A0A146MGE6_SCHMA Loading...

Cytochrome b-c1 complex subunit 10 AlphaSync

AlphaFold DB , UniProt , Accession A0A146MGE6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 65 aa.

						>A0A146MGE6_SCHMA|A0A146MGE6
MDSILRNLKYSRDALTPLISLAKTWRRPAAAWTVTAGVLFVYFTDWKVICTRIPLYNRKFLDSDE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.6	Confident	81.2	Confident	179 Å²	179	120.3 Å²	120.3	88%	0.882	60%	0.596	S	S	*	*				0	-44.7	0	-156.3	90.8	77.2	0	0	111.6	S3 I4 L5	M1-S3 VanDerWaalsContact C-N 3.32Å; M1-S3 PolarHBondContact O-N 3.13Å; M1-I4 PolarHBondContact O-N 3.21Å; M1-L5 HydrophobicContact CG-CD1 4.31Å; M1-L5 PolarHBondContact O-N 3.3Å
2	D	79.5	Confident	81.1	Confident	109 Å²	109	122.9 Å²	122.9	58%	0.583	60%	0.595	S	S	*	*	H	α-helix	trans	-68.2	-19.3	-167.5	-49.4	-38.5	0	0	0	116.2	R6	D2-R6 WeakPolarHBondContact O-CB 3.29Å; D2-R6 VanDerWaalsContact O-CG 3.31Å; D2-R6 WeakPolarHBondContact O-CG 3.39Å; D2-R6 PolarHBondContact O-N 3.42Å; D2-R6 PolarHBondContact O-NE 3.12Å; D2-R6 VanDerWaalsContact O-NE 3.09Å
3	S	80.1	Confident	81.3	Confident	71 Å²	71	119.5 Å²	119.5	50%	0.497	58%	0.581	S	S	.	*	H	α-helix	trans	-70	-40.2	173	50	0	0	0	0	112.2	M1 R6 N7	M1-S3 VanDerWaalsContact C-N 3.32Å; M1-S3 PolarHBondContact O-N 3.13Å; S3-R6 PolarHBondContact O-N 3.38Å; S3-N7 PolarHBondContact O-N 3.31Å
4	I	80.1	Confident	81.6	Confident	111 Å²	111	115.5 Å²	115.5	57%	0.569	58%	0.577	S	S	*	*	H	α-helix	trans	-68.6	-43.9	179.3	-62	174.5	0	0	0	110.3	M1 R6 N7 L8	M1-I4 PolarHBondContact O-N 3.21Å; I4-R6 VanDerWaalsContact C-N 3.33Å; I4-R6 PolarHBondContact O-N 3.29Å; I4-N7 PolarHBondContact O-N 2.97Å; I4-L8 HydrophobicContact CG2-CD1 4.22Å; I4-L8 PolarHBondContact O-N 2.95Å
5	L	83.9	Confident	82.1	Confident	102 Å²	102	113.8 Å²	113.8	53%	0.534	57%	0.57	S	S	.	*	H	α-helix	trans	-63.1	-38.5	177.5	-63.6	177.8	0	0	0	112.1	M1 K9	M1-L5 HydrophobicContact CG-CD1 4.31Å; M1-L5 PolarHBondContact O-N 3.3Å; L5-K9 PolarHBondContact O-N 3.01Å
6	R	83.6	Confident	82.6	Confident	159 Å²	159	111.4 Å²	111.4	60%	0.6	56%	0.564	S	S	*	*	H	α-helix	trans	-65.1	-45.6	174.4	-78.7	-178	-72.1	-177.9	-0.2	112.1	D2 S3 I4 L8 K9 Y10	D2-R6 WeakPolarHBondContact O-CB 3.29Å; D2-R6 VanDerWaalsContact O-CG 3.31Å; D2-R6 WeakPolarHBondContact O-CG 3.39Å; D2-R6 PolarHBondContact O-N 3.42Å; D2-R6 PolarHBondContact O-NE 3.12Å; D2-R6 VanDerWaalsContact O-NE 3.09Å; S3-R6 PolarHBondContact O-N 3.38Å; I4-R6 VanDerWaalsContact C-N 3.33Å; I4-R6 PolarHBondContact O-N 3.29Å; R6-L8 PolarHBondContact O-N 3.45Å; R6-K9 PolarHBondContact O-N 3.28Å; R6-Y10 VanDerWaalsContact O-CD2 3.24Å; R6-Y10 WeakPolarHBondContact O-CD2 3.48Å; R6-Y10 PolarHBondContact O-N 3.12Å
7	N	82.4	Confident	83.1	Confident	113 Å²	113	109.4 Å²	109.4	60%	0.604	56%	0.559	S	S	*	*	H	α-helix	trans	-61	-41.6	176.7	-84.3	-13	0	0	0	112.5	S3 I4 K9 Y10 S11	S3-N7 PolarHBondContact O-N 3.31Å; I4-N7 PolarHBondContact O-N 2.97Å; N7-K9 VanDerWaalsContact C-N 3.34Å; N7-K9 PolarHBondContact O-N 2.7Å; N7-Y10 PolarHBondContact O-N 3.27Å; N7-S11 PolarHBondContact O-N 3.37Å; N7-S11 PolarHBondContact O-OG 3.4Å
8	L	85.9	Confident	83.6	Confident	112 Å²	112	109.2 Å²	109.2	59%	0.586	56%	0.559	S	S	*	*	H	α-helix	trans	-62.1	-40.8	174.6	-80.9	165.5	0	0	0	112.3	I4 R6 S11 R12	I4-L8 HydrophobicContact CG2-CD1 4.22Å; I4-L8 PolarHBondContact O-N 2.95Å; R6-L8 PolarHBondContact O-N 3.45Å; L8-S11 PolarHBondContact O-N 3.05Å; L8-R12 WeakPolarHBondContact O-CB 3.38Å; L8-R12 PolarHBondContact O-N 2.94Å
9	K	81.9	Confident	84.1	Confident	121 Å²	121	107.9 Å²	107.9	53%	0.526	55%	0.553	S	S	.	*	H	α-helix	trans	-64.8	-45.2	177.3	-166.8	-178.6	175.8	-170.7	0	111.4	L5 R6 N7 S11 R12 D13	L5-K9 PolarHBondContact O-N 3.01Å; R6-K9 PolarHBondContact O-N 3.28Å; N7-K9 VanDerWaalsContact C-N 3.34Å; N7-K9 PolarHBondContact O-N 2.7Å; K9-S11 PolarHBondContact O-N 2.72Å; K9-R12 PolarHBondContact O-N 3.39Å; K9-D13 WeakPolarHBondContact O-CB 3.47Å; K9-D13 PolarHBondContact O-N 3.32Å
10	Y	81.4	Confident	84.5	Confident	176 Å²	176	105.9 Å²	105.9	69%	0.69	55%	0.549	S	S	*	.	H	α-helix	trans	-58.4	-45.3	174.8	-86.6	-72.5	0	0	0	112.3	R6 N7 R12 D13 A14	R6-Y10 VanDerWaalsContact O-CD2 3.24Å; R6-Y10 WeakPolarHBondContact O-CD2 3.48Å; R6-Y10 PolarHBondContact O-N 3.12Å; N7-Y10 PolarHBondContact O-N 3.27Å; Y10-R12 PolarHBondContact O-N 3.36Å; Y10-D13 PolarHBondContact O-N 3.31Å; Y10-A14 WeakPolarHBondContact O-CB 3.41Å; Y10-A14 PolarHBondContact O-N 3.45Å
11	S	82.6	Confident	85	Confident	70 Å²	70	105.4 Å²	105.4	49%	0.49	55%	0.546	S	S	.	.	H	α-helix	trans	-62.6	-42	176.6	-63	0	0	0	0	112.3	N7 L8 K9 A14 L15	N7-S11 PolarHBondContact O-N 3.37Å; N7-S11 PolarHBondContact O-OG 3.4Å; L8-S11 PolarHBondContact O-N 3.05Å; K9-S11 PolarHBondContact O-N 2.72Å; S11-A14 PolarHBondContact O-N 3.38Å; S11-L15 WeakPolarHBondContact O-CB 3.26Å; S11-L15 WeakPolarHBondContact O-CD1 3.42Å; S11-L15 PolarHBondContact O-N 3.23Å
12	R	80.1	Confident	86.1	Confident	152 Å²	152	99.8 Å²	99.8	57%	0.574	53%	0.528	S	S	*	.	H	α-helix	trans	-65.5	-42.3	177.4	-171	-170	70.6	171.3	4	111.9	L8 K9 Y10 A14 L15 T16	L8-R12 WeakPolarHBondContact O-CB 3.38Å; L8-R12 PolarHBondContact O-N 2.94Å; K9-R12 PolarHBondContact O-N 3.39Å; Y10-R12 PolarHBondContact O-N 3.36Å; R12-A14 VanDerWaalsContact C-N 3.27Å; R12-A14 PolarHBondContact O-N 3.13Å; R12-L15 PolarHBondContact O-N 2.83Å; R12-L15 VanDerWaalsContact O-N 3.14Å; R12-T16 PolarHBondContact O-N 3.5Å; R12-T16 PolarHBondContact O-OG1 2.93Å
13	D	83.9	Confident	86.8	Confident	78 Å²	78	101.3 Å²	101.3	42%	0.417	53%	0.53	S	S	.	.	H	α-helix	trans	-67.9	-32.7	-179.5	-65.2	-9.3	0	0	0	110.1	K9 Y10 P17	K9-D13 WeakPolarHBondContact O-CB 3.47Å; K9-D13 PolarHBondContact O-N 3.32Å; Y10-D13 PolarHBondContact O-N 3.31Å; D13-P17 VanDerWaalsContact O-CD 3.25Å; D13-P17 WeakPolarHBondContact O-CD 3.46Å
14	A	86.2	Confident	87.6	Confident	64 Å²	64	102.9 Å²	102.9	53%	0.529	54%	0.537	S	S	.	.	H	α-helix	trans	-69.8	-33.3	169.4	0	0	0	0	0	113.9	Y10 S11 R12 P17	Y10-A14 WeakPolarHBondContact O-CB 3.41Å; Y10-A14 PolarHBondContact O-N 3.45Å; S11-A14 PolarHBondContact O-N 3.38Å; R12-A14 VanDerWaalsContact C-N 3.27Å; R12-A14 PolarHBondContact O-N 3.13Å; A14-P17 WeakPolarHBondContact O-CD 3.38Å; A14-P17 WeakPolarHBondContact O-CG 3.49Å
15	L	88.1	Confident	88.4	Confident	90 Å²	90	104.9 Å²	104.9	47%	0.471	54%	0.537	S	S	.	.	H	α-helix	trans	-76.9	-26.7	177.6	-86.5	155.1	0	0	0	113.6	S11 R12 L18 I19	S11-L15 WeakPolarHBondContact O-CB 3.26Å; S11-L15 WeakPolarHBondContact O-CD1 3.42Å; S11-L15 PolarHBondContact O-N 3.23Å; R12-L15 PolarHBondContact O-N 2.83Å; R12-L15 VanDerWaalsContact O-N 3.14Å; L15-L18 HydrophobicContact CD2-CD1 4.42Å; L15-L18 WeakPolarHBondContact O-CB 3.28Å; L15-L18 PolarHBondContact O-N 2.89Å; L15-L18 VanDerWaalsContact O-N 3.09Å; L15-I19 HydrophobicContact CB-CD1 4.42Å; L15-I19 WeakPolarHBondContact O-CG1 3.48Å; L15-I19 PolarHBondContact O-N 3.36Å
16	T	90.6	Very high	89	Confident	76 Å²	76	107.6 Å²	107.6	47%	0.466	54%	0.54	S	S	.	.	H	α-helix	trans	-54.3	-48.2	-177.4	-60.5	0	0	0	0	113.8	R12 L18 I19 S20	R12-T16 PolarHBondContact O-N 3.5Å; R12-T16 PolarHBondContact O-OG1 2.93Å; T16-L18 VanDerWaalsContact C-N 3.33Å; T16-L18 PolarHBondContact O-N 3Å; T16-I19 PolarHBondContact O-N 2.65Å; T16-S20 PolarHBondContact O-N 3.48Å; T16-S20 VanDerWaalsContact O-N 3.13Å
17	P	91.4	Very high	89.6	Confident	76 Å²	76	109.1 Å²	109.1	49%	0.494	55%	0.546	S	S	.	.	H	α-helix	trans	-66.5	-31.7	175.9	25.6	-35.2	0	0	0	113.3	D13 A14 I19 S20 L21	D13-P17 VanDerWaalsContact O-CD 3.25Å; D13-P17 WeakPolarHBondContact O-CD 3.46Å; A14-P17 WeakPolarHBondContact O-CD 3.38Å; A14-P17 WeakPolarHBondContact O-CG 3.49Å; P17-I19 VanDerWaalsContact C-N 3.35Å; P17-S20 PolarHBondContact O-N 2.92Å; P17-S20 PolarHBondContact O-OG 3.48Å; P17-L21 WeakPolarHBondContact O-CB 3.46Å; P17-L21 PolarHBondContact O-N 2.77Å
18	L	91.2	Very high	90.3	Very high	106 Å²	106	106.2 Å²	106.2	56%	0.555	53%	0.533	S	S	*	.	H	α-helix	trans	-66.5	-40.1	175.2	-65.4	173.9	0	0	0	111.2	L15 T16 L21 A22	L15-L18 HydrophobicContact CD2-CD1 4.42Å; L15-L18 WeakPolarHBondContact O-CB 3.28Å; L15-L18 PolarHBondContact O-N 2.89Å; L15-L18 VanDerWaalsContact O-N 3.09Å; T16-L18 VanDerWaalsContact C-N 3.33Å; T16-L18 PolarHBondContact O-N 3Å; L18-L21 PolarHBondContact O-N 2.93Å; L18-A22 VanDerWaalsContact O-CB 3.31Å; L18-A22 WeakPolarHBondContact O-CB 3.4Å; L18-A22 PolarHBondContact O-N 3.31Å
19	I	93.4	Very high	90.8	Very high	85 Å²	85	103.1 Å²	103.1	44%	0.436	52%	0.524	S	S	.	.	H	α-helix	trans	-65.7	-39	177.3	-66	165.2	0	0	0	111	L15 T16 P17 K23	L15-I19 HydrophobicContact CB-CD1 4.42Å; L15-I19 WeakPolarHBondContact O-CG1 3.48Å; L15-I19 PolarHBondContact O-N 3.36Å; T16-I19 PolarHBondContact O-N 2.65Å; P17-I19 VanDerWaalsContact C-N 3.35Å; I19-K23 HydrophobicContact CG2-CD 4.27Å; I19-K23 WeakPolarHBondContact O-CB 3.3Å; I19-K23 VanDerWaalsContact O-CG 3.31Å; I19-K23 WeakPolarHBondContact O-CG 3.47Å; I19-K23 PolarHBondContact O-N 3.45Å
20	S	92.8	Very high	91.6	Very high	67 Å²	67	99.8 Å²	99.8	47%	0.469	52%	0.519	S	S	.	.	H	α-helix	trans	-68.4	-40	177.3	67.2	0	0	0	0	112	T16 P17 K23 T24	T16-S20 PolarHBondContact O-N 3.48Å; T16-S20 VanDerWaalsContact O-N 3.13Å; P17-S20 PolarHBondContact O-N 2.92Å; P17-S20 PolarHBondContact O-OG 3.48Å; S20-K23 PolarHBondContact O-N 3.33Å; S20-T24 PolarHBondContact O-N 2.94Å; S20-T24 VanDerWaalsContact O-N 3.1Å; S20-T24 PolarHBondContact O-OG1 3.46Å
21	L	94.2	Very high	92.4	Very high	96 Å²	96	94 Å²	94	50%	0.503	51%	0.508	S	S	.	.	H	α-helix	trans	-61.7	-50	173.2	-172	71.2	0	0	0	110.8	P17 L18 K23 T24 W25	P17-L21 WeakPolarHBondContact O-CB 3.46Å; P17-L21 PolarHBondContact O-N 2.77Å; L18-L21 PolarHBondContact O-N 2.93Å; L21-K23 VanDerWaalsContact C-N 3.3Å; L21-K23 PolarHBondContact O-N 3.38Å; L21-T24 PolarHBondContact O-N 3.35Å; L21-W25 VanDerWaalsContact CD1-CD1 3.47Å; L21-W25 PolarHBondContact O-N 3.2Å
22	A	94.9	Very high	93.1	Very high	61 Å²	61	99.5 Å²	99.5	50%	0.504	52%	0.518	S	S	.	.	H	α-helix	trans	-58.1	-41.2	177.7	0	0	0	0	0	112	L18 T24 W25 R26	L18-A22 VanDerWaalsContact O-CB 3.31Å; L18-A22 WeakPolarHBondContact O-CB 3.4Å; L18-A22 PolarHBondContact O-N 3.31Å; A22-T24 VanDerWaalsContact C-N 3.31Å; A22-T24 PolarHBondContact O-N 2.9Å; A22-W25 PolarHBondContact O-N 2.88Å; A22-R26 WeakPolarHBondContact O-CB 3.33Å; A22-R26 PolarHBondContact O-N 2.84Å
23	K	95.3	Very high	93.9	Very high	141 Å²	141	97.1 Å²	97.1	61%	0.613	52%	0.52	S	S	*	.	H	α-helix	trans	-62.2	-36.8	175.9	-81.4	176.5	-179.3	179	0	113.1	I19 S20 L21 R26	I19-K23 HydrophobicContact CG2-CD 4.27Å; I19-K23 WeakPolarHBondContact O-CB 3.3Å; I19-K23 VanDerWaalsContact O-CG 3.31Å; I19-K23 WeakPolarHBondContact O-CG 3.47Å; I19-K23 PolarHBondContact O-N 3.45Å; S20-K23 PolarHBondContact O-N 3.33Å; L21-K23 VanDerWaalsContact C-N 3.3Å; L21-K23 PolarHBondContact O-N 3.38Å; K23-R26 WeakPolarHBondContact O-CD 3.5Å; K23-R26 WeakPolarHBondContact O-CG 3.19Å
24	T	95.4	Very high	94.6	Very high	104 Å²	104	98.1 Å²	98.1	64%	0.638	53%	0.529	S	S	*	.	H	α-helix	trans	-74.3	-43.6	179.1	-53.1	0	0	0	0	110.8	S20 L21 A22	S20-T24 PolarHBondContact O-N 2.94Å; S20-T24 VanDerWaalsContact O-N 3.1Å; S20-T24 PolarHBondContact O-OG1 3.46Å; L21-T24 PolarHBondContact O-N 3.35Å; A22-T24 VanDerWaalsContact C-N 3.31Å; A22-T24 PolarHBondContact O-N 2.9Å
25	W	96.4	Very high	95.2	Very high	154 Å²	154	99 Å²	99	58%	0.583	53%	0.528	S	S	*	.	H	α-helix	trans	-83.4	-10.6	-176.5	-78.1	84.4	0	0	0	115	L21 A22 R27 P28 A29	L21-W25 VanDerWaalsContact CD1-CD1 3.47Å; L21-W25 PolarHBondContact O-N 3.2Å; A22-W25 PolarHBondContact O-N 2.88Å; W25-R27 VanDerWaalsContact C-N 3.25Å; W25-R27 PolarHBondContact O-N 3.48Å; W25-R27 VanDerWaalsContact O-N 3.15Å; W25-P28 HydrophobicContact CE3-CG 4.09Å; W25-P28 WeakPolarHBondContact O-CD 3.28Å; W25-P28 VanDerWaalsContact O-CG 3.3Å; W25-P28 WeakPolarHBondContact O-CG 3.3Å; W25-A29 WeakPolarHBondContact O-CB 3.32Å; W25-A29 PolarHBondContact O-N 2.71Å
26	R	96.7	Very high	95.7	Very high	159 Å²	159	97.6 Å²	97.6	60%	0.6	53%	0.529	S	S	*	.	H	α-helix	trans	-53.4	-40.2	-177.1	73	-173	175.9	155.1	-0.1	113.7	A22 K23 A30	A22-R26 WeakPolarHBondContact O-CB 3.33Å; A22-R26 PolarHBondContact O-N 2.84Å; K23-R26 WeakPolarHBondContact O-CD 3.5Å; K23-R26 WeakPolarHBondContact O-CG 3.19Å; R26-A30 VanDerWaalsContact O-CB 3.25Å; R26-A30 WeakPolarHBondContact O-CB 3.34Å; R26-A30 PolarHBondContact O-N 3.34Å
27	R	96	Very high	96	Very high	191 Å²	191	95.7 Å²	95.7	72%	0.721	52%	0.524	S	S	*	.	H	α-helix	trans	-70.5	-56.6	-176.9	-72.5	-179	177.3	165.8	-2.1	111.6	W25 A29 A30 A31	W25-R27 VanDerWaalsContact C-N 3.25Å; W25-R27 PolarHBondContact O-N 3.48Å; W25-R27 VanDerWaalsContact O-N 3.15Å; R27-A29 VanDerWaalsContact C-N 3.32Å; R27-A29 PolarHBondContact O-N 2.98Å; R27-A30 PolarHBondContact O-N 2.93Å; R27-A31 PolarHBondContact O-N 3.25Å; R27-A31 VanDerWaalsContact O-N 3.08Å
28	P	97.3	Very high	96.1	Very high	51 Å²	51	96.7 Å²	96.7	33%	0.331	53%	0.529	S	S	.	.	H	α-helix	trans	-62.4	-40.1	176.8	22.5	-32.5	0	0	0	111.8	W25 A30 A31 W32	W25-P28 HydrophobicContact CE3-CG 4.09Å; W25-P28 WeakPolarHBondContact O-CD 3.28Å; W25-P28 VanDerWaalsContact O-CG 3.3Å; W25-P28 WeakPolarHBondContact O-CG 3.3Å; P28-A30 VanDerWaalsContact C-N 3.34Å; P28-A30 PolarHBondContact O-N 2.83Å; P28-A31 WeakPolarHBondContact O-CB 3.38Å; P28-A31 PolarHBondContact O-N 2.98Å; P28-A31 VanDerWaalsContact O-N 3.13Å; P28-W32 PolarHBondContact O-N 2.94Å
29	A	97.4	Very high	96.4	Very high	47 Å²	47	96 Å²	96	39%	0.388	53%	0.525	S	S	.	.	H	α-helix	trans	-58.8	-44.4	176.7	0	0	0	0	0	112	W25 R27 A31 W32 T33	W25-A29 WeakPolarHBondContact O-CB 3.32Å; W25-A29 PolarHBondContact O-N 2.71Å; R27-A29 VanDerWaalsContact C-N 3.32Å; R27-A29 PolarHBondContact O-N 2.98Å; A29-A31 VanDerWaalsContact C-N 3.35Å; A29-A31 PolarHBondContact O-N 3.46Å; A29-W32 PolarHBondContact O-N 3.45Å; A29-T33 PolarHBondContact O-N 3.13Å; A29-T33 PolarHBondContact O-OG1 3.33Å
30	A	97.9	Very high	96.6	Very high	52 Å²	52	97.5 Å²	97.5	43%	0.43	53%	0.529	S	S	.	.	H	α-helix	trans	-60.7	-43.1	174.8	0	0	0	0	0	112.1	R26 R27 P28 W32 T33 V34	R26-A30 VanDerWaalsContact O-CB 3.25Å; R26-A30 WeakPolarHBondContact O-CB 3.34Å; R26-A30 PolarHBondContact O-N 3.34Å; R27-A30 PolarHBondContact O-N 2.93Å; P28-A30 VanDerWaalsContact C-N 3.34Å; P28-A30 PolarHBondContact O-N 2.83Å; A30-W32 PolarHBondContact O-N 2.91Å; A30-T33 PolarHBondContact O-N 3.33Å; A30-V34 WeakPolarHBondContact O-CG2 3.25Å; A30-V34 PolarHBondContact O-N 2.9Å
31	A	98.1	Very high	96.6	Very high	55 Å²	55	95.2 Å²	95.2	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-61.9	-43	177.6	0	0	0	0	0	112.2	R27 P28 A29 V34 T35	R27-A31 PolarHBondContact O-N 3.25Å; R27-A31 VanDerWaalsContact O-N 3.08Å; P28-A31 WeakPolarHBondContact O-CB 3.38Å; P28-A31 PolarHBondContact O-N 2.98Å; P28-A31 VanDerWaalsContact O-N 3.13Å; A29-A31 VanDerWaalsContact C-N 3.35Å; A29-A31 PolarHBondContact O-N 3.46Å; A31-V34 PolarHBondContact O-N 3.08Å; A31-T35 WeakPolarHBondContact O-CB 3.46Å; A31-T35 PolarHBondContact O-N 3.48Å; A31-T35 PolarHBondContact O-OG1 3.31Å
32	W	97.9	Very high	96.4	Very high	185 Å²	185	97.8 Å²	97.8	70%	0.701	52%	0.516	S	S	*	.	H	α-helix	trans	-65.6	-42.3	175.7	-74.3	113.5	0	0	0	112.2	P28 A29 A30 V34 T35 A36	P28-W32 PolarHBondContact O-N 2.94Å; A29-W32 PolarHBondContact O-N 3.45Å; A30-W32 PolarHBondContact O-N 2.91Å; W32-V34 PolarHBondContact O-N 3.4Å; W32-T35 PolarHBondContact O-N 3.15Å; W32-A36 VanDerWaalsContact O-CB 3.28Å; W32-A36 WeakPolarHBondContact O-CB 3.15Å; W32-A36 PolarHBondContact O-N 2.99Å
33	T	98	Very high	96.4	Very high	102 Å²	102	102.3 Å²	102.3	63%	0.626	53%	0.525	S	S	*	.	H	α-helix	trans	-61.7	-43.4	175.9	-60.9	0	0	0	0	111.7	A29 A30 G37	A29-T33 PolarHBondContact O-N 3.13Å; A29-T33 PolarHBondContact O-OG1 3.33Å; A30-T33 PolarHBondContact O-N 3.33Å; T33-G37 PolarHBondContact O-N 3.1Å
34	V	98	Very high	96.2	Very high	98 Å²	98	98.9 Å²	98.9	59%	0.594	52%	0.516	S	S	*	.	H	α-helix	trans	-63.6	-46.5	176.1	171.2	0	0	0	0	110.6	A30 A31 W32 A36 G37 V38	A30-V34 WeakPolarHBondContact O-CG2 3.25Å; A30-V34 PolarHBondContact O-N 2.9Å; A31-V34 PolarHBondContact O-N 3.08Å; W32-V34 PolarHBondContact O-N 3.4Å; V34-A36 PolarHBondContact O-N 3.03Å; V34-G37 PolarHBondContact O-N 3.4Å; V34-V38 WeakPolarHBondContact O-CG2 3.49Å; V34-V38 PolarHBondContact O-N 3.39Å
35	T	98	Very high	95.8	Very high	84 Å²	84	96 Å²	96	52%	0.515	50%	0.497	S	S	.	.	H	α-helix	trans	-61.4	-46.5	179.7	-55.8	0	0	0	0	111.4	A31 W32 G37 V38 L39	A31-T35 WeakPolarHBondContact O-CB 3.46Å; A31-T35 PolarHBondContact O-N 3.48Å; A31-T35 PolarHBondContact O-OG1 3.31Å; W32-T35 PolarHBondContact O-N 3.15Å; T35-G37 VanDerWaalsContact C-N 3.32Å; T35-G37 PolarHBondContact O-N 3.07Å; T35-V38 PolarHBondContact O-N 2.89Å; T35-L39 WeakPolarHBondContact O-CB 3.31Å; T35-L39 PolarHBondContact O-N 3.33Å
36	A	98.1	Very high	95.5	Very high	59 Å²	59	94.3 Å²	94.3	49%	0.488	49%	0.49	S	S	.	.	H	α-helix	trans	-62.5	-39.7	175.9	0	0	0	0	0	111.7	W32 V34 L39 F40	W32-A36 VanDerWaalsContact O-CB 3.28Å; W32-A36 WeakPolarHBondContact O-CB 3.15Å; W32-A36 PolarHBondContact O-N 2.99Å; V34-A36 PolarHBondContact O-N 3.03Å; A36-L39 PolarHBondContact O-N 2.93Å; A36-F40 VanDerWaalsContact O-CB 3.3Å; A36-F40 WeakPolarHBondContact O-CB 3.31Å; A36-F40 PolarHBondContact O-N 2.93Å
37	G	96.8	Very high	95	Very high	36 Å²	36	93.3 Å²	93.3	37%	0.371	49%	0.49	S	S	.	.	H	α-helix	trans	-62.4	-45.7	175.3	0	0	0	0	0	112.7	T33 V34 T35 F40 V41	T33-G37 PolarHBondContact O-N 3.1Å; V34-G37 PolarHBondContact O-N 3.4Å; T35-G37 VanDerWaalsContact C-N 3.32Å; T35-G37 PolarHBondContact O-N 3.07Å; G37-F40 PolarHBondContact O-N 3.42Å; G37-V41 WeakPolarHBondContact O-CG2 3.4Å; G37-V41 PolarHBondContact O-N 2.87Å
38	V	95.3	Very high	94.7	Very high	98 Å²	98	87.9 Å²	87.9	59%	0.594	48%	0.478	S	S	*	.	H	α-helix	trans	-62.1	-44.7	175.3	172.5	0	0	0	0	110.8	V34 T35 F40 V41 Y42	V34-V38 WeakPolarHBondContact O-CG2 3.49Å; V34-V38 PolarHBondContact O-N 3.39Å; T35-V38 PolarHBondContact O-N 2.89Å; V38-F40 VanDerWaalsContact C-N 3.33Å; V38-F40 PolarHBondContact O-N 3.42Å; V38-V41 PolarHBondContact O-N 2.9Å; V38-Y42 WeakPolarHBondContact O-CB 3.25Å; V38-Y42 PolarHBondContact O-N 2.96Å
39	L	96.4	Very high	94.3	Very high	91 Å²	91	88.8 Å²	88.8	48%	0.476	48%	0.479	S	S	.	.	H	α-helix	trans	-63	-40.1	178.4	-170.7	67.2	0	0	0	111.9	T35 A36 Y42 F43	T35-L39 WeakPolarHBondContact O-CB 3.31Å; T35-L39 PolarHBondContact O-N 3.33Å; A36-L39 PolarHBondContact O-N 2.93Å; L39-Y42 WeakPolarHBondContact O-CB 3.39Å; L39-Y42 PolarHBondContact O-N 3.46Å; L39-F43 HydrophobicContact CD1-CD2 4.05Å; L39-F43 HydrophobicContact CD1-CE2 3.58Å; L39-F43 HydrophobicContact CD1-CZ 4.35Å; L39-F43 HydrophobicContact CD2-CD2 4.5Å; L39-F43 HydrophobicContact CD2-CE2 3.97Å; L39-F43 HydrophobicContact CG-CD2 3.76Å; L39-F43 HydrophobicContact CG-CE2 3.55Å; L39-F43 VanDerWaalsContact O-CD2 3.28Å; L39-F43 WeakPolarHBondContact O-CD2 3.43Å; L39-F43 PolarHBondContact O-N 3.04Å
40	F	96.8	Very high	93.8	Very high	117 Å²	117	86.7 Å²	86.7	51%	0.513	46%	0.462	S	S	.	.	H	α-helix	trans	-63	-46.2	175.6	-179.7	-92.8	0	0	0	111.8	A36 G37 V38 Y42 F43 T44 W46	A36-F40 VanDerWaalsContact O-CB 3.3Å; A36-F40 WeakPolarHBondContact O-CB 3.31Å; A36-F40 PolarHBondContact O-N 2.93Å; G37-F40 PolarHBondContact O-N 3.42Å; V38-F40 VanDerWaalsContact C-N 3.33Å; V38-F40 PolarHBondContact O-N 3.42Å; F40-Y42 VanDerWaalsContact C-N 3.27Å; F40-Y42 PolarHBondContact O-N 3.09Å; F40-F43 PolarHBondContact O-N 2.87Å; F40-T44 HydrophobicContact CD1-CG2 4.42Å; F40-T44 HydrophobicContact CD2-CG2 4.31Å; F40-T44 HydrophobicContact CE1-CG2 4.02Å; F40-T44 HydrophobicContact CE2-CG2 3.91Å; F40-T44 HydrophobicContact CZ-CG2 3.75Å; F40-T44 WeakPolarHBondContact O-CB 3.36Å; F40-T44 WeakPolarHBondContact O-CG2 3.36Å; F40-T44 PolarHBondContact O-N 3.41Å; F40-T44 PolarHBondContact O-OG1 3.13Å; F40-W46 HydrophobicContact CD1-CE3 4.48Å; F40-W46 HydrophobicContact CE1-CE3 4.21Å; F40-W46 HydrophobicContact CE1-CZ3 4.28Å
41	V	93.7	Very high	93.3	Very high	19 Å²	19	87.1 Å²	87.1	12%	0.115	46%	0.459	C	S	.	.	H	α-helix	trans	-59.8	-40.1	175.6	170.3	0	0	0	0	111.1	G37 V38 D45 W46 I49	G37-V41 WeakPolarHBondContact O-CG2 3.4Å; G37-V41 PolarHBondContact O-N 2.87Å; V38-V41 PolarHBondContact O-N 2.9Å; V41-D45 WeakPolarHBondContact O-CA 3.46Å; V41-D45 PolarHBondContact O-N 3.14Å; V41-D45 VanDerWaalsContact O-N 3.13Å; V41-W46 HydrophobicContact CG1-CB 4.39Å; V41-W46 HydrophobicContact CG2-CE3 4.15Å; V41-W46 PolarHBondContact O-N 3.31Å; V41-I49 HydrophobicContact CG1-CB 3.96Å; V41-I49 HydrophobicContact CG1-CG2 3.84Å; V41-I49 HydrophobicContact CG2-CB 4.45Å; V41-I49 HydrophobicContact CG2-CD1 3.65Å; V41-I49 HydrophobicContact CG2-CG2 4.37Å
42	Y	90.5	Very high	92.8	Very high	150 Å²	150	93.3 Å²	93.3	59%	0.588	47%	0.471	S	S	*	.	H	α-helix	trans	-64.6	-47.9	176.7	178.9	-101.1	0	0	0	112.4	V38 L39 F40 D45	V38-Y42 WeakPolarHBondContact O-CB 3.25Å; V38-Y42 PolarHBondContact O-N 2.96Å; L39-Y42 WeakPolarHBondContact O-CB 3.39Å; L39-Y42 PolarHBondContact O-N 3.46Å; F40-Y42 VanDerWaalsContact C-N 3.27Å; F40-Y42 PolarHBondContact O-N 3.09Å; Y42-D45 PolarHBondContact O-N 2.96Å
43	F	93.9	Very high	92.3	Very high	155 Å²	155	88.1 Å²	88.1	68%	0.68	46%	0.456	S	S	*	.	H	α-helix	trans	-68.9	-38	-179	-83.5	-59	0	0	0	113.9	L39 F40 D45	L39-F43 HydrophobicContact CD1-CD2 4.05Å; L39-F43 HydrophobicContact CD1-CE2 3.58Å; L39-F43 HydrophobicContact CD1-CZ 4.35Å; L39-F43 HydrophobicContact CD2-CD2 4.5Å; L39-F43 HydrophobicContact CD2-CE2 3.97Å; L39-F43 HydrophobicContact CG-CD2 3.76Å; L39-F43 HydrophobicContact CG-CE2 3.55Å; L39-F43 VanDerWaalsContact O-CD2 3.28Å; L39-F43 WeakPolarHBondContact O-CD2 3.43Å; L39-F43 PolarHBondContact O-N 3.04Å; F40-F43 PolarHBondContact O-N 2.87Å; F43-D45 PolarHBondContact O-N 2.79Å
44	T	91.3	Very high	91.5	Very high	70 Å²	70	88.3 Å²	88.3	43%	0.429	46%	0.459	S	S	.	.	H	α-helix	trans	-82.7	-4.7	179.8	56	0	0	0	0	112.9	F40 W46	F40-T44 HydrophobicContact CD1-CG2 4.42Å; F40-T44 HydrophobicContact CD2-CG2 4.31Å; F40-T44 HydrophobicContact CE1-CG2 4.02Å; F40-T44 HydrophobicContact CE2-CG2 3.91Å; F40-T44 HydrophobicContact CZ-CG2 3.75Å; F40-T44 WeakPolarHBondContact O-CB 3.36Å; F40-T44 WeakPolarHBondContact O-CG2 3.36Å; F40-T44 PolarHBondContact O-N 3.41Å; F40-T44 PolarHBondContact O-OG1 3.13Å; T44-W46 PolarHBondContact O-N 2.92Å
45	D	87.5	Confident	90.8	Very high	43 Å²	43	91 Å²	91	23%	0.23	47%	0.47	C	S	.	.	T	Hydrogen-bonded Turn	trans	42.2	50.8	-171.9	-149.7	23.7	0	0	0	111.7	V41 Y42 F43 K47 Y56 K59 F60	V41-D45 WeakPolarHBondContact O-CA 3.46Å; V41-D45 PolarHBondContact O-N 3.14Å; V41-D45 VanDerWaalsContact O-N 3.13Å; Y42-D45 PolarHBondContact O-N 2.96Å; F43-D45 PolarHBondContact O-N 2.79Å; D45-K47 PolarHBondContact O-N 3.45Å; D45-Y56 PolarHBondContact OD1-OH 3Å; D45-K59 IonicContact OD1-NZ 3.82Å; D45-K59 IonicContact OD2-NZ 2.7Å; D45-K59 PolarHBondContact OD2-NZ 3.3Å; D45-F60 WeakPolarHBondContact OD1-CZ 3.31Å; D45-F60 WeakPolarHBondContact OD2-CZ 3.44Å
46	W	89.9	Confident	90.1	Very high	119 Å²	119	90.7 Å²	90.7	45%	0.451	46%	0.459	S	S	.	.			trans	-68.1	95.3	-166.5	-168.7	2	0	0	0	111.2	F40 V41 T44 V48 I49 C50	F40-W46 HydrophobicContact CD1-CE3 4.48Å; F40-W46 HydrophobicContact CE1-CE3 4.21Å; F40-W46 HydrophobicContact CE1-CZ3 4.28Å; V41-W46 HydrophobicContact CG1-CB 4.39Å; V41-W46 HydrophobicContact CG2-CE3 4.15Å; V41-W46 PolarHBondContact O-N 3.31Å; T44-W46 PolarHBondContact O-N 2.92Å; W46-V48 PolarHBondContact O-N 2.97Å; W46-I49 HydrophobicContact CD2-CD1 4.2Å; W46-I49 HydrophobicContact CD2-CG1 4.46Å; W46-I49 HydrophobicContact CE3-CD1 3.76Å; W46-I49 HydrophobicContact CE3-CG1 4.5Å; W46-I49 HydrophobicContact CZ3-CD1 3.99Å; W46-I49 PolarHBondContact O-N 3.39Å; W46-C50 PolarHBondContact O-N 2.96Å; W46-C50 PolarHBondContact O-SG 3.45Å
47	K	86.9	Confident	89.3	Confident	137 Å²	137	90.4 Å²	90.4	60%	0.596	45%	0.449	S	S	*	.	H	α-helix	trans	-45.2	-38.9	-176.5	-81.9	-170.9	164.5	-174.3	0	114.3	D45 I49 T51 F60	D45-K47 PolarHBondContact O-N 3.45Å; K47-I49 VanDerWaalsContact C-N 3.3Å; K47-I49 PolarHBondContact O-N 2.87Å; K47-T51 WeakPolarHBondContact O-CB 3.39Å; K47-T51 VanDerWaalsContact O-CG2 3.26Å; K47-T51 WeakPolarHBondContact O-CG2 3.44Å; K47-T51 PolarHBondContact O-N 3.48Å; K47-T51 VanDerWaalsContact O-N 3.12Å; K47-T51 PolarHBondContact O-OG1 2.95Å; K47-F60 HydrophobicContact CD-CD1 4.29Å; K47-F60 HydrophobicContact CG-CD1 3.87Å; K47-F60 HydrophobicContact CG-CE1 3.87Å
48	V	88.5	Confident	88.5	Confident	78 Å²	78	98 Å²	98	47%	0.473	47%	0.467	S	S	.	.	H	α-helix	trans	-58.4	-43.1	179.4	-179.8	0	0	0	0	111	W46 R52	W46-V48 PolarHBondContact O-N 2.97Å; V48-R52 VanDerWaalsContact CG1-NH1 3.3Å; V48-R52 PolarHBondContact O-NH1 3.37Å
49	I	89.7	Confident	87.4	Confident	69 Å²	69	99.8 Å²	99.8	35%	0.354	47%	0.467	S	S	.	.	H	α-helix	trans	-88	-43.4	-179	-62.2	178.7	0	0	0	110.3	V41 W46 K47 T51 R52	V41-I49 HydrophobicContact CG1-CB 3.96Å; V41-I49 HydrophobicContact CG1-CG2 3.84Å; V41-I49 HydrophobicContact CG2-CB 4.45Å; V41-I49 HydrophobicContact CG2-CD1 3.65Å; V41-I49 HydrophobicContact CG2-CG2 4.37Å; W46-I49 HydrophobicContact CD2-CD1 4.2Å; W46-I49 HydrophobicContact CD2-CG1 4.46Å; W46-I49 HydrophobicContact CE3-CD1 3.76Å; W46-I49 HydrophobicContact CE3-CG1 4.5Å; W46-I49 HydrophobicContact CZ3-CD1 3.99Å; W46-I49 PolarHBondContact O-N 3.39Å; K47-I49 VanDerWaalsContact C-N 3.3Å; K47-I49 PolarHBondContact O-N 2.87Å; I49-T51 VanDerWaalsContact C-N 3.31Å; I49-T51 PolarHBondContact O-N 3.39Å; I49-R52 WeakPolarHBondContact O-CB 3.45Å; I49-R52 PolarHBondContact O-N 3.23Å
50	C	86.4	Confident	86.4	Confident	3 Å²	3	97.1 Å²	97.1	2%	0.02	45%	0.451	C	S	.	.	H	α-helix	trans	-63.2	-31.5	-174.1	-68.5	0	0	0	0	114.1	W46 R52 I53 Y56 F60	W46-C50 PolarHBondContact O-N 2.96Å; W46-C50 PolarHBondContact O-SG 3.45Å; C50-R52 PolarHBondContact O-N 3.44Å; C50-I53 PolarHBondContact O-N 3Å; C50-Y56 HydrophobicContact CB-CD1 3.88Å; C50-Y56 HydrophobicContact CB-CE1 3.91Å; C50-F60 HydrophobicContact CB-CD2 4.35Å; C50-F60 HydrophobicContact CB-CE2 3.53Å; C50-F60 HydrophobicContact CB-CZ 4.03Å
51	T	87.4	Confident	85.1	Confident	61 Å²	61	96.9 Å²	96.9	37%	0.374	46%	0.455	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.8	-19.1	176.2	49.9	0	0	0	0	113.8	K47 I49 N57 F60	K47-T51 WeakPolarHBondContact O-CB 3.39Å; K47-T51 VanDerWaalsContact O-CG2 3.26Å; K47-T51 WeakPolarHBondContact O-CG2 3.44Å; K47-T51 PolarHBondContact O-N 3.48Å; K47-T51 VanDerWaalsContact O-N 3.12Å; K47-T51 PolarHBondContact O-OG1 2.95Å; I49-T51 VanDerWaalsContact C-N 3.31Å; I49-T51 PolarHBondContact O-N 3.39Å; T51-N57 VanDerWaalsContact O-CB 3.29Å; T51-N57 WeakPolarHBondContact O-CB 3.24Å; T51-F60 HydrophobicContact CG2-CB 3.98Å; T51-F60 HydrophobicContact CG2-CD2 4.21Å; T51-F60 HydrophobicContact CG2-CG 4.29Å
52	R	88.7	Confident	83.5	Confident	185 Å²	185	101.3 Å²	101.3	70%	0.698	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87	-13	178.3	-67	175.7	165.3	94.7	-2.2	113.3	V48 I49 C50 P54	V48-R52 VanDerWaalsContact CG1-NH1 3.3Å; V48-R52 PolarHBondContact O-NH1 3.37Å; I49-R52 WeakPolarHBondContact O-CB 3.45Å; I49-R52 PolarHBondContact O-N 3.23Å; C50-R52 PolarHBondContact O-N 3.44Å; R52-P54 WeakPolarHBondContact O-CD 3.42Å
53	I	86.1	Confident	81.9	Confident	76 Å²	76	99.9 Å²	99.9	39%	0.39	49%	0.49	S	S	.	.	S	Bend	trans	-79.5	117.6	180	-59.9	174.5	0	0	0	108.3	C50 L55 Y56 N57	C50-I53 PolarHBondContact O-N 3Å; I53-L55 PolarHBondContact O-N 3.19Å; I53-Y56 PolarHBondContact O-N 3.06Å; I53-N57 PolarHBondContact O-N 3.46Å
54	P	82.1	Confident	80.2	Confident	107 Å²	107	98.9 Å²	98.9	70%	0.695	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.4	138.3	174.1	-18.8	30.6	0	0	0	109.4	R52 Y56	R52-P54 WeakPolarHBondContact O-CD 3.42Å; P54-Y56 VanDerWaalsContact C-N 3.28Å; P54-Y56 PolarHBondContact O-N 3.44Å
55	L	83.1	Confident	78.1	Confident	155 Å²	155	107.7 Å²	107.7	81%	0.812	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.3	-37.5	-175.9	-47.4	171.6	0	0	0	116.1	I53	I53-L55 PolarHBondContact O-N 3.19Å
56	Y	84.2	Confident	77.6	Confident	77 Å²	77	110.9 Å²	110.9	30%	0.302	54%	0.543	S	S	.	.	G	3₁₀ helix	trans	-81.2	-22.7	-179.1	-163.6	-101.4	0	0	0	113.1	D45 C50 I53 P54 R58 K59 F60	D45-Y56 PolarHBondContact OD1-OH 3Å; C50-Y56 HydrophobicContact CB-CD1 3.88Å; C50-Y56 HydrophobicContact CB-CE1 3.91Å; I53-Y56 PolarHBondContact O-N 3.06Å; P54-Y56 VanDerWaalsContact C-N 3.28Å; P54-Y56 PolarHBondContact O-N 3.44Å; Y56-R58 PolarHBondContact O-N 3.16Å; Y56-R58 VanDerWaalsContact O-N 3.12Å; Y56-K59 PolarHBondContact O-N 3.09Å; Y56-F60 HydrophobicContact CD1-CE2 4.05Å; Y56-F60 AromaticContact CE1-CE2 3.85Å; Y56-F60 HydrophobicContact CE1-CE2 3.85Å; Y56-F60 HydrophobicContact CE1-CZ 4.29Å
57	N	80.7	Confident	76.9	Confident	52 Å²	52	110.5 Å²	110.5	28%	0.278	55%	0.548	S	S	.	.	G	3₁₀ helix	trans	-59.7	-22.7	178.8	71.4	-18.6	0	0	0	114.2	T51 I53 K59 F60 L61	T51-N57 VanDerWaalsContact O-CB 3.29Å; T51-N57 WeakPolarHBondContact O-CB 3.24Å; I53-N57 PolarHBondContact O-N 3.46Å; N57-K59 PolarHBondContact O-N 3.07Å; N57-K59 VanDerWaalsContact O-N 3.13Å; N57-F60 PolarHBondContact O-N 3.45Å; N57-L61 PolarHBondContact O-N 3.44Å
58	R	79	Confident	76.4	Confident	196 Å²	196	109 Å²	109	74%	0.74	55%	0.545	S	S	*	.	G	3₁₀ helix	trans	-59.5	-24.2	-179	-64.5	179.5	66.9	-166.3	0.5	114	Y56 F60 L61	Y56-R58 PolarHBondContact O-N 3.16Å; Y56-R58 VanDerWaalsContact O-N 3.12Å; R58-F60 PolarHBondContact O-N 3.44Å; R58-L61 HydrophobicContact CG-CD1 4.29Å
59	K	73.7	Confident	75.7	Confident	135 Å²	135	110.8 Å²	110.8	59%	0.587	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-67.9	-21.9	174.8	-171.9	-174.5	177.4	-164.9	0	112.8	D45 Y56 N57	D45-K59 IonicContact OD1-NZ 3.82Å; D45-K59 IonicContact OD2-NZ 2.7Å; D45-K59 PolarHBondContact OD2-NZ 3.3Å; Y56-K59 PolarHBondContact O-N 3.09Å; N57-K59 PolarHBondContact O-N 3.07Å; N57-K59 VanDerWaalsContact O-N 3.13Å
60	F	75.3	Confident	74.8	Confident	35 Å²	35	113.4 Å²	113.4	15%	0.154	56%	0.561	C	S	.	*	S	Bend	trans	-116.1	1.4	-173.9	-52.3	-72.8	0	0	0	113.7	D45 K47 C50 T51 Y56 N57 R58 D62	D45-F60 WeakPolarHBondContact OD1-CZ 3.31Å; D45-F60 WeakPolarHBondContact OD2-CZ 3.44Å; K47-F60 HydrophobicContact CD-CD1 4.29Å; K47-F60 HydrophobicContact CG-CD1 3.87Å; K47-F60 HydrophobicContact CG-CE1 3.87Å; C50-F60 HydrophobicContact CB-CD2 4.35Å; C50-F60 HydrophobicContact CB-CE2 3.53Å; C50-F60 HydrophobicContact CB-CZ 4.03Å; T51-F60 HydrophobicContact CG2-CB 3.98Å; T51-F60 HydrophobicContact CG2-CD2 4.21Å; T51-F60 HydrophobicContact CG2-CG 4.29Å; Y56-F60 HydrophobicContact CD1-CE2 4.05Å; Y56-F60 AromaticContact CE1-CE2 3.85Å; Y56-F60 HydrophobicContact CE1-CE2 3.85Å; Y56-F60 HydrophobicContact CE1-CZ 4.29Å; N57-F60 PolarHBondContact O-N 3.45Å; R58-F60 PolarHBondContact O-N 3.44Å; F60-D62 VanDerWaalsContact C-N 3.25Å; F60-D62 PolarHBondContact O-N 3.19Å
61	L	67.7	Low	74	Confident	112 Å²	112	120.8 Å²	120.8	59%	0.586	60%	0.597	S	S	*	*	S	Bend	trans	-72.1	92.9	168.4	-65.8	171.3	0	0	0	106.3	N57 R58	N57-L61 PolarHBondContact O-N 3.44Å; R58-L61 HydrophobicContact CG-CD1 4.29Å
62	D	61.9	Low	73.1	Confident	112 Å²	112	125.1 Å²	125.1	60%	0.599	61%	0.613	S	S	*	*			trans	41.5	96.8	153	-60	-8.9	0	0	0	116.1	F60 D64	F60-D62 VanDerWaalsContact C-N 3.25Å; F60-D62 PolarHBondContact O-N 3.19Å; D62-D64 HydrophobicContact CB-CB 3.77Å; D62-D64 PolarHBondContact O-N 3.17Å
63	S	56.3	Low	71.9	Confident	120 Å²	120	120.5 Å²	120.5	84%	0.839	61%	0.607	S	S	*	*			trans	-77.9	35.8	132.3	53.7	0	0	0	0	110.7	E65	S63-E65 PolarHBondContact O-N 3.2Å
64	D	57	Low	70.7	Confident	135 Å²	135	124.2 Å²	124.2	72%	0.722	63%	0.625	S	S	*	*			trans	-80.1	59.1	168.2	-67.9	-9.7	0	0	0	108.6	D62	D62-D64 HydrophobicContact CB-CB 3.77Å; D62-D64 PolarHBondContact O-N 3.17Å
65	E	47.3	Very low	69.7	Low	254 Å²	254	125.7 Å²	125.7	100%	1.187	62%	0.619	S	S	*	*			trans	-99.9	0	152.8	-163.1	178.2	-177.4	0	0	108.2	S63	S63-E65 PolarHBondContact O-N 3.2Å

Retrieved 65 of 65 residues in 147 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).