A0A0D9R2S0_CHLSB Loading...

C-type natriuretic peptide

Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. Acts by specifically binding and stimulating NPR2 to produce cGMP. Binds the clearance receptor NPR3.

AlphaFold DB , UniProt , Accession A0A0D9R2S0, Species CHLSB (Chlorocebus sabaeus, Green monkey), Gene NPPC, Length 126 aa.

						>A0A0D9R2S0_CHLSB|A0A0D9R2S0|NPPC
MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.9	Low	90.3	Very high	209 Å²	209	110.1 Å²	110.1	100%	1.03	61%	0.609	S	S	*	*				0	-12.4	0	-63.6	-161.9	133.2	0	0	114.3	S4	M1-S4 PolarHBondContact O-OG 2.95Å
2	H	82.3	Confident	90.6	Very high	144 Å²	144	110.3 Å²	110.3	67%	0.667	61%	0.607	S	S	*	*	H	α-helix	trans	-81.1	-31.2	178.2	-64.8	-71.1	0	0	0	114.1	S4 Q5 L6	H2-S4 PolarHBondContact O-N 2.88Å; H2-Q5 WeakPolarHBondContact O-CB 3.5Å; H2-Q5 PolarHBondContact O-N 3.01Å; H2-Q5 VanDerWaalsContact O-N 3.15Å; H2-L6 WeakPolarHBondContact O-CG 3.24Å; H2-L6 PolarHBondContact O-N 3.44Å
3	L	90.8	Very high	90.8	Very high	141 Å²	141	110.6 Å²	110.6	74%	0.738	61%	0.607	S	S	*	*	H	α-helix	trans	-59.6	-43.3	178.5	-76.4	153.9	0	0	0	112.9	Q5 L6 L7	L3-Q5 VanDerWaalsContact C-N 3.3Å; L3-Q5 PolarHBondContact O-N 2.84Å; L3-L6 PolarHBondContact O-N 2.76Å; L3-L7 WeakPolarHBondContact O-CB 2.83Å; L3-L7 PolarHBondContact O-N 3.32Å
4	S	92.3	Very high	90.9	Very high	79 Å²	79	108.2 Å²	108.2	55%	0.552	60%	0.597	S	S	*	*	H	α-helix	trans	-64.7	-35.9	176.5	53.1	0	0	0	0	112.2	M1 H2 A8	M1-S4 PolarHBondContact O-OG 2.95Å; H2-S4 PolarHBondContact O-N 2.88Å; S4-A8 WeakPolarHBondContact O-CB 3.04Å; S4-A8 PolarHBondContact O-N 2.99Å
5	Q	91	Very high	90.9	Very high	121 Å²	121	107.9 Å²	107.9	57%	0.565	59%	0.594	S	S	*	*	H	α-helix	trans	-71.6	-40.5	179.1	-164.5	167.9	11.7	0	0	111.4	H2 L3 A8 C9	H2-Q5 WeakPolarHBondContact O-CB 3.5Å; H2-Q5 PolarHBondContact O-N 3.01Å; H2-Q5 VanDerWaalsContact O-N 3.15Å; L3-Q5 VanDerWaalsContact C-N 3.3Å; L3-Q5 PolarHBondContact O-N 2.84Å; Q5-A8 PolarHBondContact O-N 3.12Å; Q5-C9 WeakPolarHBondContact O-CB 3.31Å; Q5-C9 PolarHBondContact O-N 2.74Å; Q5-C9 PolarHBondContact O-SG 2.87Å
6	L	94.8	Very high	90.6	Very high	117 Å²	117	108.9 Å²	108.9	61%	0.613	60%	0.597	S	S	*	*	H	α-helix	trans	-63	-43.3	173.9	-68.5	172	0	0	0	111.7	H2 L3 C9 A10	H2-L6 WeakPolarHBondContact O-CG 3.24Å; H2-L6 PolarHBondContact O-N 3.44Å; L3-L6 PolarHBondContact O-N 2.76Å; L6-C9 PolarHBondContact O-N 3.09Å; L6-A10 WeakPolarHBondContact O-CB 3.48Å; L6-A10 PolarHBondContact O-N 3.06Å
7	L	95.1	Very high	90.1	Very high	116 Å²	116	108.3 Å²	108.3	61%	0.607	60%	0.603	S	S	*	*	H	α-helix	trans	-60.6	-46.1	174.7	-99.3	157.5	0	0	0	112	L3 C9 A10 L11	L3-L7 WeakPolarHBondContact O-CB 2.83Å; L3-L7 PolarHBondContact O-N 3.32Å; L7-C9 PolarHBondContact O-N 3.11Å; L7-A10 PolarHBondContact O-N 3.09Å; L7-L11 WeakPolarHBondContact O-CB 3.26Å; L7-L11 PolarHBondContact O-N 3.04Å
8	A	94	Very high	89.6	Confident	60 Å²	60	109.3 Å²	109.3	50%	0.496	61%	0.606	S	S	.	*	H	α-helix	trans	-62.1	-42.1	177.2	0	0	0	0	0	112.1	S4 Q5 L12	S4-A8 WeakPolarHBondContact O-CB 3.04Å; S4-A8 PolarHBondContact O-N 2.99Å; Q5-A8 PolarHBondContact O-N 3.12Å; A8-L12 WeakPolarHBondContact O-CB 3.33Å; A8-L12 PolarHBondContact O-N 3.36Å
9	C	93.3	Very high	88.8	Confident	68 Å²	68	114.1 Å²	114.1	46%	0.459	61%	0.614	S	S	.	*	H	α-helix	trans	-64.1	-44.7	176.3	-73.9	0	0	0	0	112.3	Q5 L6 L7 L12 L13	Q5-C9 WeakPolarHBondContact O-CB 3.31Å; Q5-C9 PolarHBondContact O-N 2.74Å; Q5-C9 PolarHBondContact O-SG 2.87Å; L6-C9 PolarHBondContact O-N 3.09Å; L7-C9 PolarHBondContact O-N 3.11Å; C9-L12 PolarHBondContact O-N 2.98Å; C9-L13 WeakPolarHBondContact O-CG 3.26Å; C9-L13 PolarHBondContact O-N 2.94Å
10	A	94.8	Very high	87.3	Confident	52 Å²	52	113.5 Å²	113.5	43%	0.43	62%	0.616	S	S	.	*	H	α-helix	trans	-63.3	-43.1	178.4	0	0	0	0	0	111.9	L6 L7 L13 T14	L6-A10 WeakPolarHBondContact O-CB 3.48Å; L6-A10 PolarHBondContact O-N 3.06Å; L7-A10 PolarHBondContact O-N 3.09Å; A10-L13 PolarHBondContact O-N 3.31Å; A10-T14 WeakPolarHBondContact O-CB 3.34Å; A10-T14 PolarHBondContact O-N 3.24Å; A10-T14 PolarHBondContact O-OG1 3Å
11	L	95.3	Very high	85.6	Confident	104 Å²	104	113.1 Å²	113.1	55%	0.545	62%	0.622	S	S	.	*	H	α-helix	trans	-59.9	-45.2	174.1	-108.8	151.9	0	0	0	112	L7 T14 L15	L7-L11 WeakPolarHBondContact O-CB 3.26Å; L7-L11 PolarHBondContact O-N 3.04Å; L11-T14 PolarHBondContact O-N 3.11Å; L11-L15 WeakPolarHBondContact O-CG 3.25Å; L11-L15 PolarHBondContact O-N 3.08Å
12	L	93.9	Very high	84.7	Confident	112 Å²	112	111.9 Å²	111.9	59%	0.586	61%	0.614	S	S	*	*	H	α-helix	trans	-63.3	-43.8	-179.7	-172.9	64	0	0	0	112.1	A8 C9 T14 L15 L16	A8-L12 WeakPolarHBondContact O-CB 3.33Å; A8-L12 PolarHBondContact O-N 3.36Å; C9-L12 PolarHBondContact O-N 2.98Å; L12-T14 VanDerWaalsContact C-N 3.32Å; L12-T14 PolarHBondContact O-N 2.82Å; L12-L15 PolarHBondContact O-N 3.16Å; L12-L16 PolarHBondContact O-N 3.33Å
13	L	92.4	Very high	83.1	Confident	115 Å²	115	108.6 Å²	108.6	60%	0.602	61%	0.612	S	S	*	*	H	α-helix	trans	-64.2	-37.9	176.1	-70.9	171.6	0	0	0	112.2	C9 A10 L16 S17	C9-L13 WeakPolarHBondContact O-CG 3.26Å; C9-L13 PolarHBondContact O-N 2.94Å; A10-L13 PolarHBondContact O-N 3.31Å; L13-L16 PolarHBondContact O-N 3.38Å; L13-S17 WeakPolarHBondContact O-CB 3.41Å; L13-S17 PolarHBondContact O-N 3.07Å; L13-S17 PolarHBondContact O-OG 2.99Å
14	T	92.6	Very high	80.7	Confident	77 Å²	77	111.1 Å²	111.1	47%	0.472	62%	0.617	S	S	.	*	H	α-helix	trans	-65	-45.8	176.5	-54.7	0	0	0	0	110.5	A10 L11 L12 L16 S17 L18	A10-T14 WeakPolarHBondContact O-CB 3.34Å; A10-T14 PolarHBondContact O-N 3.24Å; A10-T14 PolarHBondContact O-OG1 3Å; L11-T14 PolarHBondContact O-N 3.11Å; L12-T14 VanDerWaalsContact C-N 3.32Å; L12-T14 PolarHBondContact O-N 2.82Å; T14-L16 VanDerWaalsContact C-N 3.34Å; T14-L16 PolarHBondContact O-N 2.85Å; T14-S17 PolarHBondContact O-N 3.12Å; T14-L18 HydrophobicContact CG2-CD1 4.02Å; T14-L18 WeakPolarHBondContact O-CB 3.35Å; T14-L18 WeakPolarHBondContact O-CD1 3.42Å; T14-L18 PolarHBondContact O-N 3.25Å
15	L	90.4	Very high	78.7	Confident	104 Å²	104	113.8 Å²	113.8	55%	0.545	63%	0.632	S	S	.	*	H	α-helix	trans	-63.5	-37	176	-71.4	171.1	0	0	0	112.8	L11 L12 S17 R19	L11-L15 WeakPolarHBondContact O-CG 3.25Å; L11-L15 PolarHBondContact O-N 3.08Å; L12-L15 PolarHBondContact O-N 3.16Å; L15-S17 VanDerWaalsContact C-N 3.3Å; L15-R19 WeakPolarHBondContact O-CG 3.29Å; L15-R19 PolarHBondContact O-N 2.99Å
16	L	87	Confident	76.6	Confident	123 Å²	123	111.2 Å²	111.2	64%	0.644	64%	0.638	S	S	*	*	H	α-helix	trans	-67.5	-32.2	175.5	-128.6	75.1	0	0	0	112.5	L12 L13 T14	L12-L16 PolarHBondContact O-N 3.33Å; L13-L16 PolarHBondContact O-N 3.38Å; T14-L16 VanDerWaalsContact C-N 3.34Å; T14-L16 PolarHBondContact O-N 2.85Å
17	S	81.1	Confident	74	Confident	99 Å²	99	110 Å²	110	69%	0.692	65%	0.645	S	S	*	*	H	α-helix	trans	-81.9	-31.2	179.1	-53.4	0	0	0	0	112.2	L13 T14 L15	L13-S17 WeakPolarHBondContact O-CB 3.41Å; L13-S17 PolarHBondContact O-N 3.07Å; L13-S17 PolarHBondContact O-OG 2.99Å; T14-S17 PolarHBondContact O-N 3.12Å; L15-S17 VanDerWaalsContact C-N 3.3Å
18	L	82.4	Confident	71.9	Confident	126 Å²	126	109.5 Å²	109.5	66%	0.66	65%	0.649	S	S	*	*	H	α-helix	trans	-79.5	-16.9	174.6	-97.6	69	0	0	0	113	T14 P20	T14-L18 HydrophobicContact CG2-CD1 4.02Å; T14-L18 WeakPolarHBondContact O-CB 3.35Å; T14-L18 WeakPolarHBondContact O-CD1 3.42Å; T14-L18 PolarHBondContact O-N 3.25Å; L18-P20 WeakPolarHBondContact O-CD 3.47Å; L18-P20 VanDerWaalsContact O-N 3.07Å
19	R	74.8	Confident	69.5	Low	200 Å²	200	112.8 Å²	112.8	76%	0.755	67%	0.665	S	S	*	*	S	Bend	trans	-63.5	106.1	166.6	-83.8	-78.7	-174.6	151.2	0.4	106.7	L15 S21	L15-R19 WeakPolarHBondContact O-CG 3.29Å; L15-R19 PolarHBondContact O-N 2.99Å; R19-S21 PolarHBondContact O-N 3.39Å
20	P	57.5	Low	66.8	Low	103 Å²	103	119.1 Å²	119.1	67%	0.669	69%	0.685	S	S	*	*			trans	-61.3	114.4	174.5	-11.7	28.9	0	0	0	105	L18 E22	L18-P20 WeakPolarHBondContact O-CD 3.47Å; L18-P20 VanDerWaalsContact O-N 3.07Å; P20-E22 PolarHBondContact O-N 2.92Å
21	S	51.8	Low	64.3	Low	106 Å²	106	122.8 Å²	122.8	74%	0.741	70%	0.702	S	S	*	*			trans	-60.5	98.6	161.5	-176.1	0	0	0	0	104.5	R19 A23	R19-S21 PolarHBondContact O-N 3.39Å; S21-A23 PolarHBondContact O-N 3.46Å
22	E	51.2	Low	62.3	Low	182 Å²	182	122.6 Å²	122.6	85%	0.85	71%	0.707	S	S	*	*			trans	-64.7	57.7	170.5	-78.4	-84.9	104.5	0	0	109	P20 K24	P20-E22 PolarHBondContact O-N 2.92Å; E22-K24 PolarHBondContact O-N 3.39Å
23	A	49.3	Very low	59.4	Low	76 Å²	76	128.8 Å²	128.8	63%	0.628	72%	0.722	S	S	*	*			trans	-83.5	91.3	160.3	0	0	0	0	0	106.1	S21	S21-A23 PolarHBondContact O-N 3.46Å
24	K	40.6	Very low	56.6	Low	194 Å²	194	129.8 Å²	129.8	84%	0.843	73%	0.733	S	S	*	*			trans	-22.9	112	164.7	-164.9	94	175.9	179.2	0	112.4	E22 G26	E22-K24 PolarHBondContact O-N 3.39Å; K24-G26 PolarHBondContact O-N 2.82Å
25	P	50.6	Low	55	Low	134 Å²	134	131.5 Å²	131.5	87%	0.87	75%	0.746	S	S	*	*			trans	-79.7	99.4	169.1	4.7	11	0	0	0	108.1
26	G	45.8	Very low	52.5	Low	67 Å²	67	132.9 Å²	132.9	69%	0.691	76%	0.761	S	S	*	*			trans	-125.3	98	-177.9	0	0	0	0	0	112.6	K24	K24-G26 PolarHBondContact O-N 2.82Å
27	A	40.6	Very low	49.6	Very low	92 Å²	92	130.2 Å²	130.2	76%	0.76	76%	0.763	S	S	*	*			trans	89	131.3	155.5	0	0	0	0	0	119.7
28	P	51.4	Low	47.3	Very low	106 Å²	106	134.3 Å²	134.3	69%	0.688	77%	0.771	S	S	*	*			trans	-82.8	139.7	176.3	33.7	-32.8	0	0	0	111.5	K30	P28-K30 PolarHBondContact O-N 3.33Å; P28-K30 VanDerWaalsContact O-N 3.15Å
29	P	42.2	Very low	45	Very low	129 Å²	129	135.9 Å²	135.9	84%	0.838	78%	0.775	S	S	*	*			trans	-77.7	103.9	168.4	28.8	-29.6	0	0	0	110	V31	P29-V31 PolarHBondContact O-N 3.39Å
30	K	37.2	Very low	43.1	Very low	200 Å²	200	133.6 Å²	133.6	87%	0.87	78%	0.777	S	S	*	*			trans	-66.7	120.6	160.3	-73.8	178.5	177.6	178	0	109.1	P28	P28-K30 PolarHBondContact O-N 3.33Å; P28-K30 VanDerWaalsContact O-N 3.15Å
31	V	42.3	Very low	41.9	Very low	130 Å²	130	133.4 Å²	133.4	79%	0.788	78%	0.784	S	S	*	*			trans	-66.7	167.6	154.6	179.3	0	0	0	0	108.1	P29	P29-V31 PolarHBondContact O-N 3.39Å
32	P	53.1	Low	40.9	Very low	100 Å²	100	135 Å²	135	65%	0.649	78%	0.78	S	S	*	*			cis	-127	164.3	-25.1	27	-8.1	0	0	0	114.1
33	R	34.1	Very low	40.2	Very low	241 Å²	241	132.1 Å²	132.1	91%	0.909	78%	0.777	S	S	*	*			trans	164.8	139.9	132.8	-90.2	177.1	-167.6	118.9	-1.9	112.5
34	T	33.1	Very low	39.6	Very low	136 Å²	136	136.3 Å²	136.3	83%	0.834	78%	0.784	S	S	*	*			trans	-80.1	-166.8	-177.4	47.8	0	0	0	0	113.2
35	P	58.7	Low	39.4	Very low	114 Å²	114	131.9 Å²	131.9	74%	0.74	78%	0.783	S	S	*	*				-110.8	172.8	-103.5	33.9	-12.1	0	0	0	113.7
36	P	38.1	Very low	38.8	Very low	133 Å²	133	130.9 Å²	130.9	86%	0.864	79%	0.787	S	S	*	*				-150.7	147.4	105.9	35	-16.1	0	0	0	112.3
37	G	26.8	Very low	38.1	Very low	66 Å²	66	131.5 Å²	131.5	68%	0.68	79%	0.793	S	S	*	*				119	131.3	68.8	0	0	0	0	0	108.9
38	E	32.3	Very low	37.8	Very low	186 Å²	186	131.2 Å²	131.2	87%	0.869	80%	0.799	S	S	*	*			trans	72.4	139.1	167.3	-81.2	164.9	92.7	0	0	118.6
39	E	33.3	Very low	36.9	Very low	159 Å²	159	129.8 Å²	129.8	74%	0.743	80%	0.803	S	S	*	*			cis	-165.4	139.3	1.6	-161	-165.7	72.1	0	0	108.3
40	L	35.8	Very low	36.9	Very low	151 Å²	151	133.2 Å²	133.2	79%	0.791	81%	0.808	S	S	*	*			trans	27.9	114.1	144.3	-159.2	73.8	0	0	0	121.5
41	A	31.2	Very low	37.2	Very low	99 Å²	99	133.6 Å²	133.6	82%	0.818	81%	0.81	S	S	*	*			trans	-164.3	110.6	132.3	0	0	0	0	0	110.8
42	E	31.1	Very low	37.5	Very low	139 Å²	139	136.8 Å²	136.8	65%	0.65	81%	0.813	S	S	*	*			trans	-63	155.1	167.1	-140.3	-165.7	77	0	0	110.9	Q44	E42-Q44 HydrophobicContact CG-CG 4.23Å; E42-Q44 WeakPolarHBondContact OE1-CG 3.34Å; E42-Q44 PolarHBondContact OE1-N 3.3Å; E42-Q44 VanDerWaalsContact OE1-N 3.08Å
43	P	36	Very low	36.8	Very low	123 Å²	123	135.3 Å²	135.3	80%	0.799	82%	0.816	S	S	*	*				-138.3	130.6	94	25.9	-7.9	0	0	0	113.7
44	Q	37.8	Very low	37.1	Very low	163 Å²	163	131 Å²	131	76%	0.762	81%	0.811	S	S	*	*			trans	-63.4	133.6	160.1	-77.7	-179.1	-2.6	0	0	110.6	E42	E42-Q44 HydrophobicContact CG-CG 4.23Å; E42-Q44 WeakPolarHBondContact OE1-CG 3.34Å; E42-Q44 PolarHBondContact OE1-N 3.3Å; E42-Q44 VanDerWaalsContact OE1-N 3.08Å
45	A	35.2	Very low	37.7	Very low	101 Å²	101	134.6 Å²	134.6	84%	0.835	82%	0.815	S	S	*	*			trans	-134.6	124.9	152.5	0	0	0	0	0	108.5
46	A	38.7	Very low	36.7	Very low	114 Å²	114	133.7 Å²	133.7	94%	0.942	82%	0.818	S	S	*	*			trans	-62.2	147.7	-169.7	0	0	0	0	0	114.6
47	G	32.2	Very low	37.5	Very low	79 Å²	79	133.8 Å²	133.8	81%	0.814	82%	0.818	S	S	*	*			trans	-178	82.1	169.1	0	0	0	0	0	111.2
48	G	32.6	Very low	38.1	Very low	86 Å²	86	134.3 Å²	134.3	89%	0.887	82%	0.824	S	S	*	*			trans	-65.9	169.5	-170.7	0	0	0	0	0	116.3
49	G	34.1	Very low	39	Very low	76 Å²	76	129.8 Å²	129.8	78%	0.784	83%	0.826	S	S	*	*			trans	147.9	65.3	167.5	0	0	0	0	0	113.8	K51	G49-K51 PolarHBondContact O-N 3.01Å
50	Q	41.1	Very low	39.7	Very low	201 Å²	201	124.9 Å²	124.9	94%	0.939	82%	0.819	S	S	*	*			trans	-59.1	119.3	161	-70.4	175.2	16.3	0	0	108.4
51	K	43.5	Very low	40.4	Very low	208 Å²	208	120.5 Å²	120.5	90%	0.904	81%	0.81	S	S	*	*			trans	-121.5	93.2	157.4	-126	-173.1	-177.6	-175	0	109.4	G49	G49-K51 PolarHBondContact O-N 3.01Å
52	K	48.1	Very low	41.6	Very low	197 Å²	197	120.2 Å²	120.2	86%	0.857	81%	0.808	S	S	*	*			trans	-38.2	131	153.6	-178.5	179.3	179.1	-172.6	0	110.4
53	G	39.9	Very low	42.8	Very low	70 Å²	70	119.1 Å²	119.1	72%	0.722	81%	0.806	S	S	*	*			trans	-170.9	107	175.3	0	0	0	0	0	110.6
54	D	40.4	Very low	43.9	Very low	149 Å²	149	119.3 Å²	119.3	80%	0.797	80%	0.8	S	S	*	*			trans	-47.6	158.4	-169.6	-67.8	-89.9	0	0	0	119.4
55	K	44.9	Very low	45.3	Very low	212 Å²	212	119.8 Å²	119.8	92%	0.922	80%	0.8	S	S	*	*			trans	-45.1	143.7	176.1	-85.1	177.2	165.7	179.5	0	114.5
56	A	38.3	Very low	47.2	Very low	96 Å²	96	116.3 Å²	116.3	79%	0.793	77%	0.773	S	S	*	*			trans	-138.3	142.9	140.1	0	0	0	0	0	110.1
57	P	54.7	Low	49.1	Very low	135 Å²	135	114.8 Å²	114.8	88%	0.877	75%	0.749	S	S	*	*			trans	-89.4	155.4	-172	37	-32.4	0	0	0	111
58	G	40	Very low	51.4	Low	77 Å²	77	120.3 Å²	120.3	79%	0.794	75%	0.745	S	S	*	*			trans	132.6	123.6	163.2	0	0	0	0	0	113.4
59	G	49.4	Very low	53.8	Low	90 Å²	90	119.3 Å²	119.3	93%	0.928	73%	0.725	S	S	*	*	S	Bend	trans	-61.9	157.9	-174.3	0	0	0	0	0	114.9
60	G	48.8	Very low	56.1	Low	57 Å²	57	124.1 Å²	124.1	59%	0.588	72%	0.719	S	S	*	*			trans	135.4	3	173.4	0	0	0	0	0	115.8	A62	G60-A62 PolarHBondContact O-N 2.88Å
61	G	51.3	Low	58.2	Low	59 Å²	59	119.7 Å²	119.7	61%	0.608	70%	0.702	S	S	*	*	H	α-helix	trans	-76.9	-6	-165.5	0	0	0	0	0	118.2
62	A	55.6	Low	60.2	Low	92 Å²	92	113.7 Å²	113.7	76%	0.76	68%	0.679	S	S	*	*	H	α-helix	trans	-78.6	-36	-176.8	0	0	0	0	0	113	G60	G60-A62 PolarHBondContact O-N 2.88Å
63	N	55.6	Low	61.9	Low	117 Å²	117	112.7 Å²	112.7	63%	0.626	67%	0.67	S	S	*	*	H	α-helix	trans	-79.8	-39.7	-177.9	-99.2	-73.1	0	0	0	112.9	K65 G66 D67	N63-K65 VanDerWaalsContact C-N 3.32Å; N63-K65 PolarHBondContact O-N 2.89Å; N63-G66 CarbonylContact O-C 3.59Å; N63-G66 WeakPolarHBondContact O-CA 3.46Å; N63-G66 PolarHBondContact O-N 3.33Å; N63-G66 VanDerWaalsContact O-N 3.09Å; N63-D67 WeakPolarHBondContact O-CB 3.29Å; N63-D67 PolarHBondContact O-N 3.03Å
64	L	60.6	Low	63.9	Low	127 Å²	127	114.6 Å²	114.6	67%	0.665	66%	0.663	S	S	*	*	H	α-helix	trans	-61.7	-36	-174.8	-68.2	168.6	0	0	0	113.7	R68	L64-R68 WeakPolarHBondContact O-CB 3.29Å; L64-R68 PolarHBondContact O-N 2.82Å
65	K	66.4	Low	66	Low	173 Å²	173	112.6 Å²	112.6	75%	0.752	65%	0.652	S	S	*	*	H	α-helix	trans	-75.2	-34.6	177.8	-167.1	144.1	178.5	178.5	0	111.8	N63 S69	N63-K65 VanDerWaalsContact C-N 3.32Å; N63-K65 PolarHBondContact O-N 2.89Å; K65-S69 WeakPolarHBondContact O-CB 3.26Å; K65-S69 PolarHBondContact O-N 3.13Å; K65-S69 VanDerWaalsContact O-N 3.1Å; K65-S69 PolarHBondContact O-OG 2.94Å
66	G	75.2	Confident	67.7	Low	27 Å²	27	109.9 Å²	109.9	28%	0.278	64%	0.636	S	S	.	*	H	α-helix	trans	-64.9	-51.7	171.7	0	0	0	0	0	111.8	N63 R68 S69 R70	N63-G66 CarbonylContact O-C 3.59Å; N63-G66 WeakPolarHBondContact O-CA 3.46Å; N63-G66 PolarHBondContact O-N 3.33Å; N63-G66 VanDerWaalsContact O-N 3.09Å; G66-R68 PolarHBondContact O-N 3.13Å; G66-S69 PolarHBondContact O-N 3.35Å; G66-S69 VanDerWaalsContact O-N 3.1Å; G66-S69 PolarHBondContact O-OG 3.48Å; G66-R70 WeakPolarHBondContact O-CG 3.23Å; G66-R70 PolarHBondContact O-N 3.35Å
67	D	78.2	Confident	69.9	Low	82 Å²	82	109.9 Å²	109.9	44%	0.439	63%	0.626	S	S	.	*	H	α-helix	trans	-61.6	-42.4	178.8	-72.5	-33.5	0	0	0	112.1	N63 S69 R70 L71	N63-D67 WeakPolarHBondContact O-CB 3.29Å; N63-D67 PolarHBondContact O-N 3.03Å; D67-S69 VanDerWaalsContact C-N 3.3Å; D67-S69 PolarHBondContact O-N 2.78Å; D67-R70 PolarHBondContact O-N 3.38Å; D67-L71 WeakPolarHBondContact O-CB 3.34Å; D67-L71 PolarHBondContact O-N 3.44Å
68	R	80.9	Confident	71.2	Confident	195 Å²	195	108 Å²	108	74%	0.736	61%	0.609	S	S	*	*	H	α-helix	trans	-64.4	-35.7	175.1	-168.7	173.9	-178.3	179.4	0.8	112.2	L64 G66 L72	L64-R68 WeakPolarHBondContact O-CB 3.29Å; L64-R68 PolarHBondContact O-N 2.82Å; G66-R68 PolarHBondContact O-N 3.13Å; R68-L72 VanDerWaalsContact O-CB 3.24Å; R68-L72 WeakPolarHBondContact O-CB 3.5Å; R68-L72 PolarHBondContact O-N 3.31Å
69	S	81.9	Confident	73.2	Confident	65 Å²	65	108.4 Å²	108.4	46%	0.455	60%	0.596	S	S	.	*	H	α-helix	trans	-70.3	-35.9	175.9	75.7	0	0	0	0	112.4	K65 G66 D67 R73	K65-S69 WeakPolarHBondContact O-CB 3.26Å; K65-S69 PolarHBondContact O-N 3.13Å; K65-S69 VanDerWaalsContact O-N 3.1Å; K65-S69 PolarHBondContact O-OG 2.94Å; G66-S69 PolarHBondContact O-N 3.35Å; G66-S69 VanDerWaalsContact O-N 3.1Å; G66-S69 PolarHBondContact O-OG 3.48Å; D67-S69 VanDerWaalsContact C-N 3.3Å; D67-S69 PolarHBondContact O-N 2.78Å; S69-R73 WeakPolarHBondContact O-CG 3.47Å; S69-R73 PolarHBondContact O-N 3.3Å
70	R	83.9	Confident	74.8	Confident	177 Å²	177	111.9 Å²	111.9	67%	0.668	59%	0.585	S	S	*	*	H	α-helix	trans	-67.7	-48.7	174.5	-72.4	179.1	176.1	-161	-1.1	111.4	G66 D67 L72 R73 D74	G66-R70 WeakPolarHBondContact O-CG 3.23Å; G66-R70 PolarHBondContact O-N 3.35Å; D67-R70 PolarHBondContact O-N 3.38Å; R70-L72 VanDerWaalsContact C-N 3.27Å; R70-L72 PolarHBondContact O-N 2.99Å; R70-R73 CarbonylContact O-C 3.6Å; R70-R73 WeakPolarHBondContact O-CA 3.34Å; R70-R73 WeakPolarHBondContact O-CB 3.32Å; R70-R73 PolarHBondContact O-N 3.15Å; R70-D74 PolarHBondContact O-N 2.84Å
71	L	85.4	Confident	76.5	Confident	108 Å²	108	111.3 Å²	111.3	57%	0.565	57%	0.572	S	S	*	*	H	α-helix	trans	-55.2	-45.5	174	-161.1	-167.1	0	0	0	110.7	D67 R73 D74 L75	D67-L71 WeakPolarHBondContact O-CB 3.34Å; D67-L71 PolarHBondContact O-N 3.44Å; L71-R73 VanDerWaalsContact C-N 3.27Å; L71-R73 PolarHBondContact O-N 3.23Å; L71-D74 PolarHBondContact O-N 3Å; L71-L75 HydrophobicContact CD2-CB 4.36Å; L71-L75 WeakPolarHBondContact O-CB 3.44Å; L71-L75 PolarHBondContact O-N 2.94Å
72	L	83.6	Confident	78	Confident	83 Å²	83	117.5 Å²	117.5	44%	0.435	58%	0.578	S	S	.	*	H	α-helix	trans	-69.5	-25.7	-179.4	-165.7	146.2	0	0	0	112.5	R68 R70 R76	R68-L72 VanDerWaalsContact O-CB 3.24Å; R68-L72 WeakPolarHBondContact O-CB 3.5Å; R68-L72 PolarHBondContact O-N 3.31Å; R70-L72 VanDerWaalsContact C-N 3.27Å; R70-L72 PolarHBondContact O-N 2.99Å; L72-R76 VanDerWaalsContact CD2-CZ 3.49Å; L72-R76 WeakPolarHBondContact O-CB 3.31Å; L72-R76 WeakPolarHBondContact O-CG 3.4Å; L72-R76 PolarHBondContact O-N 3.41Å
73	R	84.2	Confident	79.3	Confident	176 Å²	176	115.2 Å²	115.2	66%	0.664	56%	0.559	S	S	*	*	H	α-helix	trans	-73.1	-44.8	169	-64.1	-125.9	-167.5	-158.3	3.9	111	S69 R70 L71 R76 V77	S69-R73 WeakPolarHBondContact O-CG 3.47Å; S69-R73 PolarHBondContact O-N 3.3Å; R70-R73 CarbonylContact O-C 3.6Å; R70-R73 WeakPolarHBondContact O-CA 3.34Å; R70-R73 WeakPolarHBondContact O-CB 3.32Å; R70-R73 PolarHBondContact O-N 3.15Å; L71-R73 VanDerWaalsContact C-N 3.27Å; L71-R73 PolarHBondContact O-N 3.23Å; R73-R76 CarbonylContact O-C 3.54Å; R73-R76 WeakPolarHBondContact O-CA 3.49Å; R73-R76 WeakPolarHBondContact O-CB 3.46Å; R73-R76 PolarHBondContact O-N 3.42Å; R73-R76 VanDerWaalsContact O-N 3.13Å; R73-V77 WeakPolarHBondContact O-CG2 3.41Å; R73-V77 PolarHBondContact O-N 3.46Å
74	D	82.3	Confident	80.7	Confident	109 Å²	109	112.3 Å²	112.3	58%	0.583	55%	0.55	S	S	*	*	H	α-helix	trans	-62.9	-44.4	-180	-73	-8.9	0	0	0	111.2	R70 L71 R76 V77 D78	R70-D74 PolarHBondContact O-N 2.84Å; L71-D74 PolarHBondContact O-N 3Å; D74-R76 VanDerWaalsContact C-N 3.28Å; D74-R76 PolarHBondContact O-N 3.08Å; D74-V77 PolarHBondContact O-N 3.05Å; D74-V77 VanDerWaalsContact O-N 3.13Å; D74-D78 VanDerWaalsContact O-CB 3.31Å; D74-D78 WeakPolarHBondContact O-CB 3.38Å; D74-D78 PolarHBondContact O-N 2.97Å
75	L	84.6	Confident	81.6	Confident	107 Å²	107	113.8 Å²	113.8	56%	0.56	55%	0.547	S	S	*	.	H	α-helix	trans	-62.9	-35.6	174.9	-169.6	64.2	0	0	0	111.9	L71 T79	L71-L75 HydrophobicContact CD2-CB 4.36Å; L71-L75 WeakPolarHBondContact O-CB 3.44Å; L71-L75 PolarHBondContact O-N 2.94Å; L75-T79 WeakPolarHBondContact O-CB 3.35Å; L75-T79 VanDerWaalsContact O-CG2 3.26Å; L75-T79 WeakPolarHBondContact O-CG2 3.47Å; L75-T79 PolarHBondContact O-N 3Å
76	R	80.1	Confident	82.3	Confident	156 Å²	156	107.9 Å²	107.9	59%	0.589	53%	0.531	S	S	*	.	H	α-helix	trans	-70.2	-34	173.8	-84.3	-164.4	-98.6	171.1	-12.1	113.1	L72 R73 D74 T79 K80	L72-R76 VanDerWaalsContact CD2-CZ 3.49Å; L72-R76 WeakPolarHBondContact O-CB 3.31Å; L72-R76 WeakPolarHBondContact O-CG 3.4Å; L72-R76 PolarHBondContact O-N 3.41Å; R73-R76 CarbonylContact O-C 3.54Å; R73-R76 WeakPolarHBondContact O-CA 3.49Å; R73-R76 WeakPolarHBondContact O-CB 3.46Å; R73-R76 PolarHBondContact O-N 3.42Å; R73-R76 VanDerWaalsContact O-N 3.13Å; D74-R76 VanDerWaalsContact C-N 3.28Å; D74-R76 PolarHBondContact O-N 3.08Å; R76-T79 VanDerWaalsContact O-CG2 3.29Å; R76-T79 WeakPolarHBondContact O-CG2 3.42Å; R76-K80 VanDerWaalsContact O-CB 3.29Å; R76-K80 WeakPolarHBondContact O-CB 3.34Å; R76-K80 PolarHBondContact O-N 3.32Å
77	V	85.1	Confident	82.6	Confident	96 Å²	96	115.4 Å²	115.4	58%	0.582	55%	0.551	S	S	*	*	H	α-helix	trans	-73.9	-41.9	175.8	169.6	0	0	0	0	110.1	R73 D74 K80 S81	R73-V77 WeakPolarHBondContact O-CG2 3.41Å; R73-V77 PolarHBondContact O-N 3.46Å; D74-V77 PolarHBondContact O-N 3.05Å; D74-V77 VanDerWaalsContact O-N 3.13Å; V77-K80 PolarHBondContact O-N 2.92Å; V77-S81 WeakPolarHBondContact O-CB 3.14Å; V77-S81 PolarHBondContact O-N 2.85Å; V77-S81 PolarHBondContact O-OG 3Å
78	D	81.1	Confident	82.6	Confident	95 Å²	95	115.7 Å²	115.7	51%	0.508	55%	0.552	S	S	.	*	H	α-helix	trans	-64.7	-45.7	178.6	-172.5	-99.6	0	0	0	112.1	D74 K80 S81 R82	D74-D78 VanDerWaalsContact O-CB 3.31Å; D74-D78 WeakPolarHBondContact O-CB 3.38Å; D74-D78 PolarHBondContact O-N 2.97Å; D78-K80 VanDerWaalsContact C-N 3.32Å; D78-K80 PolarHBondContact O-N 3.27Å; D78-S81 PolarHBondContact O-N 3.2Å; D78-S81 PolarHBondContact O-OG 3.37Å; D78-R82 VanDerWaalsContact O-CB 3.23Å; D78-R82 WeakPolarHBondContact O-CB 3.41Å; D78-R82 PolarHBondContact O-N 3.49Å
79	T	81.9	Confident	82.4	Confident	86 Å²	86	112.6 Å²	112.6	53%	0.528	55%	0.549	S	S	.	.	H	α-helix	trans	-63.8	-38.3	175.2	-173	0	0	0	0	112.2	L75 R76 A83	L75-T79 WeakPolarHBondContact O-CB 3.35Å; L75-T79 VanDerWaalsContact O-CG2 3.26Å; L75-T79 WeakPolarHBondContact O-CG2 3.47Å; L75-T79 PolarHBondContact O-N 3Å; R76-T79 VanDerWaalsContact O-CG2 3.29Å; R76-T79 WeakPolarHBondContact O-CG2 3.42Å; T79-A83 WeakPolarHBondContact O-CB 3.47Å; T79-A83 PolarHBondContact O-N 3.35Å
80	K	84.3	Confident	81.7	Confident	162 Å²	162	117.2 Å²	117.2	70%	0.704	56%	0.563	S	S	*	*	H	α-helix	trans	-71.1	-39.7	179	-173.7	170.4	-179.4	177.1	0	111.9	R76 V77 D78 A83 A84	R76-K80 VanDerWaalsContact O-CB 3.29Å; R76-K80 WeakPolarHBondContact O-CB 3.34Å; R76-K80 PolarHBondContact O-N 3.32Å; V77-K80 PolarHBondContact O-N 2.92Å; D78-K80 VanDerWaalsContact C-N 3.32Å; D78-K80 PolarHBondContact O-N 3.27Å; K80-A83 PolarHBondContact O-N 3.04Å; K80-A84 WeakPolarHBondContact O-CB 3.43Å; K80-A84 PolarHBondContact O-N 2.71Å
81	S	84.6	Confident	80.7	Confident	45 Å²	45	115.9 Å²	115.9	32%	0.315	57%	0.565	S	S	.	*	H	α-helix	trans	-66.3	-43.8	175.7	72.5	0	0	0	0	110.2	V77 D78 A83 A84 W85	V77-S81 WeakPolarHBondContact O-CB 3.14Å; V77-S81 PolarHBondContact O-N 2.85Å; V77-S81 PolarHBondContact O-OG 3Å; D78-S81 PolarHBondContact O-N 3.2Å; D78-S81 PolarHBondContact O-OG 3.37Å; S81-A83 VanDerWaalsContact C-N 3.33Å; S81-A83 PolarHBondContact O-N 3.3Å; S81-A84 PolarHBondContact O-N 2.98Å; S81-A84 VanDerWaalsContact O-N 3.12Å; S81-W85 PolarHBondContact O-N 2.93Å
82	R	82.8	Confident	79.5	Confident	190 Å²	190	117 Å²	117	72%	0.717	57%	0.567	S	S	*	*	H	α-helix	trans	-59.8	-41.7	176	-165	175.1	-147.7	-102.7	1	112.1	D78 A86	D78-R82 VanDerWaalsContact O-CB 3.23Å; D78-R82 WeakPolarHBondContact O-CB 3.41Å; D78-R82 PolarHBondContact O-N 3.49Å; R82-A86 WeakPolarHBondContact O-CB 3.48Å; R82-A86 PolarHBondContact O-N 3.03Å
83	A	82.3	Confident	78.4	Confident	44 Å²	44	117.3 Å²	117.3	36%	0.364	57%	0.573	S	S	.	*	H	α-helix	trans	-67.1	-37.2	174.9	0	0	0	0	0	112.8	T79 K80 S81 R87	T79-A83 WeakPolarHBondContact O-CB 3.47Å; T79-A83 PolarHBondContact O-N 3.35Å; K80-A83 PolarHBondContact O-N 3.04Å; S81-A83 VanDerWaalsContact C-N 3.33Å; S81-A83 PolarHBondContact O-N 3.3Å; A83-R87 WeakPolarHBondContact O-CG 3.24Å; A83-R87 PolarHBondContact O-N 3.04Å
84	A	85.4	Confident	77.1	Confident	55 Å²	55	115.2 Å²	115.2	46%	0.455	58%	0.575	S	S	.	*	H	α-helix	trans	-67.7	-43	175.3	0	0	0	0	0	112	K80 S81 R87 L88	K80-A84 WeakPolarHBondContact O-CB 3.43Å; K80-A84 PolarHBondContact O-N 2.71Å; S81-A84 PolarHBondContact O-N 2.98Å; S81-A84 VanDerWaalsContact O-N 3.12Å; A84-R87 PolarHBondContact O-N 2.76Å; A84-L88 PolarHBondContact O-N 3.37Å
85	W	78.6	Confident	75.9	Confident	159 Å²	159	114.3 Å²	114.3	60%	0.602	58%	0.583	S	S	*	*	H	α-helix	trans	-64.8	-39.5	174.8	-77.9	113.6	0	0	0	112.4	S81 R87 L88 L89	S81-W85 PolarHBondContact O-N 2.93Å; W85-R87 VanDerWaalsContact C-N 3.29Å; W85-R87 PolarHBondContact O-N 3.19Å; W85-L88 HydrophobicContact CE3-CD2 3.8Å; W85-L88 HydrophobicContact CH2-CD2 4.48Å; W85-L88 HydrophobicContact CZ3-CD2 3.59Å; W85-L88 PolarHBondContact O-N 3.03Å; W85-L89 WeakPolarHBondContact O-CB 3.39Å; W85-L89 VanDerWaalsContact O-CG 3.29Å; W85-L89 WeakPolarHBondContact O-CG 3.44Å; W85-L89 PolarHBondContact O-N 2.88Å
86	A	81.4	Confident	74.8	Confident	48 Å²	48	120 Å²	120	40%	0.397	60%	0.597	S	S	.	*	H	α-helix	trans	-59.3	-40.4	175.3	0	0	0	0	0	111.8	R82 H90	R82-A86 WeakPolarHBondContact O-CB 3.48Å; R82-A86 PolarHBondContact O-N 3.03Å; A86-H90 WeakPolarHBondContact O-CB 3.41Å; A86-H90 PolarHBondContact O-CD2 2.92Å; A86-H90 PolarHBondContact O-N 2.85Å
87	R	81.1	Confident	73.7	Confident	186 Å²	186	121.6 Å²	121.6	70%	0.702	61%	0.608	S	S	*	*	H	α-helix	trans	-66.2	-46.5	174.7	-67.7	173.8	-169.1	169.1	1.8	111.7	A83 A84 W85 L89 H90 E91	A83-R87 WeakPolarHBondContact O-CG 3.24Å; A83-R87 PolarHBondContact O-N 3.04Å; A84-R87 PolarHBondContact O-N 2.76Å; W85-R87 VanDerWaalsContact C-N 3.29Å; W85-R87 PolarHBondContact O-N 3.19Å; R87-L89 VanDerWaalsContact C-N 3.27Å; R87-L89 PolarHBondContact O-N 3.44Å; R87-H90 CarbonylContact O-C 3.55Å; R87-H90 PolarHBondContact O-N 3.4Å; R87-H90 VanDerWaalsContact O-N 3.16Å; R87-E91 WeakPolarHBondContact O-CB 3.36Å; R87-E91 PolarHBondContact O-N 3Å
88	L	79.2	Confident	72.3	Confident	88 Å²	88	127.3 Å²	127.3	46%	0.461	62%	0.621	S	S	.	*	H	α-helix	trans	-60.2	-38.2	179.2	-176.5	63.3	0	0	0	112.5	A84 W85	A84-L88 PolarHBondContact O-N 3.37Å; W85-L88 HydrophobicContact CE3-CD2 3.8Å; W85-L88 HydrophobicContact CH2-CD2 4.48Å; W85-L88 HydrophobicContact CZ3-CD2 3.59Å; W85-L88 PolarHBondContact O-N 3.03Å
89	L	76.3	Confident	71	Confident	130 Å²	130	132 Å²	132	68%	0.681	64%	0.637	S	S	*	*	H	α-helix	trans	-73.7	-35.4	176.8	-67.2	173.8	0	0	0	112.3	W85 R87 E91	W85-L89 WeakPolarHBondContact O-CB 3.39Å; W85-L89 VanDerWaalsContact O-CG 3.29Å; W85-L89 WeakPolarHBondContact O-CG 3.44Å; W85-L89 PolarHBondContact O-N 2.88Å; R87-L89 VanDerWaalsContact C-N 3.27Å; R87-L89 PolarHBondContact O-N 3.44Å; L89-E91 VanDerWaalsContact C-N 3.34Å
90	H	68.3	Low	69.7	Low	161 Å²	161	130.6 Å²	130.6	75%	0.745	64%	0.64	S	S	*	*	H	α-helix	trans	-74.5	-21.3	173.7	-92.9	-80.4	0	0	0	113.9	A86 R87 H92 P93	A86-H90 WeakPolarHBondContact O-CB 3.41Å; A86-H90 PolarHBondContact O-CD2 2.92Å; A86-H90 PolarHBondContact O-N 2.85Å; R87-H90 CarbonylContact O-C 3.55Å; R87-H90 PolarHBondContact O-N 3.4Å; R87-H90 VanDerWaalsContact O-N 3.16Å; H90-H92 VanDerWaalsContact C-N 3.28Å; H90-P93 WeakPolarHBondContact O-CD 3.38Å
91	E	61.5	Low	68.4	Low	150 Å²	150	127.8 Å²	127.8	70%	0.701	65%	0.646	S	S	*	*	S	Bend	trans	-75.5	-16.7	177.6	-157.5	79.2	158.4	0	0	112.2	R87 L89 P93	R87-E91 WeakPolarHBondContact O-CB 3.36Å; R87-E91 PolarHBondContact O-N 3Å; L89-E91 VanDerWaalsContact C-N 3.34Å; E91-P93 VanDerWaalsContact O-CD 3.26Å; E91-P93 WeakPolarHBondContact O-CD 3.45Å
92	H	61	Low	67.2	Low	131 Å²	131	131.4 Å²	131.4	61%	0.606	66%	0.662	S	S	*	*			trans	-114.1	52.2	179.7	-75.9	-75.8	0	0	0	115.5	H90 N94	H90-H92 VanDerWaalsContact C-N 3.28Å; H92-N94 PolarHBondContact O-N 2.91Å; H92-N94 VanDerWaalsContact O-N 3.11Å
93	P	60.3	Low	66.2	Low	89 Å²	89	131.9 Å²	131.9	58%	0.578	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.5	-6.9	173.2	29.2	-28.5	0	0	0	112.5	H90 E91	H90-P93 WeakPolarHBondContact O-CD 3.38Å; E91-P93 VanDerWaalsContact O-CD 3.26Å; E91-P93 WeakPolarHBondContact O-CD 3.45Å
94	N	57.3	Low	65.2	Low	132 Å²	132	139 Å²	139	71%	0.706	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.1	32.2	-164.1	-74.8	-51.3	0	0	0	116.1	H92 R96	H92-N94 PolarHBondContact O-N 2.91Å; H92-N94 VanDerWaalsContact O-N 3.11Å; N94-R96 PolarHBondContact O-N 3.24Å
95	A	56.9	Low	64	Low	90 Å²	90	139.7 Å²	139.7	74%	0.744	71%	0.705	S	S	*	*			trans	-66.9	5.8	161.7	0	0	0	0	0	113.2	K97	A95-K97 PolarHBondContact O-N 2.65Å; A95-K97 VanDerWaalsContact O-N 3.08Å
96	R	60.8	Low	62.9	Low	226 Å²	226	140 Å²	140	85%	0.853	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	34.5	-175.7	-145.8	-172.9	-82	167.5	-6.4	113.8	N94	N94-R96 PolarHBondContact O-N 3.24Å
97	K	57.6	Low	61.7	Low	190 Å²	190	142.3 Å²	142.3	83%	0.826	73%	0.731	S	S	*	*	T	Hydrogen-bonded Turn	trans	-138.1	39.5	173	-64.9	-165.7	-176.3	-179.2	0	113.6	A95 K99	A95-K97 PolarHBondContact O-N 2.65Å; A95-K97 VanDerWaalsContact O-N 3.08Å; K97-K99 PolarHBondContact O-N 3.44Å
98	Y	55.8	Low	60.6	Low	216 Å²	216	144.1 Å²	144.1	85%	0.847	74%	0.744	S	S	*	*			trans	-77.9	67.5	144.9	-164.2	-102.7	0	0	0	107.9	G100	Y98-G100 PolarHBondContact O-N 3.1Å; Y98-G100 VanDerWaalsContact O-N 3.09Å
99	K	53.1	Low	59.6	Low	193 Å²	193	142.8 Å²	142.8	84%	0.839	75%	0.752	S	S	*	*			trans	-68.9	106.7	173.9	-173.7	177.6	-178.1	-170.1	0	105.7	K97 A101	K97-K99 PolarHBondContact O-N 3.44Å; K99-A101 PolarHBondContact O-N 3.1Å; K99-A101 VanDerWaalsContact O-N 3.11Å
100	G	55.7	Low	58.7	Low	57 Å²	57	138.5 Å²	138.5	59%	0.588	73%	0.732	S	S	*	*			trans	-42.1	117.1	-175.7	0	0	0	0	0	112.3	Y98 N102	Y98-G100 PolarHBondContact O-N 3.1Å; Y98-G100 VanDerWaalsContact O-N 3.09Å; G100-N102 PolarHBondContact O-N 3.39Å
101	A	56.3	Low	58.3	Low	103 Å²	103	137.1 Å²	137.1	85%	0.851	72%	0.724	S	S	*	*			trans	-72.6	58.7	160.9	0	0	0	0	0	109	K99	K99-A101 PolarHBondContact O-N 3.1Å; K99-A101 VanDerWaalsContact O-N 3.11Å
102	N	59.9	Low	58.2	Low	121 Å²	121	133.3 Å²	133.3	65%	0.647	73%	0.725	S	S	*	*			trans	-94.4	89.3	158.3	-175.4	4.6	0	0	0	106.9	G100 K104	G100-N102 PolarHBondContact O-N 3.39Å; N102-K104 PolarHBondContact OD1-N 3.44Å
103	K	60.7	Low	58	Low	201 Å²	201	133.4 Å²	133.4	87%	0.874	73%	0.73	S	S	*	*			trans	-111.2	67.5	155.6	-73.4	-161.6	178.5	-166.5	0	108.4
104	K	61.6	Low	57.9	Low	193 Å²	193	139.4 Å²	139.4	84%	0.839	75%	0.746	S	S	*	*			trans	-77.1	112	152.2	-72.8	-173.7	178.6	-173.2	0	107.8	N102	N102-K104 PolarHBondContact OD1-N 3.44Å
105	G	60	Low	57.9	Low	70 Å²	70	138.9 Å²	138.9	72%	0.722	74%	0.743	S	S	*	*			trans	86.7	100.5	151.5	0	0	0	0	0	117.6
106	L	55.7	Low	58	Low	166 Å²	166	141.7 Å²	141.7	87%	0.869	75%	0.745	S	S	*	*			trans	-163	76.7	134.1	-152.5	67.4	0	0	0	107.6
107	S	56.8	Low	58	Low	96 Å²	96	138.5 Å²	138.5	67%	0.671	73%	0.733	S	S	*	*				48	106.7	104.1	67.4	0	0	0	0	113.9
108	K	58.6	Low	58.1	Low	223 Å²	223	137.4 Å²	137.4	97%	0.97	74%	0.735	S	S	*	*			trans	45.2	85	159.3	-73.5	174.3	173.5	175.6	0	115.4
109	G	56.8	Low	58.1	Low	61 Å²	61	130.7 Å²	130.7	63%	0.629	73%	0.732	S	S	*	*			trans	-156.4	100	172.7	0	0	0	0	0	112.8	F111	G109-F111 PolarHBondContact O-N 3Å; G109-F111 VanDerWaalsContact O-N 3.09Å
110	C	59.2	Low	58.2	Low	40 Å²	40	125.6 Å²	125.6	27%	0.27	72%	0.72	S	S	.	*	S	Bend	trans	-46.3	-23.7	170.2	174.4	0	0	0	0	117.5	L124 G125 C126	C110-L124 PolarHBondContact SG-O 3.15Å; C110-L124 VanDerWaalsContact SG-O 3.32Å; C110-G125 WeakPolarHBondContact SG-CA 3.03Å; C110-C126 HydrophobicContact CB-CB 3.72Å; C110-C126 WeakPolarHBondContact CB-SG 3.49Å; C110-C126 WeakPolarHBondContact SG-CA 3.44Å; C110-C126 PolarHBondContact SG-N 3.46Å
111	F	59.9	Low	58.1	Low	131 Å²	131	131.8 Å²	131.8	58%	0.575	74%	0.736	S	S	*	*			trans	-143.4	82.7	-176.6	-79.2	-76.8	0	0	0	108.1	G109 S122 L124	G109-F111 PolarHBondContact O-N 3Å; G109-F111 VanDerWaalsContact O-N 3.09Å; F111-S122 VanDerWaalsContact CE1-O 3.24Å; F111-S122 WeakPolarHBondContact CE1-O 3.41Å; F111-S122 WeakPolarHBondContact CZ-O 3.38Å; F111-L124 VanDerWaalsContact CE1-O 3.31Å; F111-L124 WeakPolarHBondContact CE1-O 3.43Å; F111-L124 WeakPolarHBondContact CE2-O 3.2Å; F111-L124 WeakPolarHBondContact CZ-O 3.47Å
112	G	58.8	Low	58	Low	70 Å²	70	129 Å²	129	72%	0.722	71%	0.711	S	S	*	*			trans	-96.4	0.7	-174.7	0	0	0	0	0	115.7
113	L	57.1	Low	58	Low	134 Å²	134	126.9 Å²	126.9	70%	0.702	72%	0.717	S	S	*	*	S	Bend	trans	-151.5	115.3	175.5	-154.6	67.5	0	0	0	109.4	L115	L113-L115 HydrophobicContact CD2-CD2 4.31Å; L113-L115 PolarHBondContact O-N 2.79Å
114	K	57.1	Low	57.7	Low	214 Å²	214	123.3 Å²	123.3	93%	0.93	71%	0.707	S	S	*	*			trans	-60.6	82.8	170.8	-147.3	177.2	-169.6	174.9	0	107.4	D116	K114-D116 PolarHBondContact O-N 3.28Å; K114-D116 VanDerWaalsContact O-N 3.12Å
115	L	58	Low	57.2	Low	121 Å²	121	116.6 Å²	116.6	63%	0.634	69%	0.693	S	S	*	*			trans	-70.7	104.8	168.7	-70.1	179.1	0	0	0	105	L113 R117	L113-L115 HydrophobicContact CD2-CD2 4.31Å; L113-L115 PolarHBondContact O-N 2.79Å; L115-R117 PolarHBondContact O-N 2.71Å
116	D	58.3	Low	56.8	Low	149 Å²	149	121.3 Å²	121.3	80%	0.797	71%	0.712	S	S	*	*			trans	-63.2	78.9	166.6	-171.9	53.1	0	0	0	107.9	K114	K114-D116 PolarHBondContact O-N 3.28Å; K114-D116 VanDerWaalsContact O-N 3.12Å
117	R	61	Low	56.9	Low	159 Å²	159	119.1 Å²	119.1	60%	0.6	71%	0.705	S	S	*	*			trans	-82.6	108.9	163.2	-81.2	-167.4	172.7	178.2	-0.3	105.8	L115 G119	L115-R117 PolarHBondContact O-N 2.71Å; R117-G119 VanDerWaalsContact C-N 3.32Å; R117-G119 PolarHBondContact O-N 2.85Å
118	I	59.5	Low	56.9	Low	167 Å²	167	120.3 Å²	120.3	86%	0.856	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.8	104.7	154.5	-66.4	165.3	0	0	0	106.6
119	G	56	Low	56.8	Low	76 Å²	76	114.6 Å²	114.6	78%	0.784	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	104.8	0.5	158.6	0	0	0	0	0	120.5	R117	R117-G119 VanDerWaalsContact C-N 3.32Å; R117-G119 PolarHBondContact O-N 2.85Å
120	S	54.9	Low	56.8	Low	86 Å²	86	117.7 Å²	117.7	60%	0.601	70%	0.695	S	S	*	*			trans	-160	120.9	169.9	-142.8	0	0	0	0	113.9	S122	S120-S122 PolarHBondContact O-N 3.24Å
121	M	53.3	Low	56.6	Low	187 Å²	187	122.6 Å²	122.6	92%	0.921	72%	0.722	S	S	*	*			trans	-61.4	102.6	170.6	-65	176.5	63.5	0	0	108.6	G123	M121-G123 PolarHBondContact O-N 3.09Å
122	S	55.2	Low	56.4	Low	45 Å²	45	122 Å²	122	32%	0.315	73%	0.732	S	S	.	*			trans	-69.8	98.9	171.4	54.3	0	0	0	0	108.2	F111 S120 L124	F111-S122 VanDerWaalsContact CE1-O 3.24Å; F111-S122 WeakPolarHBondContact CE1-O 3.41Å; F111-S122 WeakPolarHBondContact CZ-O 3.38Å; S120-S122 PolarHBondContact O-N 3.24Å; S122-L124 PolarHBondContact O-N 3.3Å
123	G	59.5	Low	56.2	Low	76 Å²	76	125.7 Å²	125.7	78%	0.784	73%	0.732	S	S	*	*			trans	-69.5	60.8	173.2	0	0	0	0	0	112.6	M121 G125	M121-G123 PolarHBondContact O-N 3.09Å; G123-G125 PolarHBondContact O-N 3.19Å
124	L	54.7	Low	56.2	Low	126 Å²	126	125.1 Å²	125.1	66%	0.66	74%	0.735	S	S	*	*			trans	-94.8	88.1	168.7	-93.8	123.5	0	0	0	109.7	C110 F111 S122	C110-L124 PolarHBondContact SG-O 3.15Å; C110-L124 VanDerWaalsContact SG-O 3.32Å; F111-L124 VanDerWaalsContact CE1-O 3.31Å; F111-L124 WeakPolarHBondContact CE1-O 3.43Å; F111-L124 WeakPolarHBondContact CE2-O 3.2Å; F111-L124 WeakPolarHBondContact CZ-O 3.47Å; S122-L124 PolarHBondContact O-N 3.3Å
125	G	51.3	Low	56.1	Low	52 Å²	52	117.7 Å²	117.7	54%	0.536	72%	0.718	S	S	.	*			trans	-45	170.2	155.4	0	0	0	0	0	113.3	C110 G123	C110-G125 WeakPolarHBondContact SG-CA 3.03Å; G123-G125 PolarHBondContact O-N 3.19Å
126	C	51.5	Low	55.9	Low	168 Å²	168	117.4 Å²	117.4	100%	1.135	73%	0.726	S	S	*	*			trans	-44.9	0	-149.9	-49.7	0	0	0	0	120.4	C110	C110-C126 HydrophobicContact CB-CB 3.72Å; C110-C126 WeakPolarHBondContact CB-SG 3.49Å; C110-C126 WeakPolarHBondContact SG-CA 3.44Å; C110-C126 PolarHBondContact SG-N 3.46Å

Retrieved 126 of 126 residues in 414.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).