A0A0U5KI45_SCHMA Loading...

MEG-30 protein

AlphaFold DB , UniProt , Accession A0A0U5KI45, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene MEG-30, Length 58 aa.

						>A0A0U5KI45_SCHMA|A0A0U5KI45|MEG-30
MQVDKFIIYTIVIIAIAIFVSMPEIHAFGIKFFTTTPVPNKGLLDKLLDGLYQFFNRH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61	Low	83.6	Confident	197 Å²	197	121.5 Å²	121.5	97%	0.97	59%	0.592	S	S	*	*				0	-45.3	0	-72.4	-154.1	-157.5	0	0	114.2	D4	M1-D4 WeakPolarHBondContact CA-OD2 3.11Å; M1-D4 PolarHBondContact N-OD2 2.96Å
2	Q	69.7	Low	84.1	Confident	174 Å²	174	117.4 Å²	117.4	81%	0.813	58%	0.579	S	S	*	*	H	α-helix	trans	-80	-40.1	179.4	-165.5	177.1	53.7	0	0	113.5	D4 K5 F6	Q2-D4 VanDerWaalsContact C-N 3.3Å; Q2-D4 PolarHBondContact O-N 3.33Å; Q2-K5 PolarHBondContact O-N 3.49Å; Q2-F6 PolarHBondContact O-N 2.93Å
3	V	77.3	Confident	84.4	Confident	101 Å²	101	117.1 Å²	117.1	61%	0.612	58%	0.579	S	S	*	*	H	α-helix	trans	-60	-41.2	177.9	180	0	0	0	0	111.4	K5 F6 I7	V3-K5 VanDerWaalsContact C-N 3.28Å; V3-K5 PolarHBondContact O-N 3.16Å; V3-F6 WeakPolarHBondContact O-CB 3.49Å; V3-F6 PolarHBondContact O-N 3.48Å; V3-F6 VanDerWaalsContact O-N 3.11Å; V3-I7 HydrophobicContact CG1-CD1 4.08Å; V3-I7 PolarHBondContact O-N 3.01Å; V3-I7 VanDerWaalsContact O-N 3.12Å
4	D	84	Confident	84.8	Confident	93 Å²	93	115.4 Å²	115.4	50%	0.497	57%	0.572	S	S	.	*	H	α-helix	trans	-59.5	-40.6	-179.6	-45.6	-59.7	0	0	0	111.5	M1 Q2 I8	M1-D4 WeakPolarHBondContact CA-OD2 3.11Å; M1-D4 PolarHBondContact N-OD2 2.96Å; Q2-D4 VanDerWaalsContact C-N 3.3Å; Q2-D4 PolarHBondContact O-N 3.33Å; D4-I8 WeakPolarHBondContact O-CD1 3.49Å; D4-I8 WeakPolarHBondContact O-CG1 3.05Å; D4-I8 PolarHBondContact O-N 3.23Å
5	K	84.9	Confident	84.8	Confident	129 Å²	129	111.4 Å²	111.4	56%	0.561	57%	0.565	S	S	*	*	H	α-helix	trans	-69.3	-38.9	176.9	-66.5	-176.1	-178.9	-175.9	0	112.1	Q2 V3 I7 I8 Y9	Q2-K5 PolarHBondContact O-N 3.49Å; V3-K5 VanDerWaalsContact C-N 3.28Å; V3-K5 PolarHBondContact O-N 3.16Å; K5-I7 PolarHBondContact O-N 3.37Å; K5-I8 PolarHBondContact O-N 2.86Å; K5-Y9 HydrophobicContact CB-CD2 4.41Å; K5-Y9 HydrophobicContact CB-CE2 4.06Å; K5-Y9 WeakPolarHBondContact O-CD2 3.34Å; K5-Y9 PolarHBondContact O-N 2.9Å
6	F	89.5	Confident	84.9	Confident	143 Å²	143	110.3 Å²	110.3	63%	0.627	56%	0.559	S	S	*	*	H	α-helix	trans	-62	-42.6	179.2	180	-98.4	0	0	0	112.3	Q2 V3 Y9 T10	Q2-F6 PolarHBondContact O-N 2.93Å; V3-F6 WeakPolarHBondContact O-CB 3.49Å; V3-F6 PolarHBondContact O-N 3.48Å; V3-F6 VanDerWaalsContact O-N 3.11Å; F6-Y9 PolarHBondContact O-N 2.74Å; F6-T10 WeakPolarHBondContact O-CB 3.26Å; F6-T10 PolarHBondContact O-N 2.85Å; F6-T10 PolarHBondContact O-OG1 3.45Å
7	I	93.1	Very high	84.7	Confident	89 Å²	89	106.7 Å²	106.7	46%	0.456	55%	0.551	S	S	.	*	H	α-helix	trans	-62.8	-46.1	177.4	-64.8	170.2	0	0	0	110.4	V3 K5 Y9 T10 I11	V3-I7 HydrophobicContact CG1-CD1 4.08Å; V3-I7 PolarHBondContact O-N 3.01Å; V3-I7 VanDerWaalsContact O-N 3.12Å; K5-I7 PolarHBondContact O-N 3.37Å; I7-Y9 PolarHBondContact O-N 3.03Å; I7-T10 PolarHBondContact O-N 3.37Å; I7-I11 HydrophobicContact CG2-CD1 3.84Å; I7-I11 WeakPolarHBondContact O-CG1 3.44Å; I7-I11 PolarHBondContact O-N 3.25Å
8	I	89.9	Confident	84.5	Confident	100 Å²	100	105.1 Å²	105.1	51%	0.513	54%	0.542	S	S	.	.	H	α-helix	trans	-60.9	-47.5	179.1	-66.4	166.1	0	0	0	111	D4 K5 T10 I11 V12	D4-I8 WeakPolarHBondContact O-CD1 3.49Å; D4-I8 WeakPolarHBondContact O-CG1 3.05Å; D4-I8 PolarHBondContact O-N 3.23Å; K5-I8 PolarHBondContact O-N 2.86Å; I8-T10 VanDerWaalsContact C-N 3.3Å; I8-T10 PolarHBondContact O-N 3.32Å; I8-I11 PolarHBondContact O-N 3.06Å; I8-V12 HydrophobicContact CG2-CG2 4.46Å; I8-V12 WeakPolarHBondContact O-CG2 3.35Å; I8-V12 PolarHBondContact O-N 3.31Å
9	Y	87.7	Confident	84.2	Confident	152 Å²	152	103.5 Å²	103.5	60%	0.596	53%	0.531	S	S	*	.	H	α-helix	trans	-62.1	-39	178.6	-69.2	-48.9	0	0	0	112.3	K5 F6 I7 V12 I13	K5-Y9 HydrophobicContact CB-CD2 4.41Å; K5-Y9 HydrophobicContact CB-CE2 4.06Å; K5-Y9 WeakPolarHBondContact O-CD2 3.34Å; K5-Y9 PolarHBondContact O-N 2.9Å; F6-Y9 PolarHBondContact O-N 2.74Å; I7-Y9 PolarHBondContact O-N 3.03Å; Y9-V12 PolarHBondContact O-N 3.19Å; Y9-I13 WeakPolarHBondContact O-CD1 3.37Å; Y9-I13 VanDerWaalsContact O-CG1 3.26Å; Y9-I13 WeakPolarHBondContact O-CG1 3.07Å; Y9-I13 PolarHBondContact O-N 3Å
10	T	89.8	Confident	83.8	Confident	53 Å²	53	102 Å²	102	33%	0.325	53%	0.526	S	S	.	.	H	α-helix	trans	-63.3	-44.8	177.3	-56.2	0	0	0	0	111.4	F6 I7 I8 V12 I13 I14	F6-T10 WeakPolarHBondContact O-CB 3.26Å; F6-T10 PolarHBondContact O-N 2.85Å; F6-T10 PolarHBondContact O-OG1 3.45Å; I7-T10 PolarHBondContact O-N 3.37Å; I8-T10 VanDerWaalsContact C-N 3.3Å; I8-T10 PolarHBondContact O-N 3.32Å; T10-V12 PolarHBondContact O-N 3.39Å; T10-I13 PolarHBondContact O-N 3.35Å; T10-I14 HydrophobicContact CG2-CD1 3.97Å; T10-I14 WeakPolarHBondContact O-CG1 3.43Å; T10-I14 PolarHBondContact O-N 2.84Å
11	I	92.9	Very high	83.6	Confident	106 Å²	106	101.5 Å²	101.5	54%	0.544	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-43.8	177.6	-67.5	167.3	0	0	0	111.2	I7 I8 I13 I14 A15	I7-I11 HydrophobicContact CG2-CD1 3.84Å; I7-I11 WeakPolarHBondContact O-CG1 3.44Å; I7-I11 PolarHBondContact O-N 3.25Å; I8-I11 PolarHBondContact O-N 3.06Å; I11-I13 PolarHBondContact O-N 3.32Å; I11-I14 PolarHBondContact O-N 3.12Å; I11-A15 WeakPolarHBondContact O-CB 3.29Å; I11-A15 PolarHBondContact O-N 3.03Å
12	V	89.7	Confident	84.5	Confident	72 Å²	72	96.5 Å²	96.5	44%	0.436	51%	0.508	S	S	.	.	H	α-helix	trans	-61.9	-44	178.6	171.8	0	0	0	0	111	I8 Y9 T10 I14 A15 I16	I8-V12 HydrophobicContact CG2-CG2 4.46Å; I8-V12 WeakPolarHBondContact O-CG2 3.35Å; I8-V12 PolarHBondContact O-N 3.31Å; Y9-V12 PolarHBondContact O-N 3.19Å; T10-V12 PolarHBondContact O-N 3.39Å; V12-I14 PolarHBondContact O-N 3.49Å; V12-A15 PolarHBondContact O-N 3.46Å; V12-I16 HydrophobicContact CG1-CD1 3.77Å; V12-I16 VanDerWaalsContact O-CG1 3.26Å; V12-I16 WeakPolarHBondContact O-CG1 3.49Å; V12-I16 PolarHBondContact O-N 2.82Å
13	I	87.9	Confident	84.9	Confident	113 Å²	113	92.2 Å²	92.2	58%	0.579	50%	0.495	S	S	*	.	H	α-helix	trans	-62.9	-43.8	177.8	-69	165.7	0	0	0	111	Y9 T10 I11 I16 A17	Y9-I13 WeakPolarHBondContact O-CD1 3.37Å; Y9-I13 VanDerWaalsContact O-CG1 3.26Å; Y9-I13 WeakPolarHBondContact O-CG1 3.07Å; Y9-I13 PolarHBondContact O-N 3Å; T10-I13 PolarHBondContact O-N 3.35Å; I11-I13 PolarHBondContact O-N 3.32Å; I13-I16 PolarHBondContact O-N 3.48Å; I13-A17 WeakPolarHBondContact O-CB 3.4Å; I13-A17 PolarHBondContact O-N 3.36Å
14	I	89.4	Confident	84.9	Confident	93 Å²	93	93.8 Å²	93.8	48%	0.477	50%	0.495	S	S	.	.	H	α-helix	trans	-62.8	-44.5	177.5	-68.8	167.6	0	0	0	110.7	T10 I11 V12 I16 A17 I18	T10-I14 HydrophobicContact CG2-CD1 3.97Å; T10-I14 WeakPolarHBondContact O-CG1 3.43Å; T10-I14 PolarHBondContact O-N 2.84Å; I11-I14 PolarHBondContact O-N 3.12Å; V12-I14 PolarHBondContact O-N 3.49Å; I14-I16 VanDerWaalsContact C-N 3.32Å; I14-I16 PolarHBondContact O-N 3.11Å; I14-A17 PolarHBondContact O-N 3.01Å; I14-I18 HydrophobicContact CG2-CD1 3.73Å; I14-I18 HydrophobicContact CG2-CG1 4.36Å; I14-I18 VanDerWaalsContact O-CG1 3.32Å; I14-I18 WeakPolarHBondContact O-CG1 3.39Å; I14-I18 PolarHBondContact O-N 3.4Å
15	A	85.7	Confident	84.5	Confident	56 Å²	56	92.2 Å²	92.2	46%	0.463	49%	0.486	S	S	.	.	H	α-helix	trans	-60.5	-42.2	177.6	0	0	0	0	0	111.7	I11 V12 F19	I11-A15 WeakPolarHBondContact O-CB 3.29Å; I11-A15 PolarHBondContact O-N 3.03Å; V12-A15 PolarHBondContact O-N 3.46Å; A15-F19 VanDerWaalsContact O-CB 3.28Å; A15-F19 WeakPolarHBondContact O-CB 3.15Å; A15-F19 PolarHBondContact O-N 3.02Å
16	I	85.7	Confident	83.6	Confident	93 Å²	93	88.4 Å²	88.4	48%	0.477	47%	0.47	S	S	.	.	H	α-helix	trans	-65.9	-43.3	175.5	-66.5	166	0	0	0	110.9	V12 I13 I14 I18 F19 V20	V12-I16 HydrophobicContact CG1-CD1 3.77Å; V12-I16 VanDerWaalsContact O-CG1 3.26Å; V12-I16 WeakPolarHBondContact O-CG1 3.49Å; V12-I16 PolarHBondContact O-N 2.82Å; I13-I16 PolarHBondContact O-N 3.48Å; I14-I16 VanDerWaalsContact C-N 3.32Å; I14-I16 PolarHBondContact O-N 3.11Å; I16-I18 PolarHBondContact O-N 3.02Å; I16-F19 WeakPolarHBondContact O-CB 3.47Å; I16-F19 PolarHBondContact O-N 3.28Å; I16-V20 HydrophobicContact CG2-CG2 4.21Å; I16-V20 WeakPolarHBondContact O-CB 3.46Å; I16-V20 VanDerWaalsContact O-CG2 3.29Å; I16-V20 WeakPolarHBondContact O-CG2 3.33Å; I16-V20 PolarHBondContact O-N 3.27Å
17	A	82	Confident	82.9	Confident	50 Å²	50	84.4 Å²	84.4	41%	0.413	46%	0.464	S	S	.	.	H	α-helix	trans	-63.2	-41.7	179.4	0	0	0	0	0	112.3	I13 I14 S21	I13-A17 WeakPolarHBondContact O-CB 3.4Å; I13-A17 PolarHBondContact O-N 3.36Å; I14-A17 PolarHBondContact O-N 3.01Å; A17-S21 VanDerWaalsContact O-CB 3.3Å; A17-S21 WeakPolarHBondContact O-CB 3.3Å; A17-S21 PolarHBondContact O-N 3.49Å; A17-S21 PolarHBondContact O-OG 3.49Å
18	I	81.9	Confident	82.3	Confident	78 Å²	78	87 Å²	87	40%	0.4	47%	0.472	S	S	.	.	H	α-helix	trans	-63.2	-45.6	174.1	-69.9	169.4	0	0	0	110.1	I14 I16 S21 M22 I25	I14-I18 HydrophobicContact CG2-CD1 3.73Å; I14-I18 HydrophobicContact CG2-CG1 4.36Å; I14-I18 VanDerWaalsContact O-CG1 3.32Å; I14-I18 WeakPolarHBondContact O-CG1 3.39Å; I14-I18 PolarHBondContact O-N 3.4Å; I16-I18 PolarHBondContact O-N 3.02Å; I18-S21 PolarHBondContact O-N 2.92Å; I18-M22 HydrophobicContact CG2-SD 4.17Å; I18-M22 WeakPolarHBondContact O-CB 3.32Å; I18-M22 PolarHBondContact O-N 3.07Å; I18-M22 VanDerWaalsContact O-N 3.13Å; I18-I25 HydrophobicContact CG2-CD1 3.56Å
19	F	77.6	Confident	81.4	Confident	74 Å²	74	83 Å²	83	33%	0.325	46%	0.455	S	S	.	.	H	α-helix	trans	-56.4	-54.9	177.7	-169.2	-105.7	0	0	0	110.3	A15 I16 S21 M22 I25 H26	A15-F19 VanDerWaalsContact O-CB 3.28Å; A15-F19 WeakPolarHBondContact O-CB 3.15Å; A15-F19 PolarHBondContact O-N 3.02Å; I16-F19 WeakPolarHBondContact O-CB 3.47Å; I16-F19 PolarHBondContact O-N 3.28Å; F19-S21 VanDerWaalsContact C-N 3.3Å; F19-S21 PolarHBondContact O-N 3.38Å; F19-M22 PolarHBondContact O-N 3.01Å; F19-I25 HydrophobicContact CD2-CG2 3.66Å; F19-I25 HydrophobicContact CE2-CG2 4.16Å; F19-H26 AromaticContact CD1-CD2 3.24Å; F19-H26 WeakPolarHBondContact CD1-CD2 3.26Å; F19-H26 AromaticContact CD1-NE2 3.13Å; F19-H26 WeakPolarHBondContact CD1-NE2 3.37Å; F19-H26 AromaticContact CD2-CD2 3.78Å; F19-H26 AromaticContact CE1-CD2 3.14Å; F19-H26 WeakPolarHBondContact CE1-CD2 3.43Å; F19-H26 AromaticContact CE1-NE2 3.37Å; F19-H26 WeakPolarHBondContact CE1-NE2 3.13Å; F19-H26 AromaticContact CE2-CD2 3.68Å; F19-H26 AromaticContact CG-CD2 3.56Å; F19-H26 AromaticContact CG-NE2 3.71Å; F19-H26 AromaticContact CZ-CD2 3.37Å; F19-H26 WeakPolarHBondContact CZ-CD2 3.35Å; F19-H26 PolarHBondContact O-CD2 2.98Å; F19-H26 PolarHBondContact O-CE1 3.42Å; F19-H26 PolarHBondContact O-NE2 3.34Å
20	V	76.5	Confident	80.8	Confident	73 Å²	73	79.5 Å²	79.5	44%	0.442	45%	0.446	S	S	.	.	H	α-helix	trans	-60.8	-36.4	-178.4	172.3	0	0	0	0	112.8	I16 F55	I16-V20 HydrophobicContact CG2-CG2 4.21Å; I16-V20 WeakPolarHBondContact O-CB 3.46Å; I16-V20 VanDerWaalsContact O-CG2 3.29Å; I16-V20 WeakPolarHBondContact O-CG2 3.33Å; I16-V20 PolarHBondContact O-N 3.27Å; V20-F55 HydrophobicContact CG2-CE1 4.08Å
21	S	80.2	Confident	80	Confident	93 Å²	93	83.6 Å²	83.6	65%	0.65	46%	0.459	S	S	*	.	H	α-helix	trans	-81.1	-20.3	-175.2	-56.3	0	0	0	0	113.5	A17 I18 F19 P23	A17-S21 VanDerWaalsContact O-CB 3.3Å; A17-S21 WeakPolarHBondContact O-CB 3.3Å; A17-S21 PolarHBondContact O-N 3.49Å; A17-S21 PolarHBondContact O-OG 3.49Å; I18-S21 PolarHBondContact O-N 2.92Å; F19-S21 VanDerWaalsContact C-N 3.3Å; F19-S21 PolarHBondContact O-N 3.38Å; S21-P23 WeakPolarHBondContact O-CD 3.34Å
22	M	79.8	Confident	79.1	Confident	92 Å²	92	83.7 Å²	83.7	45%	0.453	46%	0.456	S	S	.	.			trans	-114.3	92.5	-177.1	-64.1	-172.9	176.5	0	0	109.9	I18 F19 E24 I25 H26	I18-M22 HydrophobicContact CG2-SD 4.17Å; I18-M22 WeakPolarHBondContact O-CB 3.32Å; I18-M22 PolarHBondContact O-N 3.07Å; I18-M22 VanDerWaalsContact O-N 3.13Å; F19-M22 PolarHBondContact O-N 3.01Å; M22-E24 PolarHBondContact O-N 3.3Å; M22-E24 VanDerWaalsContact O-N 3.07Å; M22-I25 HydrophobicContact CB-CB 4.06Å; M22-I25 HydrophobicContact CB-CD1 3.74Å; M22-I25 HydrophobicContact CB-CG1 3.67Å; M22-I25 HydrophobicContact CG-CD1 4.1Å; M22-I25 HydrophobicContact CG-CG1 4.47Å; M22-I25 WeakPolarHBondContact O-CB 3.36Å; M22-I25 PolarHBondContact O-N 2.86Å; M22-I25 HydrophobicContact SD-CD1 3.39Å; M22-I25 WeakPolarHBondContact SD-CD1 3.26Å; M22-I25 HydrophobicContact SD-CG1 4.07Å; M22-H26 PolarHBondContact O-N 3.48Å
23	P	76.7	Confident	78	Confident	83 Å²	83	85 Å²	85	54%	0.539	46%	0.456	S	S	.	.	H	α-helix	trans	-57.5	-24.3	176.2	24.8	-34.2	0	0	0	112.5	S21 I25 H26 A27	S21-P23 WeakPolarHBondContact O-CD 3.34Å; P23-I25 VanDerWaalsContact C-N 3.35Å; P23-H26 WeakPolarHBondContact O-CB 3.48Å; P23-H26 PolarHBondContact O-N 2.89Å; P23-A27 PolarHBondContact O-N 3.35Å
24	E	77.5	Confident	77.2	Confident	134 Å²	134	82.9 Å²	82.9	63%	0.626	45%	0.449	S	S	*	.	H	α-helix	trans	-63.7	-37.4	172.7	-59.5	81.2	-178.8	0	0	112.3	M22 A27 F28	M22-E24 PolarHBondContact O-N 3.3Å; M22-E24 VanDerWaalsContact O-N 3.07Å; E24-A27 PolarHBondContact O-N 3.5Å; E24-F28 WeakPolarHBondContact O-CB 2.99Å; E24-F28 PolarHBondContact O-N 2.92Å
25	I	75.8	Confident	76.5	Confident	60 Å²	60	83.1 Å²	83.1	31%	0.308	46%	0.455	S	S	.	.	H	α-helix	trans	-71.2	-37	176	-62.4	-177.6	0	0	0	110.2	I18 F19 M22 P23 F28 G29	I18-I25 HydrophobicContact CG2-CD1 3.56Å; F19-I25 HydrophobicContact CD2-CG2 3.66Å; F19-I25 HydrophobicContact CE2-CG2 4.16Å; M22-I25 HydrophobicContact CB-CB 4.06Å; M22-I25 HydrophobicContact CB-CD1 3.74Å; M22-I25 HydrophobicContact CB-CG1 3.67Å; M22-I25 HydrophobicContact CG-CD1 4.1Å; M22-I25 HydrophobicContact CG-CG1 4.47Å; M22-I25 WeakPolarHBondContact O-CB 3.36Å; M22-I25 PolarHBondContact O-N 2.86Å; M22-I25 HydrophobicContact SD-CD1 3.39Å; M22-I25 WeakPolarHBondContact SD-CD1 3.26Å; M22-I25 HydrophobicContact SD-CG1 4.07Å; P23-I25 VanDerWaalsContact C-N 3.35Å; I25-F28 PolarHBondContact O-N 3.33Å; I25-G29 PolarHBondContact O-N 3.38Å
26	H	67.6	Low	75.7	Confident	49 Å²	49	82.9 Å²	82.9	23%	0.227	45%	0.448	C	S	.	.	H	α-helix	trans	-58	-50.9	171.2	-64.2	166.8	0	0	0	111.2	F19 M22 P23 F28 G29 I30	F19-H26 AromaticContact CD1-CD2 3.24Å; F19-H26 WeakPolarHBondContact CD1-CD2 3.26Å; F19-H26 AromaticContact CD1-NE2 3.13Å; F19-H26 WeakPolarHBondContact CD1-NE2 3.37Å; F19-H26 AromaticContact CD2-CD2 3.78Å; F19-H26 AromaticContact CE1-CD2 3.14Å; F19-H26 WeakPolarHBondContact CE1-CD2 3.43Å; F19-H26 AromaticContact CE1-NE2 3.37Å; F19-H26 WeakPolarHBondContact CE1-NE2 3.13Å; F19-H26 AromaticContact CE2-CD2 3.68Å; F19-H26 AromaticContact CG-CD2 3.56Å; F19-H26 AromaticContact CG-NE2 3.71Å; F19-H26 AromaticContact CZ-CD2 3.37Å; F19-H26 WeakPolarHBondContact CZ-CD2 3.35Å; F19-H26 PolarHBondContact O-CD2 2.98Å; F19-H26 PolarHBondContact O-CE1 3.42Å; F19-H26 PolarHBondContact O-NE2 3.34Å; M22-H26 PolarHBondContact O-N 3.48Å; P23-H26 WeakPolarHBondContact O-CB 3.48Å; P23-H26 PolarHBondContact O-N 2.89Å; H26-F28 VanDerWaalsContact C-N 3.31Å; H26-F28 PolarHBondContact O-N 2.84Å; H26-G29 PolarHBondContact O-N 2.91Å; H26-I30 VanDerWaalsContact O-CG1 3.31Å; H26-I30 WeakPolarHBondContact O-CG1 3.24Å; H26-I30 PolarHBondContact O-N 3.28Å
27	A	74.8	Confident	74.7	Confident	59 Å²	59	84.5 Å²	84.5	49%	0.488	46%	0.464	S	S	.	.	H	α-helix	trans	-62	-39.6	179.2	0	0	0	0	0	111.8	P23 E24 K31	P23-A27 PolarHBondContact O-N 3.35Å; E24-A27 PolarHBondContact O-N 3.5Å; A27-K31 VanDerWaalsContact O-CB 3.29Å; A27-K31 WeakPolarHBondContact O-CB 3.37Å; A27-K31 PolarHBondContact O-N 3.24Å
28	F	78.8	Confident	73.9	Confident	143 Å²	143	84.4 Å²	84.4	63%	0.627	46%	0.458	S	S	*	.	H	α-helix	trans	-64.1	-46.1	175.2	-176.9	-97.2	0	0	0	112.2	E24 I25 H26 K31 F32	E24-F28 WeakPolarHBondContact O-CB 2.99Å; E24-F28 PolarHBondContact O-N 2.92Å; I25-F28 PolarHBondContact O-N 3.33Å; H26-F28 VanDerWaalsContact C-N 3.31Å; H26-F28 PolarHBondContact O-N 2.84Å; F28-K31 PolarHBondContact O-N 2.96Å; F28-F32 WeakPolarHBondContact O-CB 3.42Å; F28-F32 PolarHBondContact O-N 3.47Å
29	G	72.2	Confident	73.4	Confident	16 Å²	16	87.4 Å²	87.4	17%	0.165	48%	0.483	C	S	.	.	H	α-helix	trans	-59.4	-49.4	176.7	0	0	0	0	0	112.1	I25 H26 K31 F32 F33	I25-G29 PolarHBondContact O-N 3.38Å; H26-G29 PolarHBondContact O-N 2.91Å; G29-K31 VanDerWaalsContact C-N 3.32Å; G29-K31 PolarHBondContact O-N 3.44Å; G29-F32 WeakPolarHBondContact O-CB 3.28Å; G29-F32 PolarHBondContact O-N 3.15Å; G29-F33 WeakPolarHBondContact O-CD2 3.39Å; G29-F33 PolarHBondContact O-N 2.92Å
30	I	74.1	Confident	73.5	Confident	79 Å²	79	88 Å²	88	41%	0.405	49%	0.489	S	S	.	.	H	α-helix	trans	-58.1	-45.1	175.9	-66.8	166.5	0	0	0	110.8	H26 F33 T34 L48	H26-I30 VanDerWaalsContact O-CG1 3.31Å; H26-I30 WeakPolarHBondContact O-CG1 3.24Å; H26-I30 PolarHBondContact O-N 3.28Å; I30-F33 PolarHBondContact O-N 2.99Å; I30-T34 HydrophobicContact CG2-CG2 4.4Å; I30-T34 WeakPolarHBondContact O-CB 3.14Å; I30-T34 VanDerWaalsContact O-CG2 3.32Å; I30-T34 WeakPolarHBondContact O-CG2 3.49Å; I30-T34 PolarHBondContact O-N 3.29Å; I30-T34 PolarHBondContact O-OG1 2.87Å; I30-L48 HydrophobicContact CG1-CD1 4.36Å; I30-L48 HydrophobicContact CG1-CD2 3.93Å; I30-L48 HydrophobicContact CG2-CD1 4.03Å
31	K	73.6	Confident	73.4	Confident	139 Å²	139	91.2 Å²	91.2	60%	0.604	50%	0.497	S	S	*	.	H	α-helix	trans	-63	-44.2	178.1	-170.2	175.4	-178.1	178.8	0	111.5	A27 F28 G29 F33 T34 T35	A27-K31 VanDerWaalsContact O-CB 3.29Å; A27-K31 WeakPolarHBondContact O-CB 3.37Å; A27-K31 PolarHBondContact O-N 3.24Å; F28-K31 PolarHBondContact O-N 2.96Å; G29-K31 VanDerWaalsContact C-N 3.32Å; G29-K31 PolarHBondContact O-N 3.44Å; K31-F33 PolarHBondContact O-N 3.32Å; K31-T34 WeakPolarHBondContact CA-OG1 3.39Å; K31-T34 PolarHBondContact O-N 3.32Å; K31-T34 PolarHBondContact O-OG1 3.07Å; K31-T34 VanDerWaalsContact O-OG1 3.04Å; K31-T35 HydrophobicContact CG-CG2 4.12Å; K31-T35 WeakPolarHBondContact O-CG2 3.48Å; K31-T35 PolarHBondContact O-N 3.13Å; K31-T35 PolarHBondContact O-OG1 3.33Å
32	F	74.1	Confident	73.4	Confident	108 Å²	108	88.6 Å²	88.6	47%	0.474	49%	0.485	S	S	.	.	H	α-helix	trans	-57.2	-48.3	177.3	-177.2	-93.5	0	0	0	111.5	F28 G29 T34 T36	F28-F32 WeakPolarHBondContact O-CB 3.42Å; F28-F32 PolarHBondContact O-N 3.47Å; G29-F32 WeakPolarHBondContact O-CB 3.28Å; G29-F32 PolarHBondContact O-N 3.15Å; F32-T34 VanDerWaalsContact C-N 3.33Å; F32-T34 PolarHBondContact O-N 2.88Å; F32-T36 HydrophobicContact CD2-CG2 4.39Å; F32-T36 HydrophobicContact CE1-CG2 4.28Å; F32-T36 HydrophobicContact CE2-CG2 4.04Å; F32-T36 HydrophobicContact CZ-CG2 3.99Å; F32-T36 WeakPolarHBondContact O-CB 3.32Å; F32-T36 PolarHBondContact O-N 3.28Å; F32-T36 PolarHBondContact O-OG1 3.34Å
33	F	66.9	Low	73.7	Confident	100 Å²	100	88.5 Å²	88.5	44%	0.439	49%	0.486	S	S	.	.	H	α-helix	trans	-70.1	-25.1	179.1	-72.8	-70.7	0	0	0	113.8	G29 I30 K31 V38 L44	G29-F33 WeakPolarHBondContact O-CD2 3.39Å; G29-F33 PolarHBondContact O-N 2.92Å; I30-F33 PolarHBondContact O-N 2.99Å; K31-F33 PolarHBondContact O-N 3.32Å; F33-V38 HydrophobicContact CB-CG2 4.5Å; F33-V38 HydrophobicContact CD1-CG2 4.17Å; F33-V38 VanDerWaalsContact O-CG2 3.29Å; F33-V38 WeakPolarHBondContact O-CG2 3.38Å; F33-L44 VanDerWaalsContact C-CD2 3.48Å; F33-L44 HydrophobicContact CB-CD1 3.56Å; F33-L44 HydrophobicContact CB-CD2 3.6Å; F33-L44 HydrophobicContact CB-CG 4.19Å; F33-L44 HydrophobicContact CD1-CD1 4.23Å; F33-L44 HydrophobicContact CG-CD1 3.93Å; F33-L44 WeakPolarHBondContact O-CD2 3.37Å
34	T	70.9	Confident	73.9	Confident	69 Å²	69	85.1 Å²	85.1	42%	0.423	46%	0.463	S	S	.	.	H	α-helix	trans	-87.2	-27	178.3	51.7	0	0	0	0	113.6	I30 K31 F32 L44	I30-T34 HydrophobicContact CG2-CG2 4.4Å; I30-T34 WeakPolarHBondContact O-CB 3.14Å; I30-T34 VanDerWaalsContact O-CG2 3.32Å; I30-T34 WeakPolarHBondContact O-CG2 3.49Å; I30-T34 PolarHBondContact O-N 3.29Å; I30-T34 PolarHBondContact O-OG1 2.87Å; K31-T34 WeakPolarHBondContact CA-OG1 3.39Å; K31-T34 PolarHBondContact O-N 3.32Å; K31-T34 PolarHBondContact O-OG1 3.07Å; K31-T34 VanDerWaalsContact O-OG1 3.04Å; F32-T34 VanDerWaalsContact C-N 3.33Å; F32-T34 PolarHBondContact O-N 2.88Å; T34-L44 HydrophobicContact CG2-CD2 4.22Å
35	T	75.1	Confident	74.2	Confident	98 Å²	98	82.3 Å²	82.3	60%	0.601	45%	0.453	S	S	*	.	H	α-helix	trans	-93.7	-26.8	178.6	59.5	0	0	0	0	114.1	K31	K31-T35 HydrophobicContact CG-CG2 4.12Å; K31-T35 WeakPolarHBondContact O-CG2 3.48Å; K31-T35 PolarHBondContact O-N 3.13Å; K31-T35 PolarHBondContact O-OG1 3.33Å
36	T	69	Low	74.5	Confident	51 Å²	51	87 Å²	87	31%	0.313	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.1	131.7	164.9	55.9	0	0	0	0	107.2	F32 V38	F32-T36 HydrophobicContact CD2-CG2 4.39Å; F32-T36 HydrophobicContact CE1-CG2 4.28Å; F32-T36 HydrophobicContact CE2-CG2 4.04Å; F32-T36 HydrophobicContact CZ-CG2 3.99Å; F32-T36 WeakPolarHBondContact O-CB 3.32Å; F32-T36 PolarHBondContact O-N 3.28Å; F32-T36 PolarHBondContact O-OG1 3.34Å; T36-V38 PolarHBondContact O-N 2.89Å
37	P	63.6	Low	75.3	Confident	127 Å²	127	89.7 Å²	89.7	83%	0.825	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.5	88.8	178.5	26.7	-32.3	0	0	0	108.6	P39	P37-P39 WeakPolarHBondContact O-CD 3.29Å
38	V	66	Low	75.7	Confident	47 Å²	47	88.7 Å²	88.7	29%	0.285	47%	0.473	S	S	.	.			trans	-64.4	121.4	162.9	177.6	0	0	0	0	104.8	F33 T36 N40 L44	F33-V38 HydrophobicContact CB-CG2 4.5Å; F33-V38 HydrophobicContact CD1-CG2 4.17Å; F33-V38 VanDerWaalsContact O-CG2 3.29Å; F33-V38 WeakPolarHBondContact O-CG2 3.38Å; T36-V38 PolarHBondContact O-N 2.89Å; V38-N40 PolarHBondContact O-N 3.44Å; V38-L44 HydrophobicContact CG1-CB 4.41Å; V38-L44 HydrophobicContact CG2-CD2 4.25Å
39	P	71.2	Confident	76.1	Confident	141 Å²	141	85.9 Å²	85.9	92%	0.916	46%	0.464	S	S	*	.	S	Bend	trans	-58.1	-9	-173.2	20.4	-32.2	0	0	0	113.5	P37	P37-P39 WeakPolarHBondContact O-CD 3.29Å
40	N	80.2	Confident	76.6	Confident	87 Å²	87	86.9 Å²	86.9	47%	0.465	48%	0.475	S	S	.	.			trans	-138.1	78.4	177.6	-161.9	-22.4	0	0	0	111.4	V38 G42 L43 L44	V38-N40 PolarHBondContact O-N 3.44Å; N40-G42 PolarHBondContact O-N 3.42Å; N40-L43 HydrophobicContact CB-CB 3.82Å; N40-L43 HydrophobicContact CB-CD2 4.49Å; N40-L43 VanDerWaalsContact CG-CB 3.44Å; N40-L43 WeakPolarHBondContact O-CB 3.44Å; N40-L43 PolarHBondContact O-N 3.35Å; N40-L43 PolarHBondContact OD1-N 2.87Å; N40-L44 PolarHBondContact O-N 3.44Å
41	K	74.5	Confident	77.1	Confident	140 Å²	140	87.3 Å²	87.3	61%	0.609	48%	0.478	S	S	*	.	H	α-helix	trans	-53.5	-37.7	176.2	-174.7	178	177.4	-178	0	112.6	L43 L44 D45	K41-L43 VanDerWaalsContact C-N 3.35Å; K41-L43 PolarHBondContact O-N 2.89Å; K41-L44 WeakPolarHBondContact O-CB 3.33Å; K41-L44 PolarHBondContact O-N 3.03Å; K41-D45 VanDerWaalsContact O-CG 3.31Å; K41-D45 PolarHBondContact O-N 2.96Å
42	G	79.8	Confident	77.6	Confident	39 Å²	39	87.8 Å²	87.8	40%	0.402	48%	0.477	S	S	.	.	H	α-helix	trans	-67.3	-31.5	177.1	0	0	0	0	0	114	N40 K46	N40-G42 PolarHBondContact O-N 3.42Å; G42-K46 WeakPolarHBondContact O-CG 3.4Å; G42-K46 PolarHBondContact O-N 3.28Å
43	L	85	Confident	77.9	Confident	90 Å²	90	87.9 Å²	87.9	47%	0.471	48%	0.478	S	S	.	.	H	α-helix	trans	-69.1	-42.7	170.4	178.5	66.4	0	0	0	110.8	N40 K41 K46 L47	N40-L43 HydrophobicContact CB-CB 3.82Å; N40-L43 HydrophobicContact CB-CD2 4.49Å; N40-L43 VanDerWaalsContact CG-CB 3.44Å; N40-L43 WeakPolarHBondContact O-CB 3.44Å; N40-L43 PolarHBondContact O-N 3.35Å; N40-L43 PolarHBondContact OD1-N 2.87Å; K41-L43 VanDerWaalsContact C-N 3.35Å; K41-L43 PolarHBondContact O-N 2.89Å; L43-K46 PolarHBondContact O-N 2.87Å; L43-L47 HydrophobicContact CG-CD1 4.26Å; L43-L47 WeakPolarHBondContact O-CG 3.42Å; L43-L47 PolarHBondContact O-N 3.04Å
44	L	82.2	Confident	78.7	Confident	11 Å²	11	88.9 Å²	88.9	6%	0.058	48%	0.483	C	S	.	.	H	α-helix	trans	-60.7	-48.8	177.2	174.9	66.6	0	0	0	111.7	F33 T34 V38 N40 K41 K46 L47 L48	F33-L44 VanDerWaalsContact C-CD2 3.48Å; F33-L44 HydrophobicContact CB-CD1 3.56Å; F33-L44 HydrophobicContact CB-CD2 3.6Å; F33-L44 HydrophobicContact CB-CG 4.19Å; F33-L44 HydrophobicContact CD1-CD1 4.23Å; F33-L44 HydrophobicContact CG-CD1 3.93Å; F33-L44 WeakPolarHBondContact O-CD2 3.37Å; T34-L44 HydrophobicContact CG2-CD2 4.22Å; V38-L44 HydrophobicContact CG1-CB 4.41Å; V38-L44 HydrophobicContact CG2-CD2 4.25Å; N40-L44 PolarHBondContact O-N 3.44Å; K41-L44 WeakPolarHBondContact O-CB 3.33Å; K41-L44 PolarHBondContact O-N 3.03Å; L44-K46 PolarHBondContact O-N 3.45Å; L44-L47 WeakPolarHBondContact O-CB 3.43Å; L44-L47 PolarHBondContact O-N 2.88Å; L44-L48 HydrophobicContact CD1-CD1 4.21Å; L44-L48 HydrophobicContact CD1-CG 4.08Å; L44-L48 HydrophobicContact CG-CD1 4.08Å; L44-L48 HydrophobicContact CG-CG 4.33Å; L44-L48 WeakPolarHBondContact O-CG 3.31Å; L44-L48 PolarHBondContact O-N 3.19Å
45	D	82.3	Confident	79.1	Confident	76 Å²	76	89.6 Å²	89.6	41%	0.406	48%	0.48	S	S	.	.	H	α-helix	trans	-58.7	-38.6	180	-68.1	-22.2	0	0	0	110.8	K41 L48 D49	K41-D45 VanDerWaalsContact O-CG 3.31Å; K41-D45 PolarHBondContact O-N 2.96Å; D45-L48 PolarHBondContact O-N 3.07Å; D45-D49 VanDerWaalsContact O-CB 3.29Å; D45-D49 WeakPolarHBondContact O-CB 3.08Å; D45-D49 PolarHBondContact O-N 3.41Å
46	K	83	Confident	79.3	Confident	158 Å²	158	89.9 Å²	89.9	69%	0.687	48%	0.478	S	S	*	.	H	α-helix	trans	-67.3	-37.8	173.7	-73.5	177.1	179.9	-176.6	0	113.5	G42 L43 L44 G50	G42-K46 WeakPolarHBondContact O-CG 3.4Å; G42-K46 PolarHBondContact O-N 3.28Å; L43-K46 PolarHBondContact O-N 2.87Å; L44-K46 PolarHBondContact O-N 3.45Å; K46-G50 PolarHBondContact O-N 3.43Å
47	L	83.9	Confident	79.5	Confident	106 Å²	106	97.7 Å²	97.7	56%	0.555	50%	0.502	S	S	*	.	H	α-helix	trans	-64.9	-44.6	174.9	-73.9	169.9	0	0	0	110.5	L43 L44 G50 L51	L43-L47 HydrophobicContact CG-CD1 4.26Å; L43-L47 WeakPolarHBondContact O-CG 3.42Å; L43-L47 PolarHBondContact O-N 3.04Å; L44-L47 WeakPolarHBondContact O-CB 3.43Å; L44-L47 PolarHBondContact O-N 2.88Å; L47-G50 PolarHBondContact O-N 3.04Å; L47-L51 WeakPolarHBondContact O-CB 3.32Å; L47-L51 VanDerWaalsContact O-CG 3.26Å; L47-L51 WeakPolarHBondContact O-CG 3.49Å; L47-L51 PolarHBondContact O-N 3Å
48	L	84	Confident	79.3	Confident	38 Å²	38	100.6 Å²	100.6	20%	0.199	50%	0.504	C	S	.	.	H	α-helix	trans	-65.7	-43.3	178.4	-67.6	179.8	0	0	0	112	I30 L44 D45 L51 Y52	I30-L48 HydrophobicContact CG1-CD1 4.36Å; I30-L48 HydrophobicContact CG1-CD2 3.93Å; I30-L48 HydrophobicContact CG2-CD1 4.03Å; L44-L48 HydrophobicContact CD1-CD1 4.21Å; L44-L48 HydrophobicContact CD1-CG 4.08Å; L44-L48 HydrophobicContact CG-CD1 4.08Å; L44-L48 HydrophobicContact CG-CG 4.33Å; L44-L48 WeakPolarHBondContact O-CG 3.31Å; L44-L48 PolarHBondContact O-N 3.19Å; D45-L48 PolarHBondContact O-N 3.07Å; L48-L51 PolarHBondContact O-N 2.88Å; L48-Y52 WeakPolarHBondContact O-CB 3.5Å; L48-Y52 PolarHBondContact O-N 3.22Å
49	D	85.5	Confident	80	Confident	83 Å²	83	103.3 Å²	103.3	44%	0.444	52%	0.515	S	S	.	.	H	α-helix	trans	-63.1	-42.1	174.7	-176.6	39	0	0	0	111.5	D45 L51 Y52 Q53	D45-D49 VanDerWaalsContact O-CB 3.29Å; D45-D49 WeakPolarHBondContact O-CB 3.08Å; D45-D49 PolarHBondContact O-N 3.41Å; D49-L51 PolarHBondContact O-N 2.96Å; D49-Y52 PolarHBondContact O-N 3.4Å; D49-Q53 WeakPolarHBondContact O-CB 3.43Å; D49-Q53 WeakPolarHBondContact O-CG 3.37Å; D49-Q53 PolarHBondContact O-N 3.04Å; D49-Q53 PolarHBondContact OD1-NE2 3.28Å; D49-Q53 VanDerWaalsContact OD1-NE2 3.07Å; D49-Q53 PolarHBondContact OD2-NE2 3.07Å
50	G	84	Confident	80.5	Confident	38 Å²	38	101.3 Å²	101.3	39%	0.392	49%	0.494	S	S	.	.	H	α-helix	trans	-62.8	-40.8	174.7	0	0	0	0	0	113.3	K46 L47 F54	K46-G50 PolarHBondContact O-N 3.43Å; L47-G50 PolarHBondContact O-N 3.04Å; G50-F54 WeakPolarHBondContact O-CB 3.29Å; G50-F54 PolarHBondContact O-N 3.25Å
51	L	84.9	Confident	80.5	Confident	88 Å²	88	102.1 Å²	102.1	46%	0.461	50%	0.495	S	S	.	.	H	α-helix	trans	-64.6	-46.6	173.6	-72.4	172.3	0	0	0	110.9	L47 L48 D49 Q53 F54 F55	L47-L51 WeakPolarHBondContact O-CB 3.32Å; L47-L51 VanDerWaalsContact O-CG 3.26Å; L47-L51 WeakPolarHBondContact O-CG 3.49Å; L47-L51 PolarHBondContact O-N 3Å; L48-L51 PolarHBondContact O-N 2.88Å; D49-L51 PolarHBondContact O-N 2.96Å; L51-Q53 PolarHBondContact O-N 2.84Å; L51-F54 WeakPolarHBondContact O-CB 3.29Å; L51-F54 PolarHBondContact O-N 2.77Å; L51-F54 VanDerWaalsContact O-N 3.16Å; L51-F55 HydrophobicContact CB-CE2 4.37Å; L51-F55 HydrophobicContact CD2-CE2 4.5Å; L51-F55 WeakPolarHBondContact O-CD2 3.09Å; L51-F55 PolarHBondContact O-N 2.69Å
52	Y	82.6	Confident	80.8	Confident	149 Å²	149	99.9 Å²	99.9	58%	0.584	49%	0.489	S	S	*	.	H	α-helix	trans	-59.3	-45.5	177.8	-178	-106.4	0	0	0	111.9	L48 D49 F54 F55 N56	L48-Y52 WeakPolarHBondContact O-CB 3.5Å; L48-Y52 PolarHBondContact O-N 3.22Å; D49-Y52 PolarHBondContact O-N 3.4Å; Y52-F54 VanDerWaalsContact C-N 3.35Å; Y52-F54 PolarHBondContact O-N 2.72Å; Y52-F55 PolarHBondContact O-N 3.01Å; Y52-N56 WeakPolarHBondContact CE1-ND2 3.47Å; Y52-N56 WeakPolarHBondContact O-CB 3.44Å; Y52-N56 PolarHBondContact O-N 3.43Å; Y52-N56 PolarHBondContact OH-ND2 3.19Å
53	Q	81.3	Confident	80.9	Confident	109 Å²	109	103.7 Å²	103.7	51%	0.509	49%	0.494	S	S	.	.	H	α-helix	trans	-65.7	-35.7	175.2	-71.9	179.3	47.6	0	0	112.6	D49 L51 N56 R57	D49-Q53 WeakPolarHBondContact O-CB 3.43Å; D49-Q53 WeakPolarHBondContact O-CG 3.37Å; D49-Q53 PolarHBondContact O-N 3.04Å; D49-Q53 PolarHBondContact OD1-NE2 3.28Å; D49-Q53 VanDerWaalsContact OD1-NE2 3.07Å; D49-Q53 PolarHBondContact OD2-NE2 3.07Å; L51-Q53 PolarHBondContact O-N 2.84Å; Q53-N56 PolarHBondContact O-N 2.94Å; Q53-R57 WeakPolarHBondContact O-CB 3.45Å; Q53-R57 PolarHBondContact O-N 2.95Å
54	F	83.2	Confident	80.6	Confident	122 Å²	122	104.6 Å²	104.6	54%	0.535	50%	0.496	S	S	.	.	H	α-helix	trans	-62.2	-45.3	175.3	179.7	-95.9	0	0	0	111.3	G50 L51 Y52 H58	G50-F54 WeakPolarHBondContact O-CB 3.29Å; G50-F54 PolarHBondContact O-N 3.25Å; L51-F54 WeakPolarHBondContact O-CB 3.29Å; L51-F54 PolarHBondContact O-N 2.77Å; L51-F54 VanDerWaalsContact O-N 3.16Å; Y52-F54 VanDerWaalsContact C-N 3.35Å; Y52-F54 PolarHBondContact O-N 2.72Å; F54-H58 AromaticContact CE2-NE2 3.95Å; F54-H58 PolarHBondContact O-CD2 2.92Å
55	F	80.2	Confident	80.5	Confident	83 Å²	83	111.3 Å²	111.3	36%	0.364	53%	0.527	S	S	.	.	H	α-helix	trans	-73.6	-32.3	177.9	-66.5	-65.9	0	0	0	113.5	V20 L51 Y52 R57	V20-F55 HydrophobicContact CG2-CE1 4.08Å; L51-F55 HydrophobicContact CB-CE2 4.37Å; L51-F55 HydrophobicContact CD2-CE2 4.5Å; L51-F55 WeakPolarHBondContact O-CD2 3.09Å; L51-F55 PolarHBondContact O-N 2.69Å; Y52-F55 PolarHBondContact O-N 3.01Å; F55-R57 VanDerWaalsContact C-N 3.33Å
56	N	79.2	Confident	80.4	Confident	104 Å²	104	114 Å²	114	56%	0.556	54%	0.536	S	S	*	.	H	α-helix	trans	-80.7	-12.2	176.3	-84.7	-1.5	0	0	0	114	Y52 Q53	Y52-N56 WeakPolarHBondContact CE1-ND2 3.47Å; Y52-N56 WeakPolarHBondContact O-CB 3.44Å; Y52-N56 PolarHBondContact O-N 3.43Å; Y52-N56 PolarHBondContact OH-ND2 3.19Å; Q53-N56 PolarHBondContact O-N 2.94Å
57	R	74.1	Confident	80.2	Confident	216 Å²	216	110.3 Å²	110.3	82%	0.815	52%	0.524	S	S	*	.	H	α-helix	trans	-85.3	-21.2	175.1	-178.1	172.6	-174.1	177.7	2.7	112.3	Q53 F55	Q53-R57 WeakPolarHBondContact O-CB 3.45Å; Q53-R57 PolarHBondContact O-N 2.95Å; F55-R57 VanDerWaalsContact C-N 3.33Å
58	H	59.1	Low	79.8	Confident	188 Å²	188	110.7 Å²	110.7	87%	0.87	52%	0.521	S	S	*	.			trans	-104.6	0	177.8	-75.2	-63.5	0	0	0	110.4	F54	F54-H58 AromaticContact CE2-NE2 3.95Å; F54-H58 PolarHBondContact O-CD2 2.92Å

Retrieved 58 of 58 residues in 209.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).