A0A146MGC6_SCHMA Loading...

ATP synthase F0 subunit 8

AlphaFold DB , UniProt , Accession A0A146MGC6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 60 aa.

						>A0A146MGC6_SCHMA|A0A146MGC6
MSGGSSVPDSAFTGWKYYFNSYTLKGRFNIVMANYAILFAGIAIWRMRSKKKKALKKDET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.6	Very low	61.5	Low	244 Å²	244	99.2 Å²	99.2	100%	1.202	68%	0.68	S	S	*	*				0	94.2	0	-68.1	159.3	73	0	0	107.7	G3	M1-G3 PolarHBondContact O-N 2.96Å
2	S	46.2	Very low	63.2	Low	120 Å²	120	94.2 Å²	94.2	84%	0.839	64%	0.638	S	S	*	*			trans	-84.7	103.9	177.5	63.5	0	0	0	0	109	G4	S2-G4 PolarHBondContact O-N 3.25Å
3	G	46	Very low	64.8	Low	84 Å²	84	95.8 Å²	95.8	87%	0.866	64%	0.643	S	S	*	*			trans	-69.1	67.1	175.6	0	0	0	0	0	112.2	M1	M1-G3 PolarHBondContact O-N 2.96Å
4	G	53.1	Low	66.2	Low	56 Å²	56	92.9 Å²	92.9	58%	0.577	64%	0.638	S	S	*	*			trans	-74.2	126.1	176.9	0	0	0	0	0	110	S2 S6	S2-G4 PolarHBondContact O-N 3.25Å; G4-S6 PolarHBondContact O-N 3.44Å
5	S	56.7	Low	67.4	Low	123 Å²	123	102.2 Å²	102.2	86%	0.86	65%	0.654	S	S	*	*			trans	-58	75.2	171.9	-46	0	0	0	0	111.1	V7	S5-V7 PolarHBondContact O-N 3.27Å; S5-V7 VanDerWaalsContact O-N 3.14Å
6	S	63.6	Low	68.5	Low	106 Å²	106	105.3 Å²	105.3	74%	0.741	65%	0.654	S	S	*	*			trans	-75.6	101.4	175	59.2	0	0	0	0	107.7	G4	G4-S6 PolarHBondContact O-N 3.44Å
7	V	68.3	Low	69.4	Low	58 Å²	58	102.2 Å²	102.2	35%	0.352	63%	0.628	S	S	.	*			trans	-58.5	122.8	169.3	-177.9	0	0	0	0	107	S5 D9 A11 F12	S5-V7 PolarHBondContact O-N 3.27Å; S5-V7 VanDerWaalsContact O-N 3.14Å; V7-D9 PolarHBondContact O-N 3.07Å; V7-A11 HydrophobicContact CG1-CB 4.02Å; V7-F12 HydrophobicContact CB-CE2 4.23Å; V7-F12 HydrophobicContact CG1-CE2 3.51Å; V7-F12 HydrophobicContact CG1-CZ 3.73Å
8	P	71.9	Confident	70.1	Confident	77 Å²	77	103.4 Å²	103.4	50%	0.5	62%	0.62	S	S	.	*			trans	-63	134.6	-177.6	25.8	-33.1	0	0	0	109	S10 A11	P8-S10 PolarHBondContact O-N 3.24Å; P8-A11 HydrophobicContact CG-CB 4.36Å; P8-A11 VanDerWaalsContact O-CB 3.27Å; P8-A11 WeakPolarHBondContact O-CB 3.48Å; P8-A11 PolarHBondContact O-N 3.37Å
9	D	71.5	Confident	70.9	Confident	57 Å²	57	103.9 Å²	103.9	31%	0.305	61%	0.614	S	S	.	*	G	3₁₀ helix	trans	-52.1	-28.8	177.4	-94.6	2.9	0	0	0	112	V7 A11 F12 Y17 T23	V7-D9 PolarHBondContact O-N 3.07Å; D9-A11 PolarHBondContact O-N 2.85Å; D9-F12 PolarHBondContact O-N 3.49Å; D9-Y17 HydrophobicContact CB-CE2 3.76Å; D9-Y17 VanDerWaalsContact O-CD2 3.31Å; D9-Y17 WeakPolarHBondContact O-CD2 3.35Å; D9-Y17 WeakPolarHBondContact O-CE2 3.5Å; D9-Y17 PolarHBondContact OD2-OH 3.3Å; D9-T23 WeakPolarHBondContact OD1-CB 3.37Å; D9-T23 VanDerWaalsContact OD1-CG2 3.22Å; D9-T23 WeakPolarHBondContact OD1-CG2 3.39Å; D9-T23 PolarHBondContact OD1-OG1 2.87Å
10	S	77.1	Confident	71.5	Confident	103 Å²	103	99.3 Å²	99.3	72%	0.72	59%	0.586	S	S	*	*	G	3₁₀ helix	trans	-67.4	-13.9	176.1	57.9	0	0	0	0	115	P8 F12	P8-S10 PolarHBondContact O-N 3.24Å; S10-F12 PolarHBondContact O-N 3.28Å
11	A	79.5	Confident	72.1	Confident	63 Å²	63	98.7 Å²	98.7	52%	0.521	59%	0.587	S	S	.	*	G	3₁₀ helix	trans	-72.9	-16.4	175.1	0	0	0	0	0	112.8	V7 P8 D9	V7-A11 HydrophobicContact CG1-CB 4.02Å; P8-A11 HydrophobicContact CG-CB 4.36Å; P8-A11 VanDerWaalsContact O-CB 3.27Å; P8-A11 WeakPolarHBondContact O-CB 3.48Å; P8-A11 PolarHBondContact O-N 3.37Å; D9-A11 PolarHBondContact O-N 2.85Å
12	F	81.9	Confident	73.9	Confident	39 Å²	39	95.4 Å²	95.4	17%	0.171	56%	0.562	C	S	.	*			trans	-112.5	134	-178.4	-55.5	-72	0	0	0	110.5	V7 D9 S10 Y17 Y22 T23	V7-F12 HydrophobicContact CB-CE2 4.23Å; V7-F12 HydrophobicContact CG1-CE2 3.51Å; V7-F12 HydrophobicContact CG1-CZ 3.73Å; D9-F12 PolarHBondContact O-N 3.49Å; S10-F12 PolarHBondContact O-N 3.28Å; F12-Y17 WeakPolarHBondContact O-CD2 3.3Å; F12-Y22 HydrophobicContact CE1-CD2 4.09Å; F12-Y22 AromaticContact CZ-CD2 3.71Å; F12-Y22 HydrophobicContact CZ-CD2 3.71Å; F12-Y22 HydrophobicContact CZ-CG 4.09Å; F12-T23 HydrophobicContact CD2-CG2 3.91Å; F12-T23 HydrophobicContact CE2-CG2 3.62Å
13	T	83.8	Confident	75.7	Confident	115 Å²	115	90 Å²	90	71%	0.706	53%	0.525	S	S	*	.			trans	-123	156.4	178.5	60.9	0	0	0	0	111.2	K16	T13-K16 PolarHBondContact O-N 3.35Å
14	G	85	Confident	77.5	Confident	55 Å²	55	93 Å²	93	57%	0.567	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.4	-136.9	178.5	0	0	0	0	0	113.5	K16 Y17	G14-K16 VanDerWaalsContact C-N 3.25Å; G14-K16 PolarHBondContact O-N 3.17Å; G14-Y17 VanDerWaalsContact O-CB 3.3Å; G14-Y17 WeakPolarHBondContact O-CB 3.46Å; G14-Y17 PolarHBondContact O-N 3.24Å
15	W	84.2	Confident	79.1	Confident	233 Å²	233	94.5 Å²	94.5	88%	0.883	51%	0.51	S	S	*	.	H	α-helix	trans	-64.3	-29.1	-179.1	-63.9	-8.6	0	0	0	113.3	Y17 Y18 F19	W15-Y17 PolarHBondContact O-N 3.26Å; W15-Y18 PolarHBondContact O-N 3.07Å; W15-Y18 VanDerWaalsContact O-N 3.12Å; W15-F19 PolarHBondContact O-N 3.12Å
16	K	83.9	Confident	80.5	Confident	151 Å²	151	88.6 Å²	88.6	66%	0.657	47%	0.469	S	S	*	.	H	α-helix	trans	-65.5	-27	177.9	-66.7	-175.7	176.9	-178.4	0	112.1	T13 G14 Y18 F19 N20	T13-K16 PolarHBondContact O-N 3.35Å; G14-K16 VanDerWaalsContact C-N 3.25Å; G14-K16 PolarHBondContact O-N 3.17Å; K16-Y18 VanDerWaalsContact C-N 3.25Å; K16-Y18 PolarHBondContact O-N 3.06Å; K16-F19 CarbonylContact O-C 3.58Å; K16-N20 VanDerWaalsContact O-CB 3.27Å; K16-N20 WeakPolarHBondContact O-CB 3.35Å; K16-N20 PolarHBondContact O-ND2 3.44Å; K16-N20 VanDerWaalsContact O-ND2 3.08Å
17	Y	84.2	Confident	81.7	Confident	54 Å²	54	90.6 Å²	90.6	21%	0.212	46%	0.461	C	S	.	.	H	α-helix	trans	-59.1	-40.6	173.4	-176.1	-94.2	0	0	0	111.8	D9 F12 G14 W15 N20 K25	D9-Y17 HydrophobicContact CB-CE2 3.76Å; D9-Y17 VanDerWaalsContact O-CD2 3.31Å; D9-Y17 WeakPolarHBondContact O-CD2 3.35Å; D9-Y17 WeakPolarHBondContact O-CE2 3.5Å; D9-Y17 PolarHBondContact OD2-OH 3.3Å; F12-Y17 WeakPolarHBondContact O-CD2 3.3Å; G14-Y17 VanDerWaalsContact O-CB 3.3Å; G14-Y17 WeakPolarHBondContact O-CB 3.46Å; G14-Y17 PolarHBondContact O-N 3.24Å; W15-Y17 PolarHBondContact O-N 3.26Å; Y17-N20 PolarHBondContact O-ND2 2.88Å; Y17-K25 HydrophobicContact CD1-CD 4.25Å; Y17-K25 HydrophobicContact CE1-CD 3.48Å; Y17-K25 VanDerWaalsContact CE1-CD 3.48Å; Y17-K25 PolarHBondContact OH-NZ 3.44Å
18	Y	83.1	Confident	82.7	Confident	123 Å²	123	93.9 Å²	93.9	48%	0.482	47%	0.47	S	S	.	.	H	α-helix	trans	-92.7	-23.6	-177.9	-65.4	-72.2	0	0	0	113.6	W15 K16 K25 G26 N29	W15-Y18 PolarHBondContact O-N 3.07Å; W15-Y18 VanDerWaalsContact O-N 3.12Å; K16-Y18 VanDerWaalsContact C-N 3.25Å; K16-Y18 PolarHBondContact O-N 3.06Å; Y18-K25 HydrophobicContact CD1-CD 4.47Å; Y18-G26 WeakPolarHBondContact O-CA 3.49Å; Y18-N29 WeakPolarHBondContact CB-ND2 3.39Å; Y18-N29 WeakPolarHBondContact CD1-ND2 3.48Å; Y18-N29 WeakPolarHBondContact O-CB 3.33Å; Y18-N29 PolarHBondContact O-ND2 3.44Å; Y18-N29 VanDerWaalsContact O-ND2 3.17Å
19	F	84.4	Confident	83.6	Confident	114 Å²	114	92.2 Å²	92.2	50%	0.5	46%	0.457	S	S	.	.	S	Bend	trans	-124.8	69.6	-178.3	-67	-79.8	0	0	0	110.4	W15 K16 N29 I30 A33	W15-F19 PolarHBondContact O-N 3.12Å; K16-F19 CarbonylContact O-C 3.58Å; F19-N29 HydrophobicContact CE1-CB 4.46Å; F19-I30 HydrophobicContact CD1-CG1 4.02Å; F19-A33 HydrophobicContact CE1-CB 3.91Å
20	N	83.8	Confident	84.6	Confident	11 Å²	11	92 Å²	92	6%	0.059	46%	0.456	C	S	.	.			trans	-127.5	158.2	170.5	71.5	81.5	0	0	0	110.8	K16 Y17 Y22 T23 G26 R27 I30	K16-N20 VanDerWaalsContact O-CB 3.27Å; K16-N20 WeakPolarHBondContact O-CB 3.35Å; K16-N20 PolarHBondContact O-ND2 3.44Å; K16-N20 VanDerWaalsContact O-ND2 3.08Å; Y17-N20 PolarHBondContact O-ND2 2.88Å; N20-Y22 HydrophobicContact CB-CD2 4.45Å; N20-Y22 PolarHBondContact OD1-N 3.47Å; N20-T23 PolarHBondContact ND2-OG1 3.08Å; N20-T23 PolarHBondContact OD1-N 3.33Å; N20-T23 PolarHBondContact OD1-OG1 3.31Å; N20-G26 CarbonylContact O-C 2.9Å; N20-G26 WeakPolarHBondContact O-CA 3.31Å; N20-R27 PolarHBondContact O-N 2.84Å; N20-R27 VanDerWaalsContact O-N 3.11Å; N20-I30 WeakPolarHBondContact O-CD1 3.23Å
21	S	83.4	Confident	85.4	Confident	87 Å²	87	90.4 Å²	90.4	61%	0.608	44%	0.441	S	S	*	.	S	Bend	trans	-92.7	-2.7	179.1	-53.9	0	0	0	0	113.4	R27	S21-R27 WeakPolarHBondContact O-CD 3.22Å; S21-R27 WeakPolarHBondContact O-CG 3.48Å
22	Y	80.6	Confident	86.1	Confident	174 Å²	174	92.1 Å²	92.1	68%	0.682	44%	0.44	S	S	*	.	S	Bend	trans	-95	-35.9	-168.7	-62.2	-74.4	0	0	0	113.1	F12 N20	F12-Y22 HydrophobicContact CE1-CD2 4.09Å; F12-Y22 AromaticContact CZ-CD2 3.71Å; F12-Y22 HydrophobicContact CZ-CD2 3.71Å; F12-Y22 HydrophobicContact CZ-CG 4.09Å; N20-Y22 HydrophobicContact CB-CD2 4.45Å; N20-Y22 PolarHBondContact OD1-N 3.47Å
23	T	84.1	Confident	86.7	Confident	8 Å²	8	91.8 Å²	91.8	5%	0.049	44%	0.444	C	S	.	.	S	Bend	trans	-102.1	152.8	-178.3	79.6	0	0	0	0	110.5	D9 F12 N20 K25 G26 R27	D9-T23 WeakPolarHBondContact OD1-CB 3.37Å; D9-T23 VanDerWaalsContact OD1-CG2 3.22Å; D9-T23 WeakPolarHBondContact OD1-CG2 3.39Å; D9-T23 PolarHBondContact OD1-OG1 2.87Å; F12-T23 HydrophobicContact CD2-CG2 3.91Å; F12-T23 HydrophobicContact CE2-CG2 3.62Å; N20-T23 PolarHBondContact ND2-OG1 3.08Å; N20-T23 PolarHBondContact OD1-N 3.33Å; N20-T23 PolarHBondContact OD1-OG1 3.31Å; T23-K25 PolarHBondContact O-N 3.46Å; T23-G26 PolarHBondContact O-N 3.43Å; T23-G26 PolarHBondContact OG1-N 2.91Å; T23-R27 VanDerWaalsContact O-CG 3.32Å; T23-R27 WeakPolarHBondContact O-CG 3.35Å; T23-R27 PolarHBondContact O-N 3.32Å
24	L	84.6	Confident	87.2	Confident	146 Å²	146	90.5 Å²	90.5	76%	0.764	43%	0.433	S	S	*	.	H	α-helix	trans	-58.6	-38.6	178.2	-69.9	172.8	0	0	0	111.4	R27 F28	L24-R27 PolarHBondContact O-N 2.89Å; L24-F28 WeakPolarHBondContact O-CB 3.4Å; L24-F28 PolarHBondContact O-N 3.31Å
25	K	85.2	Confident	87.8	Confident	87 Å²	87	95.3 Å²	95.3	38%	0.378	44%	0.435	S	S	.	.	H	α-helix	trans	-64.5	-47	178.5	-173.8	177.4	-67.7	179.2	0	111.9	Y17 Y18 T23 R27 F28 N29	Y17-K25 HydrophobicContact CD1-CD 4.25Å; Y17-K25 HydrophobicContact CE1-CD 3.48Å; Y17-K25 VanDerWaalsContact CE1-CD 3.48Å; Y17-K25 PolarHBondContact OH-NZ 3.44Å; Y18-K25 HydrophobicContact CD1-CD 4.47Å; T23-K25 PolarHBondContact O-N 3.46Å; K25-R27 PolarHBondContact O-N 2.96Å; K25-F28 PolarHBondContact O-N 3.28Å; K25-N29 PolarHBondContact O-N 3.35Å; K25-N29 VanDerWaalsContact O-N 3.13Å
26	G	86.4	Confident	88.3	Confident	0 Å²	0	87 Å²	87	0%	0	42%	0.416	C	S	.	.	H	α-helix	trans	-60.4	-46.6	177.6	0	0	0	0	0	112.2	Y18 N20 T23 F28 N29 I30	Y18-G26 WeakPolarHBondContact O-CA 3.49Å; N20-G26 CarbonylContact O-C 2.9Å; N20-G26 WeakPolarHBondContact O-CA 3.31Å; T23-G26 PolarHBondContact O-N 3.43Å; T23-G26 PolarHBondContact OG1-N 2.91Å; G26-F28 PolarHBondContact O-N 2.87Å; G26-N29 PolarHBondContact O-N 2.83Å; G26-I30 WeakPolarHBondContact O-CG1 3.48Å; G26-I30 PolarHBondContact O-N 2.84Å
27	R	88.6	Confident	88.9	Confident	148 Å²	148	85.4 Å²	85.4	56%	0.558	41%	0.413	S	S	*	.	H	α-helix	trans	-61	-44.7	178.8	-69.4	172.8	67.2	-174.7	1.1	112	N20 S21 T23 L24 K25 N29 I30 V31	N20-R27 PolarHBondContact O-N 2.84Å; N20-R27 VanDerWaalsContact O-N 3.11Å; S21-R27 WeakPolarHBondContact O-CD 3.22Å; S21-R27 WeakPolarHBondContact O-CG 3.48Å; T23-R27 VanDerWaalsContact O-CG 3.32Å; T23-R27 WeakPolarHBondContact O-CG 3.35Å; T23-R27 PolarHBondContact O-N 3.32Å; L24-R27 PolarHBondContact O-N 2.89Å; K25-R27 PolarHBondContact O-N 2.96Å; R27-N29 PolarHBondContact O-N 3.45Å; R27-I30 PolarHBondContact O-N 3.45Å; R27-V31 WeakPolarHBondContact O-CG2 3.23Å; R27-V31 PolarHBondContact O-N 2.89Å; R27-V31 VanDerWaalsContact O-N 3.09Å
28	F	90.4	Very high	89.5	Confident	127 Å²	127	88 Å²	88	56%	0.557	43%	0.43	S	S	*	.	H	α-helix	trans	-60.4	-45.4	178.3	178.5	-99.9	0	0	0	111.9	L24 K25 G26 V31 M32	L24-F28 WeakPolarHBondContact O-CB 3.4Å; L24-F28 PolarHBondContact O-N 3.31Å; K25-F28 PolarHBondContact O-N 3.28Å; G26-F28 PolarHBondContact O-N 2.87Å; F28-V31 WeakPolarHBondContact O-CB 3.28Å; F28-V31 PolarHBondContact O-N 3.46Å; F28-M32 HydrophobicContact CD1-CG 4.09Å; F28-M32 HydrophobicContact CE1-CG 3.62Å; F28-M32 HydrophobicContact CE1-SD 4.43Å; F28-M32 HydrophobicContact CE2-CG 4.2Å; F28-M32 HydrophobicContact CE2-SD 4.5Å; F28-M32 HydrophobicContact CZ-CG 3.68Å; F28-M32 HydrophobicContact CZ-SD 3.98Å; F28-M32 WeakPolarHBondContact O-CG 3.36Å; F28-M32 PolarHBondContact O-N 3.3Å
29	N	91.1	Very high	90.1	Very high	41 Å²	41	89.7 Å²	89.7	22%	0.219	44%	0.44	C	S	.	.	H	α-helix	trans	-66.7	-37.8	179.3	-78.9	0.8	0	0	0	113.2	Y18 F19 K25 G26 R27 V31 M32 A33	Y18-N29 WeakPolarHBondContact CB-ND2 3.39Å; Y18-N29 WeakPolarHBondContact CD1-ND2 3.48Å; Y18-N29 WeakPolarHBondContact O-CB 3.33Å; Y18-N29 PolarHBondContact O-ND2 3.44Å; Y18-N29 VanDerWaalsContact O-ND2 3.17Å; F19-N29 HydrophobicContact CE1-CB 4.46Å; K25-N29 PolarHBondContact O-N 3.35Å; K25-N29 VanDerWaalsContact O-N 3.13Å; G26-N29 PolarHBondContact O-N 2.83Å; R27-N29 PolarHBondContact O-N 3.45Å; N29-V31 VanDerWaalsContact C-N 3.3Å; N29-V31 PolarHBondContact O-N 3.46Å; N29-M32 PolarHBondContact O-N 2.91Å; N29-A33 WeakPolarHBondContact O-CB 3.38Å; N29-A33 PolarHBondContact O-N 3.33Å
30	I	91.5	Very high	90.7	Very high	53 Å²	53	86.3 Å²	86.3	27%	0.272	43%	0.434	S	S	.	.	H	α-helix	trans	-60.7	-42.5	173.2	-69.4	168	0	0	0	110.4	F19 N20 G26 R27 A33 N34	F19-I30 HydrophobicContact CD1-CG1 4.02Å; N20-I30 WeakPolarHBondContact O-CD1 3.23Å; G26-I30 WeakPolarHBondContact O-CG1 3.48Å; G26-I30 PolarHBondContact O-N 2.84Å; R27-I30 PolarHBondContact O-N 3.45Å; I30-A33 PolarHBondContact O-N 2.94Å; I30-N34 PolarHBondContact O-N 3.31Å; I30-N34 PolarHBondContact O-ND2 3.09Å
31	V	94.3	Very high	91.3	Very high	69 Å²	69	87.7 Å²	87.7	42%	0.418	45%	0.451	S	S	.	.	H	α-helix	trans	-64.7	-46.4	176.9	170.5	0	0	0	0	111.1	R27 F28 N29 A33 N34 Y35	R27-V31 WeakPolarHBondContact O-CG2 3.23Å; R27-V31 PolarHBondContact O-N 2.89Å; R27-V31 VanDerWaalsContact O-N 3.09Å; F28-V31 WeakPolarHBondContact O-CB 3.28Å; F28-V31 PolarHBondContact O-N 3.46Å; N29-V31 VanDerWaalsContact C-N 3.3Å; N29-V31 PolarHBondContact O-N 3.46Å; V31-A33 VanDerWaalsContact C-N 3.31Å; V31-A33 PolarHBondContact O-N 3.4Å; V31-N34 WeakPolarHBondContact O-CB 3.34Å; V31-N34 PolarHBondContact O-N 2.86Å; V31-N34 VanDerWaalsContact O-N 3.17Å; V31-Y35 HydrophobicContact CG1-CD2 3.75Å; V31-Y35 HydrophobicContact CG1-CE2 3.34Å; V31-Y35 WeakPolarHBondContact O-CD2 3.42Å; V31-Y35 PolarHBondContact O-N 3.47Å
32	M	94.4	Very high	91.9	Very high	100 Å²	100	88.8 Å²	88.8	49%	0.493	45%	0.448	S	S	.	.	H	α-helix	trans	-59.6	-41.1	175.5	-74.1	-66.9	-77.6	0	0	112.1	F28 N29 Y35 A36	F28-M32 HydrophobicContact CD1-CG 4.09Å; F28-M32 HydrophobicContact CE1-CG 3.62Å; F28-M32 HydrophobicContact CE1-SD 4.43Å; F28-M32 HydrophobicContact CE2-CG 4.2Å; F28-M32 HydrophobicContact CE2-SD 4.5Å; F28-M32 HydrophobicContact CZ-CG 3.68Å; F28-M32 HydrophobicContact CZ-SD 3.98Å; F28-M32 WeakPolarHBondContact O-CG 3.36Å; F28-M32 PolarHBondContact O-N 3.3Å; N29-M32 PolarHBondContact O-N 2.91Å; M32-Y35 PolarHBondContact O-N 2.99Å; M32-A36 WeakPolarHBondContact O-CB 3.34Å; M32-A36 PolarHBondContact O-N 2.97Å
33	A	93.7	Very high	92.6	Very high	31 Å²	31	82.1 Å²	82.1	26%	0.256	43%	0.429	S	S	.	.	H	α-helix	trans	-63.8	-40.3	175.7	0	0	0	0	0	112.1	F19 N29 I30 V31 A36 I37	F19-A33 HydrophobicContact CE1-CB 3.91Å; N29-A33 WeakPolarHBondContact O-CB 3.38Å; N29-A33 PolarHBondContact O-N 3.33Å; I30-A33 PolarHBondContact O-N 2.94Å; V31-A33 VanDerWaalsContact C-N 3.31Å; V31-A33 PolarHBondContact O-N 3.4Å; A33-A36 PolarHBondContact O-N 3.17Å; A33-I37 VanDerWaalsContact O-CG1 3.28Å; A33-I37 WeakPolarHBondContact O-CG1 3.4Å; A33-I37 PolarHBondContact O-N 3.3Å
34	N	95.2	Very high	93.1	Very high	88 Å²	88	85.6 Å²	85.6	47%	0.471	45%	0.447	S	S	.	.	H	α-helix	trans	-62.5	-45	174.2	-86.5	-88.3	0	0	0	111.8	I30 V31 A36 I37 L38	I30-N34 PolarHBondContact O-N 3.31Å; I30-N34 PolarHBondContact O-ND2 3.09Å; V31-N34 WeakPolarHBondContact O-CB 3.34Å; V31-N34 PolarHBondContact O-N 2.86Å; V31-N34 VanDerWaalsContact O-N 3.17Å; N34-A36 VanDerWaalsContact C-N 3.32Å; N34-A36 PolarHBondContact O-N 3.4Å; N34-I37 PolarHBondContact O-N 2.86Å; N34-L38 WeakPolarHBondContact O-CB 3.34Å; N34-L38 WeakPolarHBondContact O-CG 3.36Å; N34-L38 PolarHBondContact O-N 3.22Å
35	Y	96.1	Very high	93.5	Very high	157 Å²	157	87.3 Å²	87.3	62%	0.616	44%	0.443	S	S	*	.	H	α-helix	trans	-61.4	-41.1	175	-73.5	-49.8	0	0	0	112.3	V31 M32 L38 F39	V31-Y35 HydrophobicContact CG1-CD2 3.75Å; V31-Y35 HydrophobicContact CG1-CE2 3.34Å; V31-Y35 WeakPolarHBondContact O-CD2 3.42Å; V31-Y35 PolarHBondContact O-N 3.47Å; M32-Y35 PolarHBondContact O-N 2.99Å; Y35-L38 PolarHBondContact O-N 3.41Å; Y35-F39 VanDerWaalsContact O-CB 3.23Å; Y35-F39 WeakPolarHBondContact O-CB 3.5Å; Y35-F39 PolarHBondContact O-N 2.89Å
36	A	95.6	Very high	93.8	Very high	58 Å²	58	90.9 Å²	90.9	48%	0.479	45%	0.454	S	S	.	.	H	α-helix	trans	-62.8	-43.7	176.3	0	0	0	0	0	112.1	M32 A33 N34 F39 A40	M32-A36 WeakPolarHBondContact O-CB 3.34Å; M32-A36 PolarHBondContact O-N 2.97Å; A33-A36 PolarHBondContact O-N 3.17Å; N34-A36 VanDerWaalsContact C-N 3.32Å; N34-A36 PolarHBondContact O-N 3.4Å; A36-F39 PolarHBondContact O-N 2.96Å; A36-A40 VanDerWaalsContact O-CB 3.23Å; A36-A40 WeakPolarHBondContact O-CB 3.39Å; A36-A40 PolarHBondContact O-N 3.11Å
37	I	96.5	Very high	94	Very high	118 Å²	118	96.3 Å²	96.3	61%	0.605	48%	0.481	S	S	*	.	H	α-helix	trans	-63.9	-46.7	177.5	-70.3	165.4	0	0	0	110.9	A33 N34 A40 G41	A33-I37 VanDerWaalsContact O-CG1 3.28Å; A33-I37 WeakPolarHBondContact O-CG1 3.4Å; A33-I37 PolarHBondContact O-N 3.3Å; N34-I37 PolarHBondContact O-N 2.86Å; I37-A40 PolarHBondContact O-N 3.04Å; I37-G41 PolarHBondContact O-N 3.5Å
38	L	96.7	Very high	93.9	Very high	109 Å²	109	97.6 Å²	97.6	57%	0.571	49%	0.486	S	S	*	.	H	α-helix	trans	-61.1	-46.9	177.6	-74.3	171.8	0	0	0	111.2	N34 Y35 G41 I42	N34-L38 WeakPolarHBondContact O-CB 3.34Å; N34-L38 WeakPolarHBondContact O-CG 3.36Å; N34-L38 PolarHBondContact O-N 3.22Å; Y35-L38 PolarHBondContact O-N 3.41Å; L38-G41 PolarHBondContact O-N 2.84Å; L38-I42 VanDerWaalsContact O-CG1 3.31Å; L38-I42 WeakPolarHBondContact O-CG1 3.12Å; L38-I42 PolarHBondContact O-N 3.39Å
39	F	96.6	Very high	93.5	Very high	157 Å²	157	93.4 Å²	93.4	69%	0.689	47%	0.472	S	S	*	.	H	α-helix	trans	-60.9	-47.1	177.6	-178.3	-97	0	0	0	111.9	Y35 A36 G41 I42 A43	Y35-F39 VanDerWaalsContact O-CB 3.23Å; Y35-F39 WeakPolarHBondContact O-CB 3.5Å; Y35-F39 PolarHBondContact O-N 2.89Å; A36-F39 PolarHBondContact O-N 2.96Å; F39-G41 VanDerWaalsContact C-N 3.34Å; F39-G41 PolarHBondContact O-N 3.49Å; F39-I42 PolarHBondContact O-N 3.02Å; F39-A43 WeakPolarHBondContact O-CB 3.42Å; F39-A43 PolarHBondContact O-N 3.33Å
40	A	96.7	Very high	92.8	Very high	44 Å²	44	97.9 Å²	97.9	36%	0.364	49%	0.49	S	S	.	.	H	α-helix	trans	-61.4	-41.6	176.5	0	0	0	0	0	111.8	A36 I37 A43 I44	A36-A40 VanDerWaalsContact O-CB 3.23Å; A36-A40 WeakPolarHBondContact O-CB 3.39Å; A36-A40 PolarHBondContact O-N 3.11Å; I37-A40 PolarHBondContact O-N 3.04Å; A40-A43 PolarHBondContact O-N 3.13Å; A40-I44 WeakPolarHBondContact O-CB 3.43Å; A40-I44 VanDerWaalsContact O-CG1 3.22Å; A40-I44 WeakPolarHBondContact O-CG1 3.27Å; A40-I44 PolarHBondContact O-N 2.89Å
41	G	96.5	Very high	91.9	Very high	40 Å²	40	102.5 Å²	102.5	41%	0.412	51%	0.508	S	S	.	.	H	α-helix	trans	-59.3	-47.4	175.5	0	0	0	0	0	112.3	I37 L38 F39 I44 W45	I37-G41 PolarHBondContact O-N 3.5Å; L38-G41 PolarHBondContact O-N 2.84Å; F39-G41 VanDerWaalsContact C-N 3.34Å; F39-G41 PolarHBondContact O-N 3.49Å; G41-I44 PolarHBondContact O-N 3.46Å; G41-W45 WeakPolarHBondContact O-CB 3.43Å; G41-W45 PolarHBondContact O-N 3.36Å
42	I	95.1	Very high	90.9	Very high	109 Å²	109	106.5 Å²	106.5	56%	0.559	52%	0.52	S	S	*	.	H	α-helix	trans	-63.4	-43.9	176.3	-66.1	165.9	0	0	0	110.7	L38 F39 W45 R46	L38-I42 VanDerWaalsContact O-CG1 3.31Å; L38-I42 WeakPolarHBondContact O-CG1 3.12Å; L38-I42 PolarHBondContact O-N 3.39Å; F39-I42 PolarHBondContact O-N 3.02Å; I42-W45 PolarHBondContact O-N 3.48Å; I42-R46 WeakPolarHBondContact O-CB 3.32Å; I42-R46 PolarHBondContact O-N 3.17Å
43	A	95.9	Very high	89.8	Confident	34 Å²	34	109.5 Å²	109.5	28%	0.281	53%	0.53	S	S	.	.	H	α-helix	trans	-61.9	-46.3	178.5	0	0	0	0	0	111.6	F39 A40 R46 M47	F39-A43 WeakPolarHBondContact O-CB 3.42Å; F39-A43 PolarHBondContact O-N 3.33Å; A40-A43 PolarHBondContact O-N 3.13Å; A43-R46 PolarHBondContact O-N 2.88Å; A43-M47 WeakPolarHBondContact O-CB 3.02Å; A43-M47 WeakPolarHBondContact O-CG 3.3Å; A43-M47 PolarHBondContact O-N 3.2Å
44	I	94.1	Very high	88.8	Confident	81 Å²	81	110.5 Å²	110.5	42%	0.415	54%	0.538	S	S	.	.	H	α-helix	trans	-62.9	-44.3	176.6	-69	165.9	0	0	0	110.6	A40 G41 R46 M47 R48	A40-I44 WeakPolarHBondContact O-CB 3.43Å; A40-I44 VanDerWaalsContact O-CG1 3.22Å; A40-I44 WeakPolarHBondContact O-CG1 3.27Å; A40-I44 PolarHBondContact O-N 2.89Å; G41-I44 PolarHBondContact O-N 3.46Å; I44-R46 VanDerWaalsContact C-N 3.34Å; I44-R46 PolarHBondContact O-N 3.12Å; I44-M47 HydrophobicContact CG1-CE 4.15Å; I44-M47 PolarHBondContact O-N 3.41Å; I44-R48 HydrophobicContact CG2-CG 4.3Å; I44-R48 WeakPolarHBondContact O-CB 3.22Å; I44-R48 WeakPolarHBondContact O-CG 3.44Å; I44-R48 PolarHBondContact O-N 3.01Å
45	W	93.8	Very high	87.6	Confident	183 Å²	183	111.8 Å²	111.8	69%	0.693	55%	0.545	S	S	*	.	H	α-helix	trans	-62	-41.8	177.2	179.1	77.2	0	0	0	112.1	G41 I42 R48 S49	G41-W45 WeakPolarHBondContact O-CB 3.43Å; G41-W45 PolarHBondContact O-N 3.36Å; I42-W45 PolarHBondContact O-N 3.48Å; W45-R48 PolarHBondContact O-N 3.08Å; W45-S49 VanDerWaalsContact O-CB 3.3Å; W45-S49 WeakPolarHBondContact O-CB 3.22Å; W45-S49 PolarHBondContact O-N 3.37Å; W45-S49 PolarHBondContact O-OG 3.26Å
46	R	91.5	Very high	86.4	Confident	162 Å²	162	111.6 Å²	111.6	61%	0.611	55%	0.547	S	S	*	.	H	α-helix	trans	-64	-44.7	175.3	-173.8	176.2	176.5	98.7	-4.8	111.6	I42 A43 I44 S49 K50	I42-R46 WeakPolarHBondContact O-CB 3.32Å; I42-R46 PolarHBondContact O-N 3.17Å; A43-R46 PolarHBondContact O-N 2.88Å; I44-R46 VanDerWaalsContact C-N 3.34Å; I44-R46 PolarHBondContact O-N 3.12Å; R46-S49 PolarHBondContact O-N 3.31Å; R46-K50 WeakPolarHBondContact O-CG 3.43Å; R46-K50 PolarHBondContact O-N 3.3Å; R46-K50 VanDerWaalsContact O-N 3.08Å
47	M	89.8	Confident	85.3	Confident	114 Å²	114	116.5 Å²	116.5	56%	0.562	56%	0.557	S	S	*	*	H	α-helix	trans	-63.6	-44.4	176.4	-72.7	-172.5	-68.2	0	0	112	A43 I44 K50 K51	A43-M47 WeakPolarHBondContact O-CB 3.02Å; A43-M47 WeakPolarHBondContact O-CG 3.3Å; A43-M47 PolarHBondContact O-N 3.2Å; I44-M47 HydrophobicContact CG1-CE 4.15Å; I44-M47 PolarHBondContact O-N 3.41Å; M47-K50 PolarHBondContact O-N 3.36Å; M47-K51 PolarHBondContact O-N 3.29Å; M47-K51 VanDerWaalsContact O-N 3.12Å
48	R	87.1	Confident	84.1	Confident	175 Å²	175	117.1 Å²	117.1	66%	0.66	56%	0.562	S	S	*	*	H	α-helix	trans	-64.2	-40.3	176.4	-74.6	-175.3	171.8	-169.3	-0.8	111.9	I44 W45 K50 K51 K52	I44-R48 HydrophobicContact CG2-CG 4.3Å; I44-R48 WeakPolarHBondContact O-CB 3.22Å; I44-R48 WeakPolarHBondContact O-CG 3.44Å; I44-R48 PolarHBondContact O-N 3.01Å; W45-R48 PolarHBondContact O-N 3.08Å; R48-K50 VanDerWaalsContact C-N 3.32Å; R48-K50 PolarHBondContact O-N 3.21Å; R48-K51 PolarHBondContact O-N 3.39Å; R48-K52 WeakPolarHBondContact O-CG 3.4Å; R48-K52 PolarHBondContact O-N 3.32Å
49	S	80.9	Confident	82.7	Confident	39 Å²	39	119.9 Å²	119.9	27%	0.273	57%	0.572	S	S	.	*	H	α-helix	trans	-62.9	-37.4	176.2	-65	0	0	0	0	112.4	W45 R46 K52 K53	W45-S49 VanDerWaalsContact O-CB 3.3Å; W45-S49 WeakPolarHBondContact O-CB 3.22Å; W45-S49 PolarHBondContact O-N 3.37Å; W45-S49 PolarHBondContact O-OG 3.26Å; R46-S49 PolarHBondContact O-N 3.31Å; S49-K52 PolarHBondContact O-N 3.32Å; S49-K53 PolarHBondContact O-N 2.76Å
50	K	76.3	Confident	80.9	Confident	135 Å²	135	120.5 Å²	120.5	59%	0.587	59%	0.589	S	S	*	*	H	α-helix	trans	-65.4	-42.4	173.2	-72.9	-171.8	175.6	-159.2	0	112.4	R46 M47 R48 K52 K53 A54	R46-K50 WeakPolarHBondContact O-CG 3.43Å; R46-K50 PolarHBondContact O-N 3.3Å; R46-K50 VanDerWaalsContact O-N 3.08Å; M47-K50 PolarHBondContact O-N 3.36Å; R48-K50 VanDerWaalsContact C-N 3.32Å; R48-K50 PolarHBondContact O-N 3.21Å; K50-K52 VanDerWaalsContact C-N 3.34Å; K50-K52 PolarHBondContact O-N 3.06Å; K50-K53 PolarHBondContact O-N 3.43Å; K50-A54 PolarHBondContact O-N 3.14Å
51	K	73.4	Confident	80.1	Confident	150 Å²	150	124.3 Å²	124.3	65%	0.652	60%	0.6	S	S	*	*	H	α-helix	trans	-60.5	-42.1	176.4	-68.7	-172	178.9	-166.1	0	112	M47 R48 K53 A54 L55	M47-K51 PolarHBondContact O-N 3.29Å; M47-K51 VanDerWaalsContact O-N 3.12Å; R48-K51 PolarHBondContact O-N 3.39Å; K51-K53 VanDerWaalsContact C-N 3.29Å; K51-K53 PolarHBondContact O-N 3.3Å; K51-A54 PolarHBondContact O-N 3.36Å; K51-L55 WeakPolarHBondContact O-CG 3.31Å; K51-L55 PolarHBondContact O-N 2.89Å
52	K	72.8	Confident	79.2	Confident	153 Å²	153	128.7 Å²	128.7	67%	0.665	61%	0.61	S	S	*	*	H	α-helix	trans	-62.3	-33.2	176	-67.7	-171.1	178.9	-156.7	0	113.4	R48 S49 K50 K56	R48-K52 WeakPolarHBondContact O-CG 3.4Å; R48-K52 PolarHBondContact O-N 3.32Å; S49-K52 PolarHBondContact O-N 3.32Å; K50-K52 VanDerWaalsContact C-N 3.34Å; K50-K52 PolarHBondContact O-N 3.06Å; K52-K56 WeakPolarHBondContact O-CG 3.27Å; K52-K56 PolarHBondContact O-N 3.32Å
53	K	72.3	Confident	78.3	Confident	163 Å²	163	129.8 Å²	129.8	71%	0.709	61%	0.612	S	S	*	*	H	α-helix	trans	-73.5	-37.1	176	-70.9	-174.7	179.8	-167.4	0	112.6	S49 K50 K51 K57	S49-K53 PolarHBondContact O-N 2.76Å; K50-K53 PolarHBondContact O-N 3.43Å; K51-K53 VanDerWaalsContact C-N 3.29Å; K51-K53 PolarHBondContact O-N 3.3Å; K53-K57 PolarHBondContact O-N 2.7Å
54	A	71.4	Confident	77.3	Confident	52 Å²	52	135.5 Å²	135.5	43%	0.43	63%	0.632	S	S	.	*	H	α-helix	trans	-62.8	-51.7	175.1	0	0	0	0	0	110.4	K50 K51 K56 K57 D58	K50-A54 PolarHBondContact O-N 3.14Å; K51-A54 PolarHBondContact O-N 3.36Å; A54-K56 VanDerWaalsContact C-N 3.3Å; A54-K56 PolarHBondContact O-N 2.83Å; A54-K57 WeakPolarHBondContact O-CB 3.33Å; A54-K57 PolarHBondContact O-N 3.29Å; A54-D58 PolarHBondContact O-N 2.81Å
55	L	70.8	Confident	76.2	Confident	115 Å²	115	138.9 Å²	138.9	60%	0.602	65%	0.645	S	S	*	*	H	α-helix	trans	-57.5	-39.6	179.4	-64.8	171.1	0	0	0	113.1	K51 K57 D58	K51-L55 WeakPolarHBondContact O-CG 3.31Å; K51-L55 PolarHBondContact O-N 2.89Å; L55-K57 VanDerWaalsContact C-N 3.32Å; L55-K57 PolarHBondContact O-N 3.38Å; L55-D58 PolarHBondContact O-N 3.02Å
56	K	71.3	Confident	75.1	Confident	152 Å²	152	135.9 Å²	135.9	66%	0.661	64%	0.642	S	S	*	*	H	α-helix	trans	-69.4	-25.1	176.4	-79.6	-171.4	174.1	-164	0	114.4	K52 A54 D58	K52-K56 WeakPolarHBondContact O-CG 3.27Å; K52-K56 PolarHBondContact O-N 3.32Å; A54-K56 VanDerWaalsContact C-N 3.3Å; A54-K56 PolarHBondContact O-N 2.83Å; K56-D58 VanDerWaalsContact C-N 3.33Å
57	K	72.7	Confident	73.9	Confident	162 Å²	162	134.1 Å²	134.1	70%	0.704	65%	0.645	S	S	*	*	H	α-helix	trans	-78	-25.1	178.1	-175.6	176.1	176.2	-178.4	0	111.3	K53 A54 L55 E59	K53-K57 PolarHBondContact O-N 2.7Å; A54-K57 WeakPolarHBondContact O-CB 3.33Å; A54-K57 PolarHBondContact O-N 3.29Å; L55-K57 VanDerWaalsContact C-N 3.32Å; L55-K57 PolarHBondContact O-N 3.38Å; K57-E59 VanDerWaalsContact C-N 3.33Å
58	D	71.2	Confident	72.7	Confident	130 Å²	130	135.6 Å²	135.6	70%	0.695	65%	0.651	S	S	*	*	H	α-helix	trans	-82	-13.2	179.3	-54.2	-38	0	0	0	112.3	A54 L55 K56	A54-D58 PolarHBondContact O-N 2.81Å; L55-D58 PolarHBondContact O-N 3.02Å; K56-D58 VanDerWaalsContact C-N 3.33Å
59	E	66	Low	71.5	Confident	167 Å²	167	132.3 Å²	132.3	78%	0.78	65%	0.65	S	S	*	*			trans	-95.7	-7.5	178.5	-68.3	-179	143.4	0	0	114.4	K57	K57-E59 VanDerWaalsContact C-N 3.33Å
60	T	58.5	Low	70.6	Confident	170 Å²	170	140.8 Å²	140.8	100%	1.043	68%	0.684	S	S	*	*			trans	-118.9	0	177.6	50.3	0	0	0	0	111.5

Retrieved 60 of 60 residues in 227.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).