å; Y44-H48 PolarHBondContact O-ND1 2.93Å
45	C	98.1	Very high	97.1	Very high	79 Å²	79	95 Å²	95	53%	0.534	52%	0.518	S	S	.	.	H	α-helix	trans	-60.9	-46.6	177.9	-70.4	0	0	0	0	111.4	L41 L42 A47 H48 V49	L41-C45 PolarHBondContact O-N 3.41Å; L41-C45 PolarHBondContact O-SG 2.86Å; L42-C45 PolarHBondContact O-N 3.38Å; L42-C45 VanDerWaalsContact O-N 3.16Å; C45-A47 VanDerWaalsContact C-N 3.32Å; C45-A47 PolarHBondContact O-N 2.85Å; C45-H48 PolarHBondContact O-N 2.98Å; C45-V49 WeakPolarHBondContact O-CA 3.4Å; C45-V49 VanDerWaalsContact O-CB 3.3Å; C45-V49 WeakPolarHBondContact O-CB 3.48Å; C45-V49 PolarHBondContact O-N 3.5Å
46	E	96.8	Very high	96.9	Very high	127 Å²	127	94.6 Å²	94.6	59%	0.593	51%	0.508	S	S	*	.	H	α-helix	trans	-63	-37	179.2	-72.6	179.1	165.5	0	0	112.9	L42 A43 H48 V49	L42-E46 HydrophobicContact CG-CG 4.39Å; L42-E46 WeakPolarHBondContact O-CG 3.4Å; L42-E46 PolarHBondContact O-N 3.16Å; A43-E46 PolarHBondContact O-N 3.03Å; E46-H48 VanDerWaalsContact C-N 3.35Å; E46-V49 WeakPolarHBondContact O-CG1 3.33Å
47	A	97.6	Very high	96.6	Very high	65 Å²	65	95.3 Å²	95.3	54%	0.537	52%	0.521	S	S	.	.	H	α-helix	trans	-66.1	-36.5	176.9	0	0	0	0	0	112.4	A43 Y44 C45	A43-A47 WeakPolarHBondContact O-CB 3.45Å; A43-A47 PolarHBondContact O-N 3.32Å; Y44-A47 PolarHBondContact O-N 3.19Å; C45-A47 VanDerWaalsContact C-N 3.32Å; C45-A47 PolarHBondContact O-N 2.85Å
48	H	97.3	Very high	96.3	Very high	76 Å²	76	96.2 Å²	96.2	35%	0.352	52%	0.523	S	S	.	.	H	α-helix	trans	-105.4	-6.8	-172.6	-60.5	85.7	0	0	0	114.3	Y44 C45 E46 R50 E51 D52	Y44-H48 AromaticContact CD2-CE1 3.66Å; Y44-H48 AromaticContact CD2-ND1 3.75Å; Y44-H48 AromaticContact CE2-CE1 3.4Å; Y44-H48 WeakPolarHBondContact CE2-CE1 3.3Å; Y44-H48 AromaticContact CE2-ND1 3.65Å; Y44-H48 AromaticContact CZ-CE1 3.93Å; Y44-H48 AromaticContact CZ-ND1 3.84Å; Y44-H48 PolarHBondContact O-N 2.81Å; Y44-H48 PolarHBondContact O-ND1 2.93Å; C45-H48 PolarHBondContact O-N 2.98Å; E46-H48 VanDerWaalsContact C-N 3.35Å; H48-R50 PolarHBondContact O-N 3.48Å; H48-E51 PolarHBondContact O-N 3.04Å; H48-D52 PolarHBondContact O-N 3.24Å
49	V	96.4	Very high	96	Very high	53 Å²	53	97 Å²	97	32%	0.321	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.6	-30.4	-177.6	69.9	0	0	0	0	112.7	C45 E46 E51 I55 I56	C45-V49 WeakPolarHBondContact O-CA 3.4Å; C45-V49 VanDerWaalsContact O-CB 3.3Å; C45-V49 WeakPolarHBondContact O-CB 3.48Å; C45-V49 PolarHBondContact O-N 3.5Å; E46-V49 WeakPolarHBondContact O-CG1 3.33Å; V49-E51 VanDerWaalsContact C-N 3.29Å; V49-E51 PolarHBondContact O-N 3.38Å; V49-I55 HydrophobicContact CG2-CB 4.36Å; V49-I55 HydrophobicContact CG2-CG2 3.62Å; V49-I56 WeakPolarHBondContact O-CG1 3.32Å
50	R	93.9	Very high	95.6	Very high	213 Å²	213	97 Å²	97	80%	0.804	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.4	-21.2	-180	-62.8	-172.7	-179.7	-153.8	0.8	114.1	H48 I56	H48-R50 PolarHBondContact O-N 3.48Å; R50-I56 HydrophobicContact CB-CD1 4.32Å; R50-I56 HydrophobicContact CG-CD1 4.09Å
51	E	94.4	Very high	95.1	Very high	148 Å²	148	97.2 Å²	97.2	69%	0.692	53%	0.532	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.7	-10	-179.1	-61.3	178.7	-170.2	0	0	111.8	H48 V49 P53	H48-E51 PolarHBondContact O-N 3.04Å; V49-E51 VanDerWaalsContact C-N 3.29Å; V49-E51 PolarHBondContact O-N 3.38Å; E51-P53 WeakPolarHBondContact O-CD 3.46Å
52	D	96.4	Very high	94.7	Very high	62 Å²	62	97.8 Å²	97.8	33%	0.332	53%	0.531	S	S	.	.			trans	-82.7	107.3	178	-171.1	-28.2	0	0	0	110.9	H48 L54 I55 I56	H48-D52 PolarHBondContact O-N 3.24Å; D52-L54 PolarHBondContact O-N 2.89Å; D52-L54 WeakPolarHBondContact OD1-CA 3.45Å; D52-L54 VanDerWaalsContact OD1-CB 3.29Å; D52-L54 WeakPolarHBondContact OD1-CB 3.29Å; D52-L54 PolarHBondContact OD1-N 3.36Å; D52-I55 HydrophobicContact CB-CB 4.19Å; D52-I55 HydrophobicContact CB-CG1 4.14Å; D52-I55 PolarHBondContact O-N 3.22Å; D52-I55 PolarHBondContact OD1-N 2.86Å; D52-I55 WeakPolarHBondContact OD2-CG1 3.47Å; D52-I56 PolarHBondContact O-N 3.18Å
53	P	94.6	Very high	94.5	Very high	72 Å²	72	95.9 Å²	95.9	47%	0.468	52%	0.522	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.5	-15.2	-177.6	-20.1	36.7	0	0	0	113.9	E51 I56 V58	E51-P53 WeakPolarHBondContact O-CD 3.46Å; P53-I56 CarbonylContact C-O 3.48Å; P53-I56 WeakPolarHBondContact CA-O 3.15Å; P53-V58 HydrophobicContact CB-CG1 3.84Å; P53-V58 HydrophobicContact CB-CG2 4.28Å; P53-V58 HydrophobicContact CG-CG1 4.26Å
54	L	94.2	Very high	94.1	Very high	160 Å²	160	98.8 Å²	98.8	84%	0.838	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.5	-27.6	179.2	-57.2	179.7	0	0	0	111.6	D52	D52-L54 PolarHBondContact O-N 2.89Å; D52-L54 WeakPolarHBondContact OD1-CA 3.45Å; D52-L54 VanDerWaalsContact OD1-CB 3.29Å; D52-L54 WeakPolarHBondContact OD1-CB 3.29Å; D52-L54 PolarHBondContact OD1-N 3.36Å
55	I	95.1	Very high	93.8	Very high	110 Å²	110	100.5 Å²	100.5	56%	0.564	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.2	-47.5	175.5	-56.5	-62.7	0	0	0	110.9	V49 D52	V49-I55 HydrophobicContact CG2-CB 4.36Å; V49-I55 HydrophobicContact CG2-CG2 3.62Å; D52-I55 HydrophobicContact CB-CB 4.19Å; D52-I55 HydrophobicContact CB-CG1 4.14Å; D52-I55 PolarHBondContact O-N 3.22Å; D52-I55 PolarHBondContact OD1-N 2.86Å; D52-I55 WeakPolarHBondContact OD2-CG1 3.47Å
56	I	94.5	Very high	93.2	Very high	78 Å²	78	102.2 Å²	102.2	40%	0.4	54%	0.542	S	S	.	.	S	Bend	trans	-107.8	105.9	172.3	-56.3	-163.7	0	0	0	108.4	V49 R50 D52 P53 V58	V49-I56 WeakPolarHBondContact O-CG1 3.32Å; R50-I56 HydrophobicContact CB-CD1 4.32Å; R50-I56 HydrophobicContact CG-CD1 4.09Å; D52-I56 PolarHBondContact O-N 3.18Å; P53-I56 CarbonylContact C-O 3.48Å; P53-I56 WeakPolarHBondContact CA-O 3.15Å; I56-V58 PolarHBondContact O-N 3.28Å
57	P	92.3	Very high	92.6	Very high	111 Å²	111	104.4 Å²	104.4	72%	0.721	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-59.4	128.7	-178.5	-24.4	33.9	0	0	0	112
58	V	92.6	Very high	91.6	Very high	55 Å²	55	109.4 Å²	109.4	33%	0.333	56%	0.562	S	S	.	*	P	Polyproline II helix	trans	-79	155.8	172.9	-64.3	0	0	0	0	111.3	P53 I56 E62 N63	P53-V58 HydrophobicContact CB-CG1 3.84Å; P53-V58 HydrophobicContact CB-CG2 4.28Å; P53-V58 HydrophobicContact CG-CG1 4.26Å; I56-V58 PolarHBondContact O-N 3.28Å; V58-E62 HydrophobicContact CB-CB 4.34Å; V58-E62 HydrophobicContact CG2-CB 4.43Å; V58-N63 HydrophobicContact CG2-CB 4.21Å
59	P	92.3	Very high	90.3	Very high	70 Å²	70	113.3 Å²	113.3	46%	0.455	58%	0.578	S	S	.	*	P	Polyproline II helix	trans	-54.5	147.6	173	-25.7	35.4	0	0	0	112.4	S61 E62 N63	P59-S61 PolarHBondContact O-N 3.03Å; P59-E62 PolarHBondContact O-N 3.13Å; P59-N63 PolarHBondContact O-N 2.91Å; P59-N63 VanDerWaalsContact O-N 3.13Å
60	A	88.8	Confident	88.9	Confident	48 Å²	48	119.3 Å²	119.3	40%	0.397	60%	0.6	S	S	.	*	T	Hydrogen-bonded Turn	trans	-57.2	-26.3	-179.3	0	0	0	0	0	113.6	R66	A60-R66 HydrophobicContact CB-CG 4.03Å; A60-R66 VanDerWaalsContact O-CB 3.24Å; A60-R66 WeakPolarHBondContact O-CB 3.21Å; A60-R66 WeakPolarHBondContact O-CD 3.26Å; A60-R66 VanDerWaalsContact O-CG 3.26Å; A60-R66 WeakPolarHBondContact O-CG 3.09Å
61	S	89.4	Confident	87.1	Confident	93 Å²	93	118 Å²	118	65%	0.65	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.5	-30.4	174.5	44.3	0	0	0	0	114	P59	P59-S61 PolarHBondContact O-N 3.03Å
62	E	90	Very high	85.2	Confident	130 Å²	130	116 Å²	116	61%	0.607	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	-20.6	-179.5	-68.3	171.2	-134.8	0	0	111.6	V58 P59 P64	V58-E62 HydrophobicContact CB-CB 4.34Å; V58-E62 HydrophobicContact CG2-CB 4.43Å; P59-E62 PolarHBondContact O-N 3.13Å; E62-P64 WeakPolarHBondContact O-CD 3.29Å
63	N	92.9	Very high	83.5	Confident	62 Å²	62	118.1 Å²	118.1	33%	0.332	62%	0.616	S	S	.	*			trans	-71.1	112.5	174.9	-176.1	-4.7	0	0	0	111.2	V58 P59 F65 R66	V58-N63 HydrophobicContact CG2-CB 4.21Å; P59-N63 PolarHBondContact O-N 2.91Å; P59-N63 VanDerWaalsContact O-N 3.13Å; N63-F65 PolarHBondContact O-N 2.88Å; N63-F65 WeakPolarHBondContact OD1-CA 3.39Å; N63-F65 WeakPolarHBondContact OD1-CB 3.47Å; N63-F65 PolarHBondContact OD1-N 3.19Å; N63-R66 HydrophobicContact CB-CB 4.46Å; N63-R66 VanDerWaalsContact O-CB 3.29Å; N63-R66 WeakPolarHBondContact O-CB 3.24Å; N63-R66 PolarHBondContact O-N 3.1Å; N63-R66 VanDerWaalsContact O-N 3.1Å
64	P	90.8	Very high	81.9	Confident	114 Å²	114	122 Å²	122	74%	0.74	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	-18.4	179.1	28.8	-34.9	0	0	0	113.1	E62 R66	E62-P64 WeakPolarHBondContact O-CD 3.29Å; P64-R66 VanDerWaalsContact C-N 3.35Å
65	F	90.4	Very high	80.1	Confident	185 Å²	185	125 Å²	125	81%	0.811	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	9.4	177	-54.9	-76.5	0	0	0	113.2	N63	N63-F65 PolarHBondContact O-N 2.88Å; N63-F65 WeakPolarHBondContact OD1-CA 3.39Å; N63-F65 WeakPolarHBondContact OD1-CB 3.47Å; N63-F65 PolarHBondContact OD1-N 3.19Å
66	R	86.6	Confident	79.4	Confident	115 Å²	115	125.8 Å²	125.8	43%	0.434	65%	0.652	S	S	.	*	S	Bend	trans	-62.3	141.2	175.3	-167.3	-146.4	-167.9	141.7	-3.8	110.9	A60 N63 P64 K68	A60-R66 HydrophobicContact CB-CG 4.03Å; A60-R66 VanDerWaalsContact O-CB 3.24Å; A60-R66 WeakPolarHBondContact O-CB 3.21Å; A60-R66 WeakPolarHBondContact O-CD 3.26Å; A60-R66 VanDerWaalsContact O-CG 3.26Å; A60-R66 WeakPolarHBondContact O-CG 3.09Å; N63-R66 HydrophobicContact CB-CB 4.46Å; N63-R66 VanDerWaalsContact O-CB 3.29Å; N63-R66 WeakPolarHBondContact O-CB 3.24Å; N63-R66 PolarHBondContact O-N 3.1Å; N63-R66 VanDerWaalsContact O-N 3.1Å; P64-R66 VanDerWaalsContact C-N 3.35Å; R66-K68 PolarHBondContact O-N 3.24Å
67	E	83.3	Confident	78.6	Confident	172 Å²	172	128.3 Å²	128.3	80%	0.804	67%	0.665	S	S	*	*			trans	-54.4	125.7	166.4	-66.7	-176.1	179.1	0	0	111.1	K69	E67-K69 PolarHBondContact O-N 3.27Å
68	K	77.9	Confident	77.8	Confident	171 Å²	171	129.2 Å²	129.2	74%	0.743	66%	0.662	S	S	*	*			trans	-72.9	114.2	170.9	-64.5	-177.4	-177.3	177.8	0	107.5	R66 F70	R66-K68 PolarHBondContact O-N 3.24Å; K68-F70 VanDerWaalsContact C-N 3.29Å; K68-F70 HydrophobicContact CB-CD2 4.42Å; K68-F70 HydrophobicContact CB-CE2 4.08Å; K68-F70 HydrophobicContact CB-CZ 4.41Å; K68-F70 WeakPolarHBondContact O-CD2 3.46Å; K68-F70 PolarHBondContact O-N 3.21Å
69	K	69.3	Low	76.9	Confident	158 Å²	158	133.6 Å²	133.6	69%	0.687	68%	0.681	S	S	*	*			trans	-67	93.9	166.8	-68.3	-169.4	176.9	-172.4	0	107.8	E67 F71	E67-K69 PolarHBondContact O-N 3.27Å; K69-F71 PolarHBondContact O-N 2.89Å
70	F	66.1	Low	76	Confident	179 Å²	179	137.6 Å²	137.6	79%	0.785	70%	0.695	S	S	*	*			trans	-68.4	111	163.4	-68.6	-80.6	0	0	0	106.8	K68 C72	K68-F70 VanDerWaalsContact C-N 3.29Å; K68-F70 HydrophobicContact CB-CD2 4.42Å; K68-F70 HydrophobicContact CB-CE2 4.08Å; K68-F70 HydrophobicContact CB-CZ 4.41Å; K68-F70 WeakPolarHBondContact O-CD2 3.46Å; K68-F70 PolarHBondContact O-N 3.21Å; F70-C72 VanDerWaalsContact C-N 3.27Å; F70-C72 PolarHBondContact O-N 2.95Å
71	F	57.9	Low	75.1	Confident	185 Å²	185	143.5 Å²	143.5	81%	0.811	72%	0.715	S	S	*	*			trans	-69.8	93.2	166.1	-65.2	-82	0	0	0	107	K69 T73	K69-F71 PolarHBondContact O-N 2.89Å; F71-T73 PolarHBondContact O-N 3.17Å; F71-T73 VanDerWaalsContact O-N 3.17Å
72	C	53.5	Low	74.1	Confident	105 Å²	105	147.1 Å²	147.1	71%	0.709	72%	0.72	S	S	*	*			trans	-74	97.5	164.6	-174.6	0	0	0	0	107.1	F70	F70-C72 VanDerWaalsContact C-N 3.27Å; F70-C72 PolarHBondContact O-N 2.95Å
73	T	61.1	Low	72.9	Confident	107 Å²	107	148.5 Å²	148.5	66%	0.656	73%	0.729	S	S	*	*			trans	-82	107.2	158.2	-57.4	0	0	0	0	106.3	F71 L75	F71-T73 PolarHBondContact O-N 3.17Å; F71-T73 VanDerWaalsContact O-N 3.17Å; T73-L75 HydrophobicContact CG2-CD2 4.12Å; T73-L75 HydrophobicContact CG2-CG 4.27Å; T73-L75 PolarHBondContact O-N 3.25Å
74	I	61.1	Low	71.2	Confident	155 Å²	155	155.7 Å²	155.7	80%	0.795	76%	0.762	S	S	*	*			trans	-72.2	109.4	161.1	-58.3	-173.5	0	0	0	105.4
75	L	56.3	Low	69.4	Low	222 Å²	222	159.5 Å²	159.5	100%	1.162	76%	0.764	S	S	*	*			trans	-77.7	0	169.1	-73.1	171.2	0	0	0	110.2	T73	T73-L75 HydrophobicContact CG2-CD2 4.12Å; T73-L75 HydrophobicContact CG2-CG 4.27Å; T73-L75 PolarHBondContact O-N 3.25Å

Retrieved 75 of 75 residues in 32.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).