A0A146MFR6_SCHMA Loading...

V-type proton ATPase subunit

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane.

AlphaFold DB , UniProt , Accession A0A146MFR6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 84 aa.

						>A0A146MFR6_SCHMA|A0A146MFR6
MNESVGFYIPLGVVSAFWFLVGFLGPVFVPKGPNKMLLSVSIVLTAVCCYLFWIGFYLAQYHPFFGPSLKTGSIRIIQQQWTRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.4	Low	84.2	Confident	186 Å²	186	87 Å²	87	92%	0.916	46%	0.459	S	S	*	.				0	135.6	0	-72.2	162.8	58.2	0	0	106.3	E3 I9	M1-E3 PolarHBondContact O-N 3.45Å; M1-E3 VanDerWaalsContact O-N 3.15Å; M1-I9 HydrophobicContact CE-CD1 4.49Å
2	N	72.7	Confident	85.2	Confident	120 Å²	120	83.3 Å²	83.3	64%	0.642	46%	0.457	S	S	*	.			trans	-56.8	123.9	178.1	-59.2	-15.6	0	0	0	107.7	S4 V5	N2-S4 PolarHBondContact O-N 3.42Å; N2-V5 HydrophobicContact CB-CB 4.48Å; N2-V5 HydrophobicContact CB-CG2 3.91Å; N2-V5 WeakPolarHBondContact O-CA 3.48Å; N2-V5 WeakPolarHBondContact O-CB 3.42Å; N2-V5 PolarHBondContact O-N 3.02Å
3	E	71.9	Confident	86.1	Confident	177 Å²	177	84.2 Å²	84.2	83%	0.827	47%	0.467	S	S	*	.	H	α-helix	trans	-48.8	-33	-177	-64.5	-62.9	141.5	0	0	112.1	M1 G6	M1-E3 PolarHBondContact O-N 3.45Å; M1-E3 VanDerWaalsContact O-N 3.15Å; E3-G6 PolarHBondContact O-N 3.1Å
4	S	79	Confident	86.9	Confident	51 Å²	51	80.4 Å²	80.4	36%	0.357	45%	0.447	S	S	.	.	H	α-helix	trans	-61.1	-41.6	173.3	53.6	0	0	0	0	114	N2 G6 F7 Y8	N2-S4 PolarHBondContact O-N 3.42Å; S4-G6 VanDerWaalsContact C-N 3.34Å; S4-G6 PolarHBondContact O-N 2.98Å; S4-F7 WeakPolarHBondContact O-CB 3.47Å; S4-F7 PolarHBondContact O-N 2.91Å; S4-Y8 WeakPolarHBondContact O-CD2 3.32Å; S4-Y8 PolarHBondContact O-N 3.25Å
5	V	88.2	Confident	87.6	Confident	62 Å²	62	76.9 Å²	76.9	38%	0.376	43%	0.43	S	S	.	.	H	α-helix	trans	-64.8	-40.1	-178.9	173.7	0	0	0	0	110.8	N2 F7 Y8 I9	N2-V5 HydrophobicContact CB-CB 4.48Å; N2-V5 HydrophobicContact CB-CG2 3.91Å; N2-V5 WeakPolarHBondContact O-CA 3.48Å; N2-V5 WeakPolarHBondContact O-CB 3.42Å; N2-V5 PolarHBondContact O-N 3.02Å; V5-F7 PolarHBondContact O-N 3.48Å; V5-Y8 PolarHBondContact O-N 3.46Å; V5-I9 HydrophobicContact CG1-CD1 3.72Å; V5-I9 HydrophobicContact CG1-CG1 4.15Å; V5-I9 WeakPolarHBondContact O-CD1 3.31Å; V5-I9 VanDerWaalsContact O-CG1 3.24Å; V5-I9 WeakPolarHBondContact O-CG1 3.49Å; V5-I9 PolarHBondContact O-N 3.16Å
6	G	89.7	Confident	88.2	Confident	39 Å²	39	75.8 Å²	75.8	40%	0.402	43%	0.433	S	S	.	.	H	α-helix	trans	-60.1	-31.2	177.1	0	0	0	0	0	113.1	E3 S4 P10	E3-G6 PolarHBondContact O-N 3.1Å; S4-G6 VanDerWaalsContact C-N 3.34Å; S4-G6 PolarHBondContact O-N 2.98Å; G6-P10 WeakPolarHBondContact O-CD 3.39Å
7	F	91.6	Very high	88.8	Confident	25 Å²	25	78.1 Å²	78.1	11%	0.11	44%	0.438	C	S	.	.	H	α-helix	trans	-78.2	-42.4	175	179.2	-99.7	0	0	0	113.1	S4 V5 I9 P10 L11 Y57 L58 Y61	S4-F7 WeakPolarHBondContact O-CB 3.47Å; S4-F7 PolarHBondContact O-N 2.91Å; V5-F7 PolarHBondContact O-N 3.48Å; F7-I9 PolarHBondContact O-N 2.93Å; F7-P10 WeakPolarHBondContact O-CD 3.31Å; F7-P10 WeakPolarHBondContact O-CG 3.26Å; F7-L11 HydrophobicContact CE1-CD2 4.46Å; F7-Y57 WeakPolarHBondContact CA-OH 3.35Å; F7-Y57 HydrophobicContact CD2-CD1 4.49Å; F7-Y57 AromaticContact CD2-CE1 3.49Å; F7-Y57 HydrophobicContact CD2-CE1 3.49Å; F7-Y57 VanDerWaalsContact CD2-CE1 3.49Å; F7-Y57 AromaticContact CD2-CZ 3.6Å; F7-Y57 WeakPolarHBondContact CD2-OH 3.5Å; F7-Y57 HydrophobicContact CE1-CE1 4.37Å; F7-Y57 AromaticContact CE2-CD1 3.81Å; F7-Y57 HydrophobicContact CE2-CD1 3.81Å; F7-Y57 AromaticContact CE2-CE1 3.19Å; F7-Y57 HydrophobicContact CE2-CE1 3.19Å; F7-Y57 AromaticContact CE2-CZ 3.72Å; F7-Y57 HydrophobicContact CG-CE1 4.21Å; F7-Y57 HydrophobicContact CZ-CD1 4.14Å; F7-Y57 AromaticContact CZ-CE1 3.71Å; F7-Y57 HydrophobicContact CZ-CE1 3.71Å; F7-Y57 PolarHBondContact O-OH 2.89Å; F7-L58 HydrophobicContact CZ-CD2 3.85Å; F7-Y61 HydrophobicContact CB-CD2 4.43Å; F7-Y61 HydrophobicContact CB-CE2 3.95Å; F7-Y61 AromaticContact CD1-CD2 3.83Å; F7-Y61 HydrophobicContact CD1-CD2 3.83Å; F7-Y61 AromaticContact CD1-CE2 3.41Å; F7-Y61 HydrophobicContact CD1-CE2 3.41Å; F7-Y61 VanDerWaalsContact CD1-CE2 3.41Å; F7-Y61 AromaticContact CD1-CZ 3.99Å; F7-Y61 AromaticContact CD2-CD2 3.2Å; F7-Y61 HydrophobicContact CD2-CD2 3.2Å; F7-Y61 AromaticContact CD2-CE2 3.56Å; F7-Y61 HydrophobicContact CD2-CE2 3.56Å; F7-Y61 HydrophobicContact CD2-CG 4.17Å; F7-Y61 HydrophobicContact CE1-CD1 4.5Å; F7-Y61 AromaticContact CE1-CD2 3.73Å; F7-Y61 HydrophobicContact CE1-CD2 3.73Å; F7-Y61 HydrophobicContact CE1-CE1 4.44Å; F7-Y61 AromaticContact CE1-CE2 3.64Å; F7-Y61 HydrophobicContact CE1-CE2 3.64Å; F7-Y61 HydrophobicContact CE1-CG 4.15Å; F7-Y61 AromaticContact CE2-CD2 3.09Å; F7-Y61 HydrophobicContact CE2-CD2 3.09Å; F7-Y61 AromaticContact CE2-CE2 3.79Å; F7-Y61 HydrophobicContact CE2-CE2 3.79Å; F7-Y61 AromaticContact CE2-CG 3.6Å; F7-Y61 HydrophobicContact CE2-CG 3.6Å; F7-Y61 AromaticContact CG-CD2 3.56Å; F7-Y61 HydrophobicContact CG-CD2 3.56Å; F7-Y61 AromaticContact CG-CE2 3.35Å; F7-Y61 HydrophobicContact CG-CE2 3.35Å; F7-Y61 HydrophobicContact CZ-CD1 4.2Å; F7-Y61 AromaticContact CZ-CD2 3.35Å; F7-Y61 HydrophobicContact CZ-CD2 3.35Å; F7-Y61 AromaticContact CZ-CE2 3.8Å; F7-Y61 HydrophobicContact CZ-CE2 3.8Å; F7-Y61 AromaticContact CZ-CG 3.56Å; F7-Y61 HydrophobicContact CZ-CG 3.56Å
8	Y	94	Very high	89.3	Confident	129 Å²	129	76.8 Å²	76.8	51%	0.506	43%	0.425	S	S	.	.	H	α-helix	trans	-73.6	-26.1	-176.4	-65.8	-57.8	0	0	0	114	S4 V5 L11 G12	S4-Y8 WeakPolarHBondContact O-CD2 3.32Å; S4-Y8 PolarHBondContact O-N 3.25Å; V5-Y8 PolarHBondContact O-N 3.46Å; Y8-L11 HydrophobicContact CD1-CD2 4.05Å; Y8-L11 PolarHBondContact O-N 2.87Å; Y8-G12 PolarHBondContact O-N 3.49Å
9	I	94.9	Very high	89.7	Confident	89 Å²	89	80.7 Å²	80.7	46%	0.456	44%	0.437	S	S	.	.	H	α-helix	trans	-57.7	-60.7	177	-70.7	162.5	0	0	0	112.2	M1 V5 F7 L11 G12 V13	M1-I9 HydrophobicContact CE-CD1 4.49Å; V5-I9 HydrophobicContact CG1-CD1 3.72Å; V5-I9 HydrophobicContact CG1-CG1 4.15Å; V5-I9 WeakPolarHBondContact O-CD1 3.31Å; V5-I9 VanDerWaalsContact O-CG1 3.24Å; V5-I9 WeakPolarHBondContact O-CG1 3.49Å; V5-I9 PolarHBondContact O-N 3.16Å; F7-I9 PolarHBondContact O-N 2.93Å; I9-L11 VanDerWaalsContact C-N 3.27Å; I9-L11 PolarHBondContact O-N 3.46Å; I9-G12 PolarHBondContact O-N 3.23Å; I9-V13 HydrophobicContact CG2-CG2 4.43Å; I9-V13 WeakPolarHBondContact O-CG2 3.03Å; I9-V13 PolarHBondContact O-N 2.99Å
10	P	95.3	Very high	90	Very high	39 Å²	39	81.3 Å²	81.3	25%	0.253	44%	0.44	S	S	.	.	H	α-helix	trans	-64	-33.8	179.5	27	-37.1	0	0	0	111.9	G6 F7 G12 V13 V14 W53 Y57	G6-P10 WeakPolarHBondContact O-CD 3.39Å; F7-P10 WeakPolarHBondContact O-CD 3.31Å; F7-P10 WeakPolarHBondContact O-CG 3.26Å; P10-G12 PolarHBondContact O-N 3.42Å; P10-V13 PolarHBondContact O-N 3.48Å; P10-V14 WeakPolarHBondContact O-CB 3.36Å; P10-V14 VanDerWaalsContact O-CG2 3.31Å; P10-V14 WeakPolarHBondContact O-CG2 3.18Å; P10-V14 PolarHBondContact O-N 3.42Å; P10-W53 HydrophobicContact CB-CZ2 4.49Å; P10-Y57 HydrophobicContact CB-CE2 4.39Å; P10-Y57 HydrophobicContact CG-CE1 4.32Å; P10-Y57 HydrophobicContact CG-CE2 3.98Å; P10-Y57 WeakPolarHBondContact CG-OH 3.29Å
11	L	95.5	Very high	90.4	Very high	40 Å²	40	79.4 Å²	79.4	21%	0.209	43%	0.431	C	S	.	.	H	α-helix	trans	-55.5	-51.2	172.6	-170.3	73.4	0	0	0	112.1	F7 Y8 I9 S15 W53 I54 Y57	F7-L11 HydrophobicContact CE1-CD2 4.46Å; Y8-L11 HydrophobicContact CD1-CD2 4.05Å; Y8-L11 PolarHBondContact O-N 2.87Å; I9-L11 VanDerWaalsContact C-N 3.27Å; I9-L11 PolarHBondContact O-N 3.46Å; L11-S15 WeakPolarHBondContact O-CB 3.49Å; L11-S15 PolarHBondContact O-N 3.45Å; L11-S15 VanDerWaalsContact O-N 3.16Å; L11-S15 PolarHBondContact O-OG 3.11Å; L11-W53 HydrophobicContact CD1-CH2 4.26Å; L11-W53 HydrophobicContact CD1-CZ3 4.17Å; L11-I54 HydrophobicContact CD1-CD1 3.26Å; L11-Y57 HydrophobicContact CB-CE1 4.35Å; L11-Y57 HydrophobicContact CD1-CD1 4.28Å
12	G	96.2	Very high	92.4	Very high	42 Å²	42	71.4 Å²	71.4	43%	0.433	40%	0.396	S	S	.	.	H	α-helix	trans	-64.9	-49.2	177.9	0	0	0	0	0	112.5	Y8 I9 P10 A16	Y8-G12 PolarHBondContact O-N 3.49Å; I9-G12 PolarHBondContact O-N 3.23Å; P10-G12 PolarHBondContact O-N 3.42Å; G12-A16 VanDerWaalsContact O-CB 3.27Å; G12-A16 WeakPolarHBondContact O-CB 3.4Å; G12-A16 PolarHBondContact O-N 3Å
13	V	97.4	Very high	93.5	Very high	96 Å²	96	71.9 Å²	71.9	58%	0.582	39%	0.392	S	S	*	.	H	α-helix	trans	-63.2	-48.4	-175.7	172.9	0	0	0	0	111.8	I9 P10 A16 F17	I9-V13 HydrophobicContact CG2-CG2 4.43Å; I9-V13 WeakPolarHBondContact O-CG2 3.03Å; I9-V13 PolarHBondContact O-N 2.99Å; P10-V13 PolarHBondContact O-N 3.48Å; V13-A16 PolarHBondContact O-N 2.98Å; V13-F17 WeakPolarHBondContact O-CB 3.38Å; V13-F17 PolarHBondContact O-N 2.9Å
14	V	97.1	Very high	94.6	Very high	31 Å²	31	66.3 Å²	66.3	19%	0.188	37%	0.368	C	S	.	.	H	α-helix	trans	-73.6	-35.4	-176.5	-178.8	0	0	0	0	111.5	P10 F17 W18 W53	P10-V14 WeakPolarHBondContact O-CB 3.36Å; P10-V14 VanDerWaalsContact O-CG2 3.31Å; P10-V14 WeakPolarHBondContact O-CG2 3.18Å; P10-V14 PolarHBondContact O-N 3.42Å; V14-F17 PolarHBondContact O-N 3.47Å; V14-W18 PolarHBondContact O-N 2.76Å; V14-W53 HydrophobicContact CB-CD2 3.98Å; V14-W53 HydrophobicContact CB-CE3 4.05Å; V14-W53 HydrophobicContact CB-CH2 3.82Å; V14-W53 HydrophobicContact CB-CZ2 3.66Å; V14-W53 HydrophobicContact CB-CZ3 3.97Å; V14-W53 HydrophobicContact CG1-CD2 3.36Å; V14-W53 HydrophobicContact CG1-CE3 3.62Å; V14-W53 HydrophobicContact CG1-CG 3.81Å; V14-W53 HydrophobicContact CG1-CH2 4.29Å; V14-W53 HydrophobicContact CG1-CZ2 4.01Å; V14-W53 HydrophobicContact CG1-CZ3 4.08Å; V14-W53 HydrophobicContact CG2-CD2 4.47Å; V14-W53 HydrophobicContact CG2-CH2 4.25Å; V14-W53 HydrophobicContact CG2-CZ2 3.64Å
15	S	96.9	Very high	95.3	Very high	28 Å²	28	64.8 Å²	64.8	20%	0.196	36%	0.36	C	S	.	.	H	α-helix	trans	-63.6	-45.2	172.9	-57.3	0	0	0	0	111.5	L11 F17 W18 F19 Y50	L11-S15 WeakPolarHBondContact O-CB 3.49Å; L11-S15 PolarHBondContact O-N 3.45Å; L11-S15 VanDerWaalsContact O-N 3.16Å; L11-S15 PolarHBondContact O-OG 3.11Å; S15-F17 VanDerWaalsContact C-N 3.34Å; S15-F17 PolarHBondContact O-N 3.31Å; S15-W18 PolarHBondContact O-N 3.45Å; S15-F19 WeakPolarHBondContact O-CB 3.49Å; S15-F19 PolarHBondContact O-N 2.98Å; S15-Y50 VanDerWaalsContact OG-CE2 3.29Å; S15-Y50 WeakPolarHBondContact OG-CE2 3.33Å; S15-Y50 PolarHBondContact OG-OH 2.91Å
16	A	97.6	Very high	95.5	Very high	58 Å²	58	63.1 Å²	63.1	48%	0.479	35%	0.351	S	S	.	.	H	α-helix	trans	-62.5	-41	176.8	0	0	0	0	0	111.9	G12 V13 L20	G12-A16 VanDerWaalsContact O-CB 3.27Å; G12-A16 WeakPolarHBondContact O-CB 3.4Å; G12-A16 PolarHBondContact O-N 3Å; V13-A16 PolarHBondContact O-N 2.98Å; A16-L20 VanDerWaalsContact O-CB 3.23Å; A16-L20 WeakPolarHBondContact O-CB 2.9Å; A16-L20 PolarHBondContact O-N 3.06Å
17	F	97.9	Very high	95.8	Very high	116 Å²	116	66 Å²	66	51%	0.509	36%	0.36	S	S	.	.	H	α-helix	trans	-59.4	-53.9	176.5	174.9	-97.8	0	0	0	112	V13 V14 S15 F19 L20 V21	V13-F17 WeakPolarHBondContact O-CB 3.38Å; V13-F17 PolarHBondContact O-N 2.9Å; V14-F17 PolarHBondContact O-N 3.47Å; S15-F17 VanDerWaalsContact C-N 3.34Å; S15-F17 PolarHBondContact O-N 3.31Å; F17-F19 PolarHBondContact O-N 3.19Å; F17-L20 PolarHBondContact O-N 3.45Å; F17-V21 HydrophobicContact CD1-CG2 4.48Å; F17-V21 HydrophobicContact CE1-CG2 4.09Å; F17-V21 HydrophobicContact CE2-CG2 4.25Å; F17-V21 HydrophobicContact CZ-CG2 3.97Å; F17-V21 WeakPolarHBondContact O-CG2 3.27Å; F17-V21 PolarHBondContact O-N 3.17Å
18	W	97.7	Very high	95.8	Very high	55 Å²	55	72.4 Å²	72.4	21%	0.208	39%	0.388	C	S	.	.	H	α-helix	trans	-70.5	-33	-178.4	-75.5	115.5	0	0	0	113.2	V14 S15 V21 G22 A46 C49 Y50	V14-W18 PolarHBondContact O-N 2.76Å; S15-W18 PolarHBondContact O-N 3.45Å; W18-V21 HydrophobicContact CE3-CB 4.22Å; W18-V21 HydrophobicContact CE3-CG1 4.24Å; W18-V21 HydrophobicContact CZ3-CG1 4.22Å; W18-V21 PolarHBondContact O-N 2.97Å; W18-G22 PolarHBondContact O-N 3.15Å; W18-A46 HydrophobicContact CE3-CB 4Å; W18-C49 HydrophobicContact CD2-CB 4.06Å; W18-C49 HydrophobicContact CE3-CB 4.12Å; W18-C49 HydrophobicContact CH2-CB 3.4Å; W18-C49 HydrophobicContact CZ2-CB 3.33Å; W18-C49 HydrophobicContact CZ3-CB 3.8Å; W18-Y50 HydrophobicContact CB-CD2 4.13Å; W18-Y50 HydrophobicContact CB-CG 4.39Å; W18-Y50 HydrophobicContact CG-CD2 4.42Å
19	F	96.6	Very high	95.8	Very high	151 Å²	151	66.9 Å²	66.9	66%	0.662	37%	0.368	S	S	*	.	H	α-helix	trans	-60.4	-46.1	170.7	179.9	-97.8	0	0	0	111.2	S15 F17 G22 F23	S15-F19 WeakPolarHBondContact O-CB 3.49Å; S15-F19 PolarHBondContact O-N 2.98Å; F17-F19 PolarHBondContact O-N 3.19Å; F19-G22 PolarHBondContact O-N 2.95Å; F19-F23 VanDerWaalsContact O-CB 3.23Å; F19-F23 WeakPolarHBondContact O-CB 3.18Å; F19-F23 PolarHBondContact O-N 3.38Å
20	L	97.4	Very high	95.7	Very high	92 Å²	92	67.4 Å²	67.4	48%	0.482	38%	0.377	S	S	.	.	H	α-helix	trans	-62.6	-44.1	176.8	-176.4	152.5	0	0	0	111.4	A16 F17 F23 L24	A16-L20 VanDerWaalsContact O-CB 3.23Å; A16-L20 WeakPolarHBondContact O-CB 2.9Å; A16-L20 PolarHBondContact O-N 3.06Å; F17-L20 PolarHBondContact O-N 3.45Å; L20-F23 PolarHBondContact O-N 3.4Å; L20-L24 HydrophobicContact CD1-CD1 4.02Å; L20-L24 HydrophobicContact CD2-CB 4.42Å; L20-L24 HydrophobicContact CD2-CD1 3.69Å; L20-L24 HydrophobicContact CD2-CG 4.3Å; L20-L24 HydrophobicContact CG-CD1 3.55Å; L20-L24 HydrophobicContact CG-CG 4.03Å; L20-L24 WeakPolarHBondContact O-CA 3.18Å; L20-L24 VanDerWaalsContact O-CB 3.23Å; L20-L24 WeakPolarHBondContact O-CB 3.33Å; L20-L24 PolarHBondContact O-N 3.3Å
21	V	96.6	Very high	95.5	Very high	41 Å²	41	75.1 Å²	75.1	25%	0.248	41%	0.407	C	S	.	.	H	α-helix	trans	-62	-45.9	176.5	172.8	0	0	0	0	111.3	F17 W18 F23 G25 A46	F17-V21 HydrophobicContact CD1-CG2 4.48Å; F17-V21 HydrophobicContact CE1-CG2 4.09Å; F17-V21 HydrophobicContact CE2-CG2 4.25Å; F17-V21 HydrophobicContact CZ-CG2 3.97Å; F17-V21 WeakPolarHBondContact O-CG2 3.27Å; F17-V21 PolarHBondContact O-N 3.17Å; W18-V21 HydrophobicContact CE3-CB 4.22Å; W18-V21 HydrophobicContact CE3-CG1 4.24Å; W18-V21 HydrophobicContact CZ3-CG1 4.22Å; W18-V21 PolarHBondContact O-N 2.97Å; V21-F23 VanDerWaalsContact C-N 3.34Å; V21-F23 PolarHBondContact O-N 3.32Å; V21-G25 VanDerWaalsContact O-CA 3.28Å; V21-G25 WeakPolarHBondContact O-CA 3.47Å; V21-G25 PolarHBondContact O-N 3.11Å; V21-A46 HydrophobicContact CG1-CB 4.26Å
22	G	96	Very high	95.4	Very high	18 Å²	18	75.1 Å²	75.1	19%	0.186	42%	0.417	C	S	.	.	H	α-helix	trans	-68.1	-30.7	179.5	0	0	0	0	0	113.7	W18 F19 P26	W18-G22 PolarHBondContact O-N 3.15Å; F19-G22 PolarHBondContact O-N 2.95Å; G22-P26 WeakPolarHBondContact O-CD 3.41Å; G22-P26 VanDerWaalsContact O-CG 3.29Å; G22-P26 WeakPolarHBondContact O-CG 3.44Å
23	F	95.2	Very high	95.3	Very high	130 Å²	130	79.6 Å²	79.6	57%	0.57	44%	0.438	S	S	*	.	H	α-helix	trans	-89	-53.4	-179.6	-175	-101.1	0	0	0	112.9	F19 L20 V21 V27	F19-F23 VanDerWaalsContact O-CB 3.23Å; F19-F23 WeakPolarHBondContact O-CB 3.18Å; F19-F23 PolarHBondContact O-N 3.38Å; L20-F23 PolarHBondContact O-N 3.4Å; V21-F23 VanDerWaalsContact C-N 3.34Å; V21-F23 PolarHBondContact O-N 3.32Å; F23-V27 WeakPolarHBondContact O-CG2 3.28Å
24	L	95.5	Very high	95.2	Very high	60 Å²	60	80 Å²	80	31%	0.314	44%	0.437	S	S	.	.	H	α-helix	trans	-75.4	-32.7	-178.3	-65.8	-171.6	0	0	0	112.5	L20 V27 F28	L20-L24 HydrophobicContact CD1-CD1 4.02Å; L20-L24 HydrophobicContact CD2-CB 4.42Å; L20-L24 HydrophobicContact CD2-CD1 3.69Å; L20-L24 HydrophobicContact CD2-CG 4.3Å; L20-L24 HydrophobicContact CG-CD1 3.55Å; L20-L24 HydrophobicContact CG-CG 4.03Å; L20-L24 WeakPolarHBondContact O-CA 3.18Å; L20-L24 VanDerWaalsContact O-CB 3.23Å; L20-L24 WeakPolarHBondContact O-CB 3.33Å; L20-L24 PolarHBondContact O-N 3.3Å; L24-V27 WeakPolarHBondContact O-CB 3.03Å; L24-V27 PolarHBondContact O-N 3.49Å; L24-F28 HydrophobicContact CB-CD2 4.11Å; L24-F28 HydrophobicContact CB-CE2 3.89Å; L24-F28 HydrophobicContact CD1-CE2 4.32Å; L24-F28 HydrophobicContact CD2-CE2 4.47Å; L24-F28 HydrophobicContact CG-CE2 4.47Å; L24-F28 WeakPolarHBondContact O-CD2 3.2Å; L24-F28 PolarHBondContact O-N 3.38Å; L24-F28 VanDerWaalsContact O-N 3.13Å
25	G	93.8	Very high	95	Very high	19 Å²	19	82.8 Å²	82.8	20%	0.196	45%	0.447	C	S	.	.	H	α-helix	trans	-52.8	-53.8	-179.3	0	0	0	0	0	113	V21 V27 F28 V29	V21-G25 VanDerWaalsContact O-CA 3.28Å; V21-G25 WeakPolarHBondContact O-CA 3.47Å; V21-G25 PolarHBondContact O-N 3.11Å; G25-V27 VanDerWaalsContact C-N 3.28Å; G25-V27 PolarHBondContact O-N 3.47Å; G25-F28 PolarHBondContact O-N 3Å; G25-V29 WeakPolarHBondContact O-CG2 3.35Å; G25-V29 PolarHBondContact O-N 3.14Å
26	P	93.4	Very high	94.9	Very high	27 Å²	27	88.6 Å²	88.6	18%	0.175	47%	0.473	C	S	.	.	H	α-helix	trans	-60.5	-30.5	175.1	-28	37.7	0	0	0	115	G22 V29 V43	G22-P26 WeakPolarHBondContact O-CD 3.41Å; G22-P26 VanDerWaalsContact O-CG 3.29Å; G22-P26 WeakPolarHBondContact O-CG 3.44Å; P26-V29 PolarHBondContact O-N 2.84Å; P26-V43 HydrophobicContact CG-CG2 3.46Å; P26-V43 VanDerWaalsContact CG-CG2 3.46Å
27	V	94.3	Very high	94.8	Very high	99 Å²	99	91.7 Å²	91.7	60%	0.6	48%	0.481	S	S	*	.	H	α-helix	trans	-68.6	-36.8	179.4	175.4	0	0	0	0	111	F23 L24 G25 V29	F23-V27 WeakPolarHBondContact O-CG2 3.28Å; L24-V27 WeakPolarHBondContact O-CB 3.03Å; L24-V27 PolarHBondContact O-N 3.49Å; G25-V27 VanDerWaalsContact C-N 3.28Å; G25-V27 PolarHBondContact O-N 3.47Å; V27-V29 VanDerWaalsContact C-N 3.33Å
28	F	93.5	Very high	94.7	Very high	160 Å²	160	90 Å²	90	70%	0.702	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.5	2	179.6	-67.2	-64.9	0	0	0	114.5	L24 G25	L24-F28 HydrophobicContact CB-CD2 4.11Å; L24-F28 HydrophobicContact CB-CE2 3.89Å; L24-F28 HydrophobicContact CD1-CE2 4.32Å; L24-F28 HydrophobicContact CD2-CE2 4.47Å; L24-F28 HydrophobicContact CG-CE2 4.47Å; L24-F28 WeakPolarHBondContact O-CD2 3.2Å; L24-F28 PolarHBondContact O-N 3.38Å; L24-F28 VanDerWaalsContact O-N 3.13Å; G25-F28 PolarHBondContact O-N 3Å
29	V	93.4	Very high	94.6	Very high	14 Å²	14	88.4 Å²	88.4	9%	0.085	47%	0.473	C	S	.	.	P	Polyproline II helix	trans	-71.1	123.3	176.7	-177.6	0	0	0	0	110.1	G25 P26 V27 K35 L38 I42	G25-V29 WeakPolarHBondContact O-CG2 3.35Å; G25-V29 PolarHBondContact O-N 3.14Å; P26-V29 PolarHBondContact O-N 2.84Å; V27-V29 VanDerWaalsContact C-N 3.33Å; V29-K35 HydrophobicContact CB-CG 4.36Å; V29-K35 HydrophobicContact CG1-CB 4.37Å; V29-K35 HydrophobicContact CG1-CG 3.82Å; V29-L38 HydrophobicContact CG1-CB 3.75Å; V29-L38 HydrophobicContact CG1-CD1 3.99Å; V29-L38 HydrophobicContact CG2-CB 4.38Å; V29-I42 HydrophobicContact CG2-CD1 3.69Å
30	P	92.6	Very high	94.6	Very high	99 Å²	99	85 Å²	85	64%	0.643	47%	0.465	S	S	*	.	P	Polyproline II helix	trans	-62.3	151	-180	25.9	-34.1	0	0	0	111.6	G32	P30-G32 PolarHBondContact O-N 3.41Å
31	K	91.6	Very high	94.6	Very high	201 Å²	201	83 Å²	83	87%	0.874	46%	0.458	S	S	*	.	S	Bend	trans	-67.9	116.9	174.6	-64.6	179.8	-177.3	175.6	0	108.5
32	G	92.8	Very high	94.6	Very high	41 Å²	41	83.3 Å²	83.3	42%	0.423	46%	0.458	S	S	.	.	S	Bend	trans	-166.2	172.9	177.6	0	0	0	0	0	111.6	P30 N34 K35	P30-G32 PolarHBondContact O-N 3.41Å; G32-N34 PolarHBondContact O-N 2.81Å; G32-N34 VanDerWaalsContact O-N 3.15Å; G32-K35 WeakPolarHBondContact O-CB 3.36Å; G32-K35 PolarHBondContact O-N 3.15Å; G32-K35 VanDerWaalsContact O-N 3.1Å
33	P	94.6	Very high	94.6	Very high	135 Å²	135	85.4 Å²	85.4	88%	0.877	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.2	-33.6	-178	-24.8	34	0	0	0	113.1
34	N	94.3	Very high	94.8	Very high	106 Å²	106	84.3 Å²	84.3	57%	0.567	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.4	13.3	-176.2	-60.4	-25	0	0	0	113.7	G32 M36 L37 L38	G32-N34 PolarHBondContact O-N 2.81Å; G32-N34 VanDerWaalsContact O-N 3.15Å; N34-M36 VanDerWaalsContact C-N 3.33Å; N34-M36 PolarHBondContact O-N 3.23Å; N34-L37 PolarHBondContact O-N 3.26Å; N34-L38 WeakPolarHBondContact O-CG 3.24Å; N34-L38 PolarHBondContact O-N 3.29Å
35	K	93	Very high	94.8	Very high	88 Å²	88	85.1 Å²	85.1	38%	0.383	47%	0.474	S	S	.	.	H	α-helix	trans	-55.5	-47.7	-176.4	-178.4	-177.3	-179.7	-173.2	0	111.7	V29 G32 L37 L38 S39	V29-K35 HydrophobicContact CB-CG 4.36Å; V29-K35 HydrophobicContact CG1-CB 4.37Å; V29-K35 HydrophobicContact CG1-CG 3.82Å; G32-K35 WeakPolarHBondContact O-CB 3.36Å; G32-K35 PolarHBondContact O-N 3.15Å; G32-K35 VanDerWaalsContact O-N 3.1Å; K35-L37 PolarHBondContact O-N 3.2Å; K35-L38 PolarHBondContact O-N 3.49Å; K35-S39 WeakPolarHBondContact O-CB 3.32Å; K35-S39 PolarHBondContact O-N 3.32Å; K35-S39 PolarHBondContact O-OG 3.03Å; K35-S39 VanDerWaalsContact O-OG 3.06Å
36	M	94.2	Very high	95	Very high	151 Å²	151	84.4 Å²	84.4	74%	0.744	47%	0.467	S	S	*	.	H	α-helix	trans	-61.9	-45.5	-178.7	-178.4	176.5	179.5	0	0	111.8	N34 L38 S39 V40	N34-M36 VanDerWaalsContact C-N 3.33Å; N34-M36 PolarHBondContact O-N 3.23Å; M36-L38 VanDerWaalsContact C-N 3.35Å; M36-L38 PolarHBondContact O-N 3.06Å; M36-S39 PolarHBondContact O-N 3.48Å; M36-V40 HydrophobicContact CG-CG2 4.34Å; M36-V40 WeakPolarHBondContact O-CB 3.38Å; M36-V40 VanDerWaalsContact O-CG2 3.29Å; M36-V40 WeakPolarHBondContact O-CG2 3.35Å; M36-V40 PolarHBondContact O-N 3.42Å
37	L	96.3	Very high	95.2	Very high	123 Å²	123	86.7 Å²	86.7	64%	0.644	48%	0.48	S	S	*	.	H	α-helix	trans	-58.6	-47.6	177.9	179.3	63.8	0	0	0	111.2	N34 K35 V40 S41	N34-L37 PolarHBondContact O-N 3.26Å; K35-L37 PolarHBondContact O-N 3.2Å; L37-V40 PolarHBondContact O-N 2.96Å; L37-S41 WeakPolarHBondContact O-CB 3.29Å; L37-S41 PolarHBondContact O-N 2.65Å; L37-S41 PolarHBondContact O-OG 3.06Å
38	L	95.9	Very high	95.4	Very high	80 Å²	80	85.2 Å²	85.2	42%	0.419	47%	0.474	S	S	.	.	H	α-helix	trans	-63.1	-48.7	178	-71	170.4	0	0	0	111.5	V29 N34 K35 M36 V40 S41 I42	V29-L38 HydrophobicContact CG1-CB 3.75Å; V29-L38 HydrophobicContact CG1-CD1 3.99Å; V29-L38 HydrophobicContact CG2-CB 4.38Å; N34-L38 WeakPolarHBondContact O-CG 3.24Å; N34-L38 PolarHBondContact O-N 3.29Å; K35-L38 PolarHBondContact O-N 3.49Å; M36-L38 VanDerWaalsContact C-N 3.35Å; M36-L38 PolarHBondContact O-N 3.06Å; L38-V40 PolarHBondContact O-N 2.95Å; L38-S41 WeakPolarHBondContact CA-OG 3.06Å; L38-S41 PolarHBondContact O-N 3.16Å; L38-S41 PolarHBondContact O-OG 2.86Å; L38-I42 VanDerWaalsContact O-CG1 3.3Å; L38-I42 WeakPolarHBondContact O-CG1 3.47Å; L38-I42 PolarHBondContact O-N 2.94Å
39	S	95.4	Very high	95.6	Very high	21 Å²	21	79.8 Å²	79.8	15%	0.147	46%	0.455	C	S	.	.	H	α-helix	trans	-57.9	-46.7	177.9	-64.1	0	0	0	0	112	K35 M36 I42 V43	K35-S39 WeakPolarHBondContact O-CB 3.32Å; K35-S39 PolarHBondContact O-N 3.32Å; K35-S39 PolarHBondContact O-OG 3.03Å; K35-S39 VanDerWaalsContact O-OG 3.06Å; M36-S39 PolarHBondContact O-N 3.48Å; S39-I42 PolarHBondContact O-N 2.92Å; S39-V43 WeakPolarHBondContact O-CG2 3.29Å; S39-V43 PolarHBondContact O-N 3.46Å
40	V	96.7	Very high	95.8	Very high	80 Å²	80	82.7 Å²	82.7	49%	0.485	47%	0.465	S	S	.	.	H	α-helix	trans	-65.5	-42.1	178.4	173	0	0	0	0	111.1	M36 L37 L38 I42 V43 L44	M36-V40 HydrophobicContact CG-CG2 4.34Å; M36-V40 WeakPolarHBondContact O-CB 3.38Å; M36-V40 VanDerWaalsContact O-CG2 3.29Å; M36-V40 WeakPolarHBondContact O-CG2 3.35Å; M36-V40 PolarHBondContact O-N 3.42Å; L37-V40 PolarHBondContact O-N 2.96Å; L38-V40 PolarHBondContact O-N 2.95Å; V40-I42 VanDerWaalsContact C-N 3.31Å; V40-I42 PolarHBondContact O-N 3.23Å; V40-V43 PolarHBondContact O-N 2.97Å; V40-L44 VanDerWaalsContact O-CB 3.23Å; V40-L44 WeakPolarHBondContact O-CB 3.35Å; V40-L44 PolarHBondContact O-N 2.91Å
41	S	96.9	Very high	96	Very high	49 Å²	49	83 Å²	83	34%	0.343	46%	0.461	S	S	.	.	H	α-helix	trans	-60.9	-39.2	177.4	67.9	0	0	0	0	112.6	L37 L38 T45	L37-S41 WeakPolarHBondContact O-CB 3.29Å; L37-S41 PolarHBondContact O-N 2.65Å; L37-S41 PolarHBondContact O-OG 3.06Å; L38-S41 WeakPolarHBondContact CA-OG 3.06Å; L38-S41 PolarHBondContact O-N 3.16Å; L38-S41 PolarHBondContact O-OG 2.86Å; S41-T45 VanDerWaalsContact O-CB 3.29Å; S41-T45 WeakPolarHBondContact O-CB 3.31Å; S41-T45 PolarHBondContact O-N 3.5Å; S41-T45 PolarHBondContact O-OG1 2.96Å
42	I	96.6	Very high	96.2	Very high	49 Å²	49	80.3 Å²	80.3	25%	0.251	45%	0.449	S	S	.	.	H	α-helix	trans	-68	-47.8	178.6	-67.4	163.6	0	0	0	110.4	V29 L38 S39 V40 T45 A46	V29-I42 HydrophobicContact CG2-CD1 3.69Å; L38-I42 VanDerWaalsContact O-CG1 3.3Å; L38-I42 WeakPolarHBondContact O-CG1 3.47Å; L38-I42 PolarHBondContact O-N 2.94Å; S39-I42 PolarHBondContact O-N 2.92Å; V40-I42 VanDerWaalsContact C-N 3.31Å; V40-I42 PolarHBondContact O-N 3.23Å; I42-T45 PolarHBondContact O-N 3.25Å; I42-A46 WeakPolarHBondContact O-CB 3.29Å; I42-A46 PolarHBondContact O-N 3.37Å
43	V	97.4	Very high	96.4	Very high	62 Å²	62	81.2 Å²	81.2	38%	0.376	44%	0.44	S	S	.	.	H	α-helix	trans	-61.8	-47.1	178.3	175.4	0	0	0	0	110.7	P26 S39 V40 T45 A46 V47	P26-V43 HydrophobicContact CG-CG2 3.46Å; P26-V43 VanDerWaalsContact CG-CG2 3.46Å; S39-V43 WeakPolarHBondContact O-CG2 3.29Å; S39-V43 PolarHBondContact O-N 3.46Å; V40-V43 PolarHBondContact O-N 2.97Å; V43-T45 VanDerWaalsContact C-N 3.34Å; V43-T45 PolarHBondContact O-N 3.45Å; V43-A46 PolarHBondContact O-N 3.45Å; V43-V47 HydrophobicContact CG1-CG2 4.36Å; V43-V47 WeakPolarHBondContact O-CG2 3.22Å; V43-V47 PolarHBondContact O-N 2.87Å
44	L	97.6	Very high	96.5	Very high	106 Å²	106	76 Å²	76	56%	0.555	40%	0.404	S	S	*	.	H	α-helix	trans	-60.4	-45.1	179.2	-175.6	64.6	0	0	0	111.1	V40 A46 V47 C48	V40-L44 VanDerWaalsContact O-CB 3.23Å; V40-L44 WeakPolarHBondContact O-CB 3.35Å; V40-L44 PolarHBondContact O-N 2.91Å; L44-A46 PolarHBondContact O-N 2.91Å; L44-V47 PolarHBondContact O-N 3.4Å; L44-C48 WeakPolarHBondContact O-CB 3.27Å; L44-C48 PolarHBondContact O-N 3.23Å; L44-C48 PolarHBondContact O-SG 3.44Å
45	T	97.4	Very high	96.6	Very high	77 Å²	77	72.9 Å²	72.9	47%	0.472	40%	0.397	S	S	.	.	H	α-helix	trans	-59.6	-47.5	175.9	-57.5	0	0	0	0	111	S41 I42 V43 V47 C48 C49	S41-T45 VanDerWaalsContact O-CB 3.29Å; S41-T45 WeakPolarHBondContact O-CB 3.31Å; S41-T45 PolarHBondContact O-N 3.5Å; S41-T45 PolarHBondContact O-OG1 2.96Å; I42-T45 PolarHBondContact O-N 3.25Å; V43-T45 VanDerWaalsContact C-N 3.34Å; V43-T45 PolarHBondContact O-N 3.45Å; T45-V47 VanDerWaalsContact C-N 3.34Å; T45-V47 PolarHBondContact O-N 3.35Å; T45-C48 PolarHBondContact O-N 2.92Å; T45-C49 VanDerWaalsContact O-CB 3.27Å; T45-C49 WeakPolarHBondContact O-CB 3.32Å; T45-C49 PolarHBondContact O-N 3.38Å; T45-C49 PolarHBondContact O-SG 2.84Å
46	A	97.6	Very high	96.7	Very high	5 Å²	5	74.4 Å²	74.4	4%	0.041	40%	0.404	C	S	.	.	H	α-helix	trans	-60.3	-44	179.4	0	0	0	0	0	112.1	W18 V21 I42 V43 L44 Y50	W18-A46 HydrophobicContact CE3-CB 4Å; V21-A46 HydrophobicContact CG1-CB 4.26Å; I42-A46 WeakPolarHBondContact O-CB 3.29Å; I42-A46 PolarHBondContact O-N 3.37Å; V43-A46 PolarHBondContact O-N 3.45Å; L44-A46 PolarHBondContact O-N 2.91Å; A46-Y50 VanDerWaalsContact O-CB 3.22Å; A46-Y50 WeakPolarHBondContact O-CB 3.23Å; A46-Y50 PolarHBondContact O-N 3.21Å
47	V	97.5	Very high	96.7	Very high	74 Å²	74	69.6 Å²	69.6	45%	0.448	38%	0.378	S	S	.	.	H	α-helix	trans	-65.2	-49.6	177.7	172.4	0	0	0	0	111.2	V43 L44 T45 C49 Y50 L51	V43-V47 HydrophobicContact CG1-CG2 4.36Å; V43-V47 WeakPolarHBondContact O-CG2 3.22Å; V43-V47 PolarHBondContact O-N 2.87Å; L44-V47 PolarHBondContact O-N 3.4Å; T45-V47 VanDerWaalsContact C-N 3.34Å; T45-V47 PolarHBondContact O-N 3.35Å; V47-C49 PolarHBondContact O-N 2.93Å; V47-Y50 PolarHBondContact O-N 3.42Å; V47-L51 HydrophobicContact CG1-CD1 3.82Å; V47-L51 HydrophobicContact CG1-CG 4.27Å; V47-L51 WeakPolarHBondContact O-CB 3.16Å; V47-L51 VanDerWaalsContact O-CG 3.29Å; V47-L51 WeakPolarHBondContact O-CG 3.18Å; V47-L51 PolarHBondContact O-N 3.48Å
48	C	97.9	Very high	96.7	Very high	69 Å²	69	68.1 Å²	68.1	47%	0.466	37%	0.37	S	S	.	.	H	α-helix	trans	-62.1	-45	-179.6	-70.5	0	0	0	0	112	L44 T45 L51 F52	L44-C48 WeakPolarHBondContact O-CB 3.27Å; L44-C48 PolarHBondContact O-N 3.23Å; L44-C48 PolarHBondContact O-SG 3.44Å; T45-C48 PolarHBondContact O-N 2.92Å; C48-L51 PolarHBondContact O-N 2.88Å; C48-F52 WeakPolarHBondContact O-CB 3.23Å; C48-F52 PolarHBondContact O-N 3.06Å
49	C	97.5	Very high	96.6	Very high	45 Å²	45	67.8 Å²	67.8	30%	0.304	38%	0.379	S	S	.	.	H	α-helix	trans	-64.6	-40.7	177.5	-69.7	0	0	0	0	111.8	W18 T45 V47 W53	W18-C49 HydrophobicContact CD2-CB 4.06Å; W18-C49 HydrophobicContact CE3-CB 4.12Å; W18-C49 HydrophobicContact CH2-CB 3.4Å; W18-C49 HydrophobicContact CZ2-CB 3.33Å; W18-C49 HydrophobicContact CZ3-CB 3.8Å; T45-C49 VanDerWaalsContact O-CB 3.27Å; T45-C49 WeakPolarHBondContact O-CB 3.32Å; T45-C49 PolarHBondContact O-N 3.38Å; T45-C49 PolarHBondContact O-SG 2.84Å; V47-C49 PolarHBondContact O-N 2.93Å; C49-W53 VanDerWaalsContact O-CB 3.29Å; C49-W53 WeakPolarHBondContact O-CB 3.38Å; C49-W53 PolarHBondContact O-N 2.95Å
50	Y	97.7	Very high	96.4	Very high	75 Å²	75	73.6 Å²	73.6	29%	0.294	40%	0.404	S	S	.	.	H	α-helix	trans	-64.6	-47.3	175.8	-178.6	-111.3	0	0	0	111.8	S15 W18 A46 V47 F52 W53 I54	S15-Y50 VanDerWaalsContact OG-CE2 3.29Å; S15-Y50 WeakPolarHBondContact OG-CE2 3.33Å; S15-Y50 PolarHBondContact OG-OH 2.91Å; W18-Y50 HydrophobicContact CB-CD2 4.13Å; W18-Y50 HydrophobicContact CB-CG 4.39Å; W18-Y50 HydrophobicContact CG-CD2 4.42Å; A46-Y50 VanDerWaalsContact O-CB 3.22Å; A46-Y50 WeakPolarHBondContact O-CB 3.23Å; A46-Y50 PolarHBondContact O-N 3.21Å; V47-Y50 PolarHBondContact O-N 3.42Å; Y50-F52 VanDerWaalsContact C-N 3.35Å; Y50-F52 PolarHBondContact O-N 3.48Å; Y50-W53 HydrophobicContact CD2-CE3 4.41Å; Y50-W53 HydrophobicContact CE2-CE3 4.22Å; Y50-W53 HydrophobicContact CE2-CZ3 4.4Å; Y50-W53 PolarHBondContact O-N 2.92Å; Y50-I54 HydrophobicContact CD1-CG2 4.49Å; Y50-I54 HydrophobicContact CE1-CB 4.46Å; Y50-I54 HydrophobicContact CE1-CG2 4.32Å; Y50-I54 HydrophobicContact CE2-CB 4.4Å; Y50-I54 WeakPolarHBondContact O-CB 3.36Å; Y50-I54 WeakPolarHBondContact O-CG2 3.29Å; Y50-I54 PolarHBondContact O-N 3.49Å
51	L	96.8	Very high	96.1	Very high	107 Å²	107	73.9 Å²	73.9	56%	0.56	40%	0.397	S	S	*	.	H	α-helix	trans	-60.5	-42.9	178	-74.7	176.4	0	0	0	112.3	V47 C48 I54 G55	V47-L51 HydrophobicContact CG1-CD1 3.82Å; V47-L51 HydrophobicContact CG1-CG 4.27Å; V47-L51 WeakPolarHBondContact O-CB 3.16Å; V47-L51 VanDerWaalsContact O-CG 3.29Å; V47-L51 WeakPolarHBondContact O-CG 3.18Å; V47-L51 PolarHBondContact O-N 3.48Å; C48-L51 PolarHBondContact O-N 2.88Å; L51-I54 WeakPolarHBondContact O-CG2 3.27Å; L51-G55 PolarHBondContact O-N 3.39Å; L51-G55 VanDerWaalsContact O-N 3.11Å
52	F	96.5	Very high	95.8	Very high	143 Å²	143	77.9 Å²	77.9	63%	0.627	41%	0.41	S	S	*	.	H	α-helix	trans	-59.5	-53.1	173.8	-176.9	-87.5	0	0	0	110.2	C48 Y50 G55 F56	C48-F52 WeakPolarHBondContact O-CB 3.23Å; C48-F52 PolarHBondContact O-N 3.06Å; Y50-F52 VanDerWaalsContact C-N 3.35Å; Y50-F52 PolarHBondContact O-N 3.48Å; F52-G55 PolarHBondContact O-N 2.91Å; F52-F56 AromaticContact CD1-CD2 3.97Å; F52-F56 HydrophobicContact CD1-CD2 3.97Å; F52-F56 HydrophobicContact CD1-CE2 4.19Å; F52-F56 HydrophobicContact CD2-CD2 4.24Å; F52-F56 AromaticContact CD2-CE2 3.68Å; F52-F56 HydrophobicContact CD2-CE2 3.68Å; F52-F56 AromaticContact CE1-CD2 3.77Å; F52-F56 HydrophobicContact CE1-CD2 3.77Å; F52-F56 AromaticContact CE1-CE2 3.86Å; F52-F56 HydrophobicContact CE1-CE2 3.86Å; F52-F56 HydrophobicContact CE2-CD2 4.07Å; F52-F56 AromaticContact CE2-CE2 3.32Å; F52-F56 HydrophobicContact CE2-CE2 3.32Å; F52-F56 HydrophobicContact CE2-CZ 4.17Å; F52-F56 HydrophobicContact CG-CD2 4.2Å; F52-F56 HydrophobicContact CG-CE2 4.1Å; F52-F56 AromaticContact CZ-CD2 3.82Å; F52-F56 HydrophobicContact CZ-CD2 3.82Å; F52-F56 AromaticContact CZ-CE2 3.41Å; F52-F56 HydrophobicContact CZ-CE2 3.41Å; F52-F56 VanDerWaalsContact CZ-CE2 3.41Å; F52-F56 HydrophobicContact CZ-CZ 4.27Å; F52-F56 WeakPolarHBondContact O-CD2 3.43Å; F52-F56 PolarHBondContact O-N 2.96Å
53	W	97	Very high	95.5	Very high	60 Å²	60	80.1 Å²	80.1	23%	0.227	43%	0.428	C	S	.	.	H	α-helix	trans	-60.9	-51.6	-177.6	179.3	84.9	0	0	0	112.7	P10 L11 V14 C49 Y50 G55 F56 Y57	P10-W53 HydrophobicContact CB-CZ2 4.49Å; L11-W53 HydrophobicContact CD1-CH2 4.26Å; L11-W53 HydrophobicContact CD1-CZ3 4.17Å; V14-W53 HydrophobicContact CB-CD2 3.98Å; V14-W53 HydrophobicContact CB-CE3 4.05Å; V14-W53 HydrophobicContact CB-CH2 3.82Å; V14-W53 HydrophobicContact CB-CZ2 3.66Å; V14-W53 HydrophobicContact CB-CZ3 3.97Å; V14-W53 HydrophobicContact CG1-CD2 3.36Å; V14-W53 HydrophobicContact CG1-CE3 3.62Å; V14-W53 HydrophobicContact CG1-CG 3.81Å; V14-W53 HydrophobicContact CG1-CH2 4.29Å; V14-W53 HydrophobicContact CG1-CZ2 4.01Å; V14-W53 HydrophobicContact CG1-CZ3 4.08Å; V14-W53 HydrophobicContact CG2-CD2 4.47Å; V14-W53 HydrophobicContact CG2-CH2 4.25Å; V14-W53 HydrophobicContact CG2-CZ2 3.64Å; C49-W53 VanDerWaalsContact O-CB 3.29Å; C49-W53 WeakPolarHBondContact O-CB 3.38Å; C49-W53 PolarHBondContact O-N 2.95Å; Y50-W53 HydrophobicContact CD2-CE3 4.41Å; Y50-W53 HydrophobicContact CE2-CE3 4.22Å; Y50-W53 HydrophobicContact CE2-CZ3 4.4Å; Y50-W53 PolarHBondContact O-N 2.92Å; W53-G55 VanDerWaalsContact C-N 3.31Å; W53-G55 PolarHBondContact O-N 3.46Å; W53-F56 PolarHBondContact O-N 3.45Å; W53-Y57 AromaticContact CH2-CD1 3.74Å; W53-Y57 HydrophobicContact CH2-CD1 3.74Å; W53-Y57 HydrophobicContact CH2-CD2 4.3Å; W53-Y57 HydrophobicContact CH2-CE1 4.31Å; W53-Y57 AromaticContact CH2-CG 3.76Å; W53-Y57 HydrophobicContact CH2-CG 3.76Å; W53-Y57 HydrophobicContact CZ2-CD1 4.14Å; W53-Y57 AromaticContact CZ2-CD2 3.85Å; W53-Y57 HydrophobicContact CZ2-CD2 3.85Å; W53-Y57 HydrophobicContact CZ2-CE2 4.42Å; W53-Y57 AromaticContact CZ2-CG 3.73Å; W53-Y57 HydrophobicContact CZ2-CG 3.73Å; W53-Y57 HydrophobicContact CZ3-CD1 4.46Å; W53-Y57 HydrophobicContact CZ3-CG 4.5Å; W53-Y57 VanDerWaalsContact O-CB 3.27Å; W53-Y57 WeakPolarHBondContact O-CB 3.43Å; W53-Y57 PolarHBondContact O-N 2.68Å
54	I	96.7	Very high	95.2	Very high	25 Å²	25	86.3 Å²	86.3	13%	0.128	45%	0.45	C	S	.	.	H	α-helix	trans	-64.1	-37.5	-176.4	-170.2	63.4	0	0	0	111.3	L11 Y50 L51 Y57 L58	L11-I54 HydrophobicContact CD1-CD1 3.26Å; Y50-I54 HydrophobicContact CD1-CG2 4.49Å; Y50-I54 HydrophobicContact CE1-CB 4.46Å; Y50-I54 HydrophobicContact CE1-CG2 4.32Å; Y50-I54 HydrophobicContact CE2-CB 4.4Å; Y50-I54 WeakPolarHBondContact O-CB 3.36Å; Y50-I54 WeakPolarHBondContact O-CG2 3.29Å; Y50-I54 PolarHBondContact O-N 3.49Å; L51-I54 WeakPolarHBondContact O-CG2 3.27Å; I54-Y57 PolarHBondContact O-N 3.25Å; I54-L58 HydrophobicContact CD1-CD1 4.07Å; I54-L58 HydrophobicContact CD1-CD2 4.27Å; I54-L58 HydrophobicContact CD1-CG 3.9Å; I54-L58 HydrophobicContact CG1-CD1 3.83Å; I54-L58 HydrophobicContact CG1-CG 4.05Å; I54-L58 WeakPolarHBondContact O-CB 3.44Å; I54-L58 VanDerWaalsContact O-CG 3.26Å; I54-L58 WeakPolarHBondContact O-CG 3.1Å; I54-L58 PolarHBondContact O-N 3.36Å
55	G	96.2	Very high	95	Very high	41 Å²	41	90.2 Å²	90.2	42%	0.423	46%	0.463	S	S	.	.	H	α-helix	trans	-59.4	-53.6	177.4	0	0	0	0	0	112.3	L51 F52 W53 Y57 A59	L51-G55 PolarHBondContact O-N 3.39Å; L51-G55 VanDerWaalsContact O-N 3.11Å; F52-G55 PolarHBondContact O-N 2.91Å; W53-G55 VanDerWaalsContact C-N 3.31Å; W53-G55 PolarHBondContact O-N 3.46Å; G55-Y57 VanDerWaalsContact C-N 3.32Å; G55-Y57 PolarHBondContact O-N 3.41Å; G55-A59 VanDerWaalsContact O-CB 3.32Å; G55-A59 WeakPolarHBondContact O-CB 3.28Å; G55-A59 PolarHBondContact O-N 3.4Å
56	F	94.6	Very high	94.7	Very high	121 Å²	121	89.6 Å²	89.6	53%	0.531	47%	0.472	S	S	.	.	H	α-helix	trans	-68.7	-30.6	178.7	-73.3	-71.4	0	0	0	113.3	F52 W53 Q60	F52-F56 AromaticContact CD1-CD2 3.97Å; F52-F56 HydrophobicContact CD1-CD2 3.97Å; F52-F56 HydrophobicContact CD1-CE2 4.19Å; F52-F56 HydrophobicContact CD2-CD2 4.24Å; F52-F56 AromaticContact CD2-CE2 3.68Å; F52-F56 HydrophobicContact CD2-CE2 3.68Å; F52-F56 AromaticContact CE1-CD2 3.77Å; F52-F56 HydrophobicContact CE1-CD2 3.77Å; F52-F56 AromaticContact CE1-CE2 3.86Å; F52-F56 HydrophobicContact CE1-CE2 3.86Å; F52-F56 HydrophobicContact CE2-CD2 4.07Å; F52-F56 AromaticContact CE2-CE2 3.32Å; F52-F56 HydrophobicContact CE2-CE2 3.32Å; F52-F56 HydrophobicContact CE2-CZ 4.17Å; F52-F56 HydrophobicContact CG-CD2 4.2Å; F52-F56 HydrophobicContact CG-CE2 4.1Å; F52-F56 AromaticContact CZ-CD2 3.82Å; F52-F56 HydrophobicContact CZ-CD2 3.82Å; F52-F56 AromaticContact CZ-CE2 3.41Å; F52-F56 HydrophobicContact CZ-CE2 3.41Å; F52-F56 VanDerWaalsContact CZ-CE2 3.41Å; F52-F56 HydrophobicContact CZ-CZ 4.27Å; F52-F56 WeakPolarHBondContact O-CD2 3.43Å; F52-F56 PolarHBondContact O-N 2.96Å; W53-F56 PolarHBondContact O-N 3.45Å; F56-Q60 PolarHBondContact O-NE2 3.37Å
57	Y	95.5	Very high	94.5	Very high	50 Å²	50	94.9 Å²	94.9	20%	0.196	51%	0.506	C	S	.	.	H	α-helix	trans	-68.6	-48.2	177.1	-168.2	-105	0	0	0	111.3	F7 P10 L11 W53 I54 G55 A59 Q60	F7-Y57 WeakPolarHBondContact CA-OH 3.35Å; F7-Y57 HydrophobicContact CD2-CD1 4.49Å; F7-Y57 AromaticContact CD2-CE1 3.49Å; F7-Y57 HydrophobicContact CD2-CE1 3.49Å; F7-Y57 VanDerWaalsContact CD2-CE1 3.49Å; F7-Y57 AromaticContact CD2-CZ 3.6Å; F7-Y57 WeakPolarHBondContact CD2-OH 3.5Å; F7-Y57 HydrophobicContact CE1-CE1 4.37Å; F7-Y57 AromaticContact CE2-CD1 3.81Å; F7-Y57 HydrophobicContact CE2-CD1 3.81Å; F7-Y57 AromaticContact CE2-CE1 3.19Å; F7-Y57 HydrophobicContact CE2-CE1 3.19Å; F7-Y57 AromaticContact CE2-CZ 3.72Å; F7-Y57 HydrophobicContact CG-CE1 4.21Å; F7-Y57 HydrophobicContact CZ-CD1 4.14Å; F7-Y57 AromaticContact CZ-CE1 3.71Å; F7-Y57 HydrophobicContact CZ-CE1 3.71Å; F7-Y57 PolarHBondContact O-OH 2.89Å; P10-Y57 HydrophobicContact CB-CE2 4.39Å; P10-Y57 HydrophobicContact CG-CE1 4.32Å; P10-Y57 HydrophobicContact CG-CE2 3.98Å; P10-Y57 WeakPolarHBondContact CG-OH 3.29Å; L11-Y57 HydrophobicContact CB-CE1 4.35Å; L11-Y57 HydrophobicContact CD1-CD1 4.28Å; W53-Y57 AromaticContact CH2-CD1 3.74Å; W53-Y57 HydrophobicContact CH2-CD1 3.74Å; W53-Y57 HydrophobicContact CH2-CD2 4.3Å; W53-Y57 HydrophobicContact CH2-CE1 4.31Å; W53-Y57 AromaticContact CH2-CG 3.76Å; W53-Y57 HydrophobicContact CH2-CG 3.76Å; W53-Y57 HydrophobicContact CZ2-CD1 4.14Å; W53-Y57 AromaticContact CZ2-CD2 3.85Å; W53-Y57 HydrophobicContact CZ2-CD2 3.85Å; W53-Y57 HydrophobicContact CZ2-CE2 4.42Å; W53-Y57 AromaticContact CZ2-CG 3.73Å; W53-Y57 HydrophobicContact CZ2-CG 3.73Å; W53-Y57 HydrophobicContact CZ3-CD1 4.46Å; W53-Y57 HydrophobicContact CZ3-CG 4.5Å; W53-Y57 VanDerWaalsContact O-CB 3.27Å; W53-Y57 WeakPolarHBondContact O-CB 3.43Å; W53-Y57 PolarHBondContact O-N 2.68Å; I54-Y57 PolarHBondContact O-N 3.25Å; G55-Y57 VanDerWaalsContact C-N 3.32Å; G55-Y57 PolarHBondContact O-N 3.41Å; Y57-A59 VanDerWaalsContact C-N 3.35Å; Y57-A59 PolarHBondContact O-N 3.48Å; Y57-Q60 PolarHBondContact O-N 2.9Å
58	L	94.2	Very high	94.4	Very high	91 Å²	91	97.5 Å²	97.5	48%	0.476	53%	0.527	S	S	.	.	H	α-helix	trans	-67.2	-34.2	177.3	-67.4	-178.5	0	0	0	112.6	F7 I54 Q60 Y61	F7-L58 HydrophobicContact CZ-CD2 3.85Å; I54-L58 HydrophobicContact CD1-CD1 4.07Å; I54-L58 HydrophobicContact CD1-CD2 4.27Å; I54-L58 HydrophobicContact CD1-CG 3.9Å; I54-L58 HydrophobicContact CG1-CD1 3.83Å; I54-L58 HydrophobicContact CG1-CG 4.05Å; I54-L58 WeakPolarHBondContact O-CB 3.44Å; I54-L58 VanDerWaalsContact O-CG 3.26Å; I54-L58 WeakPolarHBondContact O-CG 3.1Å; I54-L58 PolarHBondContact O-N 3.36Å; L58-Q60 PolarHBondContact O-N 3.07Å; L58-Q60 VanDerWaalsContact O-N 3.11Å; L58-Y61 WeakPolarHBondContact O-CB 3.29Å; L58-Y61 PolarHBondContact O-N 3.38Å
59	A	93.9	Very high	94.2	Very high	74 Å²	74	98.1 Å²	98.1	61%	0.612	53%	0.525	S	S	*	.	H	α-helix	trans	-58.8	-23.5	177.2	0	0	0	0	0	113.5	G55 Y57	G55-A59 VanDerWaalsContact O-CB 3.32Å; G55-A59 WeakPolarHBondContact O-CB 3.28Å; G55-A59 PolarHBondContact O-N 3.4Å; Y57-A59 VanDerWaalsContact C-N 3.35Å; Y57-A59 PolarHBondContact O-N 3.48Å
60	Q	91.8	Very high	94.1	Very high	142 Å²	142	104.1 Å²	104.1	66%	0.664	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.4	-0.5	179.8	-68.4	173.6	92.1	0	0	113.6	F56 Y57 L58 H62	F56-Q60 PolarHBondContact O-NE2 3.37Å; Y57-Q60 PolarHBondContact O-N 2.9Å; L58-Q60 PolarHBondContact O-N 3.07Å; L58-Q60 VanDerWaalsContact O-N 3.11Å; Q60-H62 PolarHBondContact O-N 2.99Å
61	Y	89.9	Confident	93.9	Very high	87 Å²	87	106.3 Å²	106.3	34%	0.341	57%	0.568	S	S	.	*	S	Bend	trans	-68.4	-36.4	-175.2	-171.3	-130.6	0	0	0	113.2	F7 L58	F7-Y61 HydrophobicContact CB-CD2 4.43Å; F7-Y61 HydrophobicContact CB-CE2 3.95Å; F7-Y61 AromaticContact CD1-CD2 3.83Å; F7-Y61 HydrophobicContact CD1-CD2 3.83Å; F7-Y61 AromaticContact CD1-CE2 3.41Å; F7-Y61 HydrophobicContact CD1-CE2 3.41Å; F7-Y61 VanDerWaalsContact CD1-CE2 3.41Å; F7-Y61 AromaticContact CD1-CZ 3.99Å; F7-Y61 AromaticContact CD2-CD2 3.2Å; F7-Y61 HydrophobicContact CD2-CD2 3.2Å; F7-Y61 AromaticContact CD2-CE2 3.56Å; F7-Y61 HydrophobicContact CD2-CE2 3.56Å; F7-Y61 HydrophobicContact CD2-CG 4.17Å; F7-Y61 HydrophobicContact CE1-CD1 4.5Å; F7-Y61 AromaticContact CE1-CD2 3.73Å; F7-Y61 HydrophobicContact CE1-CD2 3.73Å; F7-Y61 HydrophobicContact CE1-CE1 4.44Å; F7-Y61 AromaticContact CE1-CE2 3.64Å; F7-Y61 HydrophobicContact CE1-CE2 3.64Å; F7-Y61 HydrophobicContact CE1-CG 4.15Å; F7-Y61 AromaticContact CE2-CD2 3.09Å; F7-Y61 HydrophobicContact CE2-CD2 3.09Å; F7-Y61 AromaticContact CE2-CE2 3.79Å; F7-Y61 HydrophobicContact CE2-CE2 3.79Å; F7-Y61 AromaticContact CE2-CG 3.6Å; F7-Y61 HydrophobicContact CE2-CG 3.6Å; F7-Y61 AromaticContact CG-CD2 3.56Å; F7-Y61 HydrophobicContact CG-CD2 3.56Å; F7-Y61 AromaticContact CG-CE2 3.35Å; F7-Y61 HydrophobicContact CG-CE2 3.35Å; F7-Y61 HydrophobicContact CZ-CD1 4.2Å; F7-Y61 AromaticContact CZ-CD2 3.35Å; F7-Y61 HydrophobicContact CZ-CD2 3.35Å; F7-Y61 AromaticContact CZ-CE2 3.8Å; F7-Y61 HydrophobicContact CZ-CE2 3.8Å; F7-Y61 AromaticContact CZ-CG 3.56Å; F7-Y61 HydrophobicContact CZ-CG 3.56Å; L58-Y61 WeakPolarHBondContact O-CB 3.29Å; L58-Y61 PolarHBondContact O-N 3.38Å
62	H	91.3	Very high	93.8	Very high	133 Å²	133	102.9 Å²	102.9	62%	0.616	56%	0.559	S	S	*	*	S	Bend	trans	-131.4	79.2	178.1	-64.6	-44.1	0	0	0	110.2	Q60 F64	Q60-H62 PolarHBondContact O-N 2.99Å; H62-F64 PolarHBondContact O-N 2.97Å
63	P	90.8	Very high	93.7	Very high	96 Å²	96	98.7 Å²	98.7	62%	0.623	55%	0.547	S	S	*	.			trans	-69.5	130.4	-178	28.6	-33.4	0	0	0	111
64	F	91.6	Very high	93.6	Very high	191 Å²	191	99.7 Å²	99.7	84%	0.838	56%	0.556	S	S	*	*	S	Bend	trans	-78.8	-29.7	174.3	-69.6	-71.2	0	0	0	113.1	H62	H62-F64 PolarHBondContact O-N 2.97Å
65	F	91.9	Very high	93.4	Very high	188 Å²	188	105.2 Å²	105.2	83%	0.825	58%	0.575	S	S	*	*	S	Bend	trans	-134.5	140	-176.6	-52.6	-73.7	0	0	0	110.5
66	G	91.9	Very high	93.2	Very high	65 Å²	65	107.6 Å²	107.6	67%	0.67	58%	0.577	S	S	*	*			trans	-90.4	166.2	170.9	0	0	0	0	0	112.5
67	P	94	Very high	93.2	Very high	116 Å²	116	105.3 Å²	105.3	75%	0.753	57%	0.569	S	S	*	*			trans	-67.6	135.4	176	28.3	-34.2	0	0	0	111.8	L69	P67-L69 HydrophobicContact CB-CG 4.49Å
68	S	93.9	Very high	93	Very high	128 Å²	128	108.7 Å²	108.7	90%	0.895	59%	0.587	S	S	*	*			trans	-96.6	113.9	171.7	-176.2	0	0	0	0	110.1
69	L	93.5	Very high	93	Very high	82 Å²	82	108.5 Å²	108.5	43%	0.429	58%	0.584	S	S	.	*			trans	-118.7	146.6	-172.5	-67.2	168.3	0	0	0	111.4	P67 I74 I77	P67-L69 HydrophobicContact CB-CG 4.49Å; L69-I74 HydrophobicContact CB-CD1 4.12Å; L69-I74 HydrophobicContact CB-CG1 3.67Å; L69-I74 HydrophobicContact CD1-CG1 4.48Å; L69-I74 WeakPolarHBondContact O-CD1 3.36Å; L69-I77 HydrophobicContact CD1-CD1 3.77Å
70	K	95.5	Very high	93	Very high	172 Å²	172	111.3 Å²	111.3	75%	0.748	58%	0.584	S	S	*	*			trans	-67.6	145.4	172.3	-65.3	-175.6	179.6	-178.1	0	110.1	G72 S73 I74	K70-G72 PolarHBondContact O-N 2.88Å; K70-G72 VanDerWaalsContact O-N 3.1Å; K70-S73 WeakPolarHBondContact O-CA 3.42Å; K70-S73 WeakPolarHBondContact O-CB 3.23Å; K70-S73 PolarHBondContact O-N 3.47Å; K70-I74 PolarHBondContact O-N 3.36Å
71	T	93.8	Very high	93	Very high	120 Å²	120	114.4 Å²	114.4	74%	0.736	59%	0.59	S	S	*	*	H	α-helix	trans	-53	-36.8	-179.8	-45.2	0	0	0	0	113.1	I74 R75	T71-I74 PolarHBondContact O-N 2.77Å; T71-R75 PolarHBondContact O-N 3.4Å
72	G	94.9	Very high	92.8	Very high	36 Å²	36	114.8 Å²	114.8	37%	0.371	60%	0.602	S	S	.	*	H	α-helix	trans	-61.2	-45	174.5	0	0	0	0	0	113.3	K70 R75 I76	K70-G72 PolarHBondContact O-N 2.88Å; K70-G72 VanDerWaalsContact O-N 3.1Å; G72-R75 PolarHBondContact O-N 2.94Å; G72-I76 WeakPolarHBondContact O-CG1 3.23Å; G72-I76 PolarHBondContact O-N 3.25Å; G72-I76 VanDerWaalsContact O-N 3.16Å
73	S	94.7	Very high	91.5	Very high	54 Å²	54	118.1 Å²	118.1	38%	0.378	61%	0.609	S	S	.	*	H	α-helix	trans	-66.4	-41.2	176.7	-54.8	0	0	0	0	111.6	K70 R75 I76 I77	K70-S73 WeakPolarHBondContact O-CA 3.42Å; K70-S73 WeakPolarHBondContact O-CB 3.23Å; K70-S73 PolarHBondContact O-N 3.47Å; S73-R75 VanDerWaalsContact C-N 3.34Å; S73-R75 PolarHBondContact O-N 3.26Å; S73-I76 PolarHBondContact O-N 3.49Å; S73-I77 VanDerWaalsContact O-CG1 3.31Å; S73-I77 WeakPolarHBondContact O-CG1 3.49Å; S73-I77 PolarHBondContact O-N 3.37Å
74	I	94	Very high	89.8	Confident	81 Å²	81	126.1 Å²	126.1	42%	0.415	63%	0.634	S	S	.	*	H	α-helix	trans	-58.9	-46	175.6	-63.7	172	0	0	0	110.5	L69 K70 T71 I76 I77 Q78	L69-I74 HydrophobicContact CB-CD1 4.12Å; L69-I74 HydrophobicContact CB-CG1 3.67Å; L69-I74 HydrophobicContact CD1-CG1 4.48Å; L69-I74 WeakPolarHBondContact O-CD1 3.36Å; K70-I74 PolarHBondContact O-N 3.36Å; T71-I74 PolarHBondContact O-N 2.77Å; I74-I76 VanDerWaalsContact C-N 3.34Å; I74-I76 PolarHBondContact O-N 3.33Å; I74-I77 PolarHBondContact O-N 3.34Å; I74-Q78 WeakPolarHBondContact O-CB 3.3Å; I74-Q78 PolarHBondContact O-N 3.03Å
75	R	92.7	Very high	89.7	Confident	141 Å²	141	122.9 Å²	122.9	53%	0.532	62%	0.624	S	S	.	*	H	α-helix	trans	-60.4	-42	177.4	-179.8	172.6	59.9	80.6	-4.3	112.4	T71 G72 S73 Q78 Q79	T71-R75 PolarHBondContact O-N 3.4Å; G72-R75 PolarHBondContact O-N 2.94Å; S73-R75 VanDerWaalsContact C-N 3.34Å; S73-R75 PolarHBondContact O-N 3.26Å; R75-Q78 PolarHBondContact O-N 3.27Å; R75-Q79 WeakPolarHBondContact O-CB 3.42Å; R75-Q79 VanDerWaalsContact O-CG 3.31Å; R75-Q79 WeakPolarHBondContact O-CG 3.44Å; R75-Q79 PolarHBondContact O-N 3.46Å
76	I	93.6	Very high	89.5	Confident	91 Å²	91	119.5 Å²	119.5	47%	0.467	61%	0.613	S	S	.	*	H	α-helix	trans	-64	-45.8	176.7	-66.9	168	0	0	0	110	G72 S73 I74 Q78 Q79 Q80	G72-I76 WeakPolarHBondContact O-CG1 3.23Å; G72-I76 PolarHBondContact O-N 3.25Å; G72-I76 VanDerWaalsContact O-N 3.16Å; S73-I76 PolarHBondContact O-N 3.49Å; I74-I76 VanDerWaalsContact C-N 3.34Å; I74-I76 PolarHBondContact O-N 3.33Å; I76-Q78 PolarHBondContact O-N 3.06Å; I76-Q79 PolarHBondContact O-N 2.88Å; I76-Q80 HydrophobicContact CG2-CG 4.27Å; I76-Q80 WeakPolarHBondContact O-CG 3.4Å; I76-Q80 PolarHBondContact O-N 2.71Å
77	I	93.9	Very high	89.4	Confident	73 Å²	73	122.5 Å²	122.5	37%	0.374	61%	0.61	S	S	.	*	H	α-helix	trans	-59.7	-47.9	178.1	-69.5	164.8	0	0	0	110.1	L69 S73 I74 Q79 Q80 W81	L69-I77 HydrophobicContact CD1-CD1 3.77Å; S73-I77 VanDerWaalsContact O-CG1 3.31Å; S73-I77 WeakPolarHBondContact O-CG1 3.49Å; S73-I77 PolarHBondContact O-N 3.37Å; I74-I77 PolarHBondContact O-N 3.34Å; I77-Q79 VanDerWaalsContact C-N 3.3Å; I77-Q79 PolarHBondContact O-N 3.45Å; I77-Q80 PolarHBondContact O-N 3.27Å; I77-W81 HydrophobicContact CG2-CG 4.26Å; I77-W81 WeakPolarHBondContact O-CB 3.12Å; I77-W81 PolarHBondContact O-N 3.05Å
78	Q	92	Very high	89.1	Confident	122 Å²	122	122.9 Å²	122.9	57%	0.57	60%	0.602	S	S	*	*	H	α-helix	trans	-58.1	-42	176.6	-171.2	179.6	-5.6	0	0	111.9	I74 R75 I76 Q80 T82	I74-Q78 WeakPolarHBondContact O-CB 3.3Å; I74-Q78 PolarHBondContact O-N 3.03Å; R75-Q78 PolarHBondContact O-N 3.27Å; I76-Q78 PolarHBondContact O-N 3.06Å; Q78-Q80 PolarHBondContact O-N 3.31Å; Q78-T82 WeakPolarHBondContact O-CB 3.37Å; Q78-T82 PolarHBondContact O-N 3.13Å; Q78-T82 VanDerWaalsContact O-N 3.14Å; Q78-T82 PolarHBondContact O-OG1 3.1Å
79	Q	93.5	Very high	88.8	Confident	87 Å²	87	122.6 Å²	122.6	41%	0.407	58%	0.583	S	S	.	*	H	α-helix	trans	-68.5	-31.1	178.3	-74.2	178.1	-19.9	0	0	114.2	R75 I76 I77 R83	R75-Q79 WeakPolarHBondContact O-CB 3.42Å; R75-Q79 VanDerWaalsContact O-CG 3.31Å; R75-Q79 WeakPolarHBondContact O-CG 3.44Å; R75-Q79 PolarHBondContact O-N 3.46Å; I76-Q79 PolarHBondContact O-N 2.88Å; I77-Q79 VanDerWaalsContact C-N 3.3Å; I77-Q79 PolarHBondContact O-N 3.45Å; Q79-R83 VanDerWaalsContact O-CD 3.28Å; Q79-R83 WeakPolarHBondContact O-CD 3.4Å; Q79-R83 WeakPolarHBondContact O-CG 3.48Å; Q79-R83 PolarHBondContact O-NE 3.49Å
80	Q	93.6	Very high	88.5	Confident	133 Å²	133	125.3 Å²	125.3	62%	0.621	59%	0.594	S	S	*	*	H	α-helix	trans	-89.8	-41.4	-176.8	-65.6	-57.9	-47.7	0	0	112.7	I76 I77 Q78	I76-Q80 HydrophobicContact CG2-CG 4.27Å; I76-Q80 WeakPolarHBondContact O-CG 3.4Å; I76-Q80 PolarHBondContact O-N 2.71Å; I77-Q80 PolarHBondContact O-N 3.27Å; Q78-Q80 PolarHBondContact O-N 3.31Å
81	W	92.2	Very high	88	Confident	206 Å²	206	121.9 Å²	121.9	78%	0.78	58%	0.582	S	S	*	*	H	α-helix	trans	-95.5	-24	-171.6	-60.5	85.8	0	0	0	113.1	I77 R83	I77-W81 HydrophobicContact CG2-CG 4.26Å; I77-W81 WeakPolarHBondContact O-CB 3.12Å; I77-W81 PolarHBondContact O-N 3.05Å; W81-R83 VanDerWaalsContact C-N 3.25Å; W81-R83 PolarHBondContact O-N 3.15Å
82	T	84.5	Confident	87.6	Confident	96 Å²	96	122.1 Å²	122.1	59%	0.589	57%	0.571	S	S	*	*	S	Bend	trans	-81.6	-2.3	172.4	-46.6	0	0	0	0	112.3	Q78 K84	Q78-T82 WeakPolarHBondContact O-CB 3.37Å; Q78-T82 PolarHBondContact O-N 3.13Å; Q78-T82 VanDerWaalsContact O-N 3.14Å; Q78-T82 PolarHBondContact O-OG1 3.1Å; T82-K84 PolarHBondContact O-N 3.2Å; T82-K84 VanDerWaalsContact O-N 3.15Å
83	R	64.5	Low	87	Confident	203 Å²	203	129.3 Å²	129.3	77%	0.766	59%	0.587	S	S	*	*			trans	-86.3	44.6	178.5	-82.7	-166.9	-168.4	-153.9	7.4	114.1	Q79 W81	Q79-R83 VanDerWaalsContact O-CD 3.28Å; Q79-R83 WeakPolarHBondContact O-CD 3.4Å; Q79-R83 WeakPolarHBondContact O-CG 3.48Å; Q79-R83 PolarHBondContact O-NE 3.49Å; W81-R83 VanDerWaalsContact C-N 3.25Å; W81-R83 PolarHBondContact O-N 3.15Å
84	K	54.8	Low	86.3	Confident	264 Å²	264	136.1 Å²	136.1	100%	1.148	61%	0.606	S	S	*	*			trans	-143.8	0	162	-73.1	-169.1	178.6	-176.5	0	108.7	T82	T82-K84 PolarHBondContact O-N 3.2Å; T82-K84 VanDerWaalsContact O-N 3.15Å

Retrieved 84 of 84 residues in 82.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).