A0A146MHV0_SCHMA Loading...

MICOS complex subunit MIC10

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

AlphaFold DB , UniProt , Accession A0A146MHV0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 91 aa.

						>A0A146MHV0_SCHMA|A0A146MHV0
MGEDLKSEDILGFKLDRCISDTLIKTGAGLFGGIIFSVVLAKRRPWPLIFGTGFGLGMGISNCNNDFKQPLPLVSHRIVSSNQVPEEKKSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	31.9	Very low	56.5	Low	248 Å²	248	129.7 Å²	129.7	100%	1.222	69%	0.686	S	S	*	*				0	86.5	0	-58.8	175.2	-78.7	0	0	104.9
2	G	43.4	Very low	58.2	Low	68 Å²	68	121.1 Å²	121.1	70%	0.701	65%	0.651	S	S	*	*			cis	140.8	-14	37.4	0	0	0	0	0	109.9
3	E	53.2	Low	59.7	Low	194 Å²	194	121.2 Å²	121.2	91%	0.907	64%	0.643	S	S	*	*	S	Bend	trans	-127.3	7.9	-174.5	-60.2	-177.2	102.4	0	0	114
4	D	54.3	Low	60.9	Low	93 Å²	93	120.3 Å²	120.3	50%	0.497	63%	0.63	S	S	.	*			trans	-83.4	-28.4	-173	-148.3	-160.9	0	0	0	113.6	K6 S7 E8	D4-K6 VanDerWaalsContact C-N 3.31Å; D4-K6 PolarHBondContact O-N 3.03Å; D4-S7 PolarHBondContact O-N 2.84Å; D4-S7 VanDerWaalsContact O-N 3.12Å; D4-E8 HydrophobicContact CB-CG 4.17Å; D4-E8 WeakPolarHBondContact CB-OE2 3.36Å; D4-E8 WeakPolarHBondContact O-CB 3.49Å; D4-E8 WeakPolarHBondContact O-CG 3.47Å; D4-E8 PolarHBondContact O-N 2.73Å; D4-E8 WeakPolarHBondContact OD1-CG 3.22Å; D4-E8 VanDerWaalsContact OD1-OE2 3.07Å
5	L	53.4	Low	62.4	Low	143 Å²	143	117.7 Å²	117.7	75%	0.749	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54	-29.6	-167	-77.4	159.1	0	0	0	117
6	K	57.9	Low	63.7	Low	181 Å²	181	116.8 Å²	116.8	79%	0.787	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.8	-25.4	-177.8	-160.7	177.8	178.5	70.4	0	113.2	D4	D4-K6 VanDerWaalsContact C-N 3.31Å; D4-K6 PolarHBondContact O-N 3.03Å
7	S	59.8	Low	64.6	Low	68 Å²	68	118.1 Å²	118.1	48%	0.476	61%	0.608	S	S	.	*	H	α-helix	trans	-80	-38.1	177.1	-156.8	0	0	0	0	110.1	D4 D9 I10 L11	D4-S7 PolarHBondContact O-N 2.84Å; D4-S7 VanDerWaalsContact O-N 3.12Å; S7-D9 VanDerWaalsContact C-N 3.27Å; S7-D9 PolarHBondContact O-N 3.37Å; S7-I10 PolarHBondContact O-N 3.49Å; S7-L11 WeakPolarHBondContact O-CB 3.35Å; S7-L11 PolarHBondContact O-N 2.61Å
8	E	59.3	Low	65.7	Low	94 Å²	94	111.9 Å²	111.9	44%	0.439	58%	0.576	S	S	.	*	H	α-helix	trans	-59.9	-29.2	173.5	-73.1	179.7	95	0	0	113.5	D4 G12	D4-E8 HydrophobicContact CB-CG 4.17Å; D4-E8 WeakPolarHBondContact CB-OE2 3.36Å; D4-E8 WeakPolarHBondContact O-CB 3.49Å; D4-E8 WeakPolarHBondContact O-CG 3.47Å; D4-E8 PolarHBondContact O-N 2.73Å; D4-E8 WeakPolarHBondContact OD1-CG 3.22Å; D4-E8 VanDerWaalsContact OD1-OE2 3.07Å; E8-G12 WeakPolarHBondContact O-CA 3.19Å; E8-G12 PolarHBondContact O-N 3.44Å
9	D	68.6	Low	66.8	Low	119 Å²	119	110.4 Å²	110.4	64%	0.636	57%	0.568	S	S	*	*	H	α-helix	trans	-68	-47.7	179.5	-70.5	-33.1	0	0	0	111.8	S7 F13	S7-D9 VanDerWaalsContact C-N 3.27Å; S7-D9 PolarHBondContact O-N 3.37Å; D9-F13 WeakPolarHBondContact O-CB 3.3Å; D9-F13 PolarHBondContact O-N 2.97Å; D9-F13 VanDerWaalsContact O-N 3.12Å
10	I	69.1	Low	67.7	Low	127 Å²	127	107.3 Å²	107.3	65%	0.651	56%	0.557	S	S	*	*	H	α-helix	trans	-76.1	-39.6	-179	-153.8	79.5	0	0	0	111.2	S7	S7-I10 PolarHBondContact O-N 3.49Å
11	L	71.2	Confident	68.4	Low	92 Å²	92	104.2 Å²	104.2	48%	0.482	54%	0.541	S	S	.	.	H	α-helix	trans	-78.1	-37.8	-179.1	-150.2	77.3	0	0	0	110.2	S7 K14 L15 F67	S7-L11 WeakPolarHBondContact O-CB 3.35Å; S7-L11 PolarHBondContact O-N 2.61Å; L11-K14 PolarHBondContact O-N 3.47Å; L11-L15 VanDerWaalsContact O-CB 3.3Å; L11-L15 WeakPolarHBondContact O-CB 3.01Å; L11-L15 PolarHBondContact O-N 3.09Å; L11-F67 HydrophobicContact CD1-CE1 4.4Å
12	G	76.5	Confident	70.9	Confident	26 Å²	26	93.3 Å²	93.3	27%	0.268	49%	0.488	S	S	.	.	H	α-helix	trans	-69	-37.2	178.2	0	0	0	0	0	112.5	E8 K14 L15 D16	E8-G12 WeakPolarHBondContact O-CA 3.19Å; E8-G12 PolarHBondContact O-N 3.44Å; G12-K14 VanDerWaalsContact C-N 3.26Å; G12-K14 PolarHBondContact O-N 3.29Å; G12-L15 PolarHBondContact O-N 2.81Å; G12-D16 WeakPolarHBondContact O-CB 3.06Å; G12-D16 PolarHBondContact O-N 3.47Å
13	F	78.5	Confident	72.9	Confident	123 Å²	123	95.6 Å²	95.6	54%	0.539	48%	0.484	S	S	.	.	H	α-helix	trans	-59.6	-38.3	170.5	-178.9	-98.4	0	0	0	112.2	D9 R17	D9-F13 WeakPolarHBondContact O-CB 3.3Å; D9-F13 PolarHBondContact O-N 2.97Å; D9-F13 VanDerWaalsContact O-N 3.12Å; F13-R17 WeakPolarHBondContact O-CB 3.45Å; F13-R17 PolarHBondContact O-N 2.75Å
14	K	76.4	Confident	74.5	Confident	108 Å²	108	90.3 Å²	90.3	47%	0.47	46%	0.461	S	S	.	.	H	α-helix	trans	-74	-41.9	175.9	-68.6	-171.9	175	-160.7	0	112.2	L11 G12 R17 C18 F67	L11-K14 PolarHBondContact O-N 3.47Å; G12-K14 VanDerWaalsContact C-N 3.26Å; G12-K14 PolarHBondContact O-N 3.29Å; K14-R17 PolarHBondContact O-N 3.49Å; K14-C18 WeakPolarHBondContact O-CB 3.49Å; K14-C18 PolarHBondContact O-N 3.04Å; K14-F67 HydrophobicContact CB-CD1 4.35Å; K14-F67 HydrophobicContact CB-CE1 3.34Å; K14-F67 HydrophobicContact CB-CZ 3.67Å; K14-F67 HydrophobicContact CD-CD1 3.81Å; K14-F67 HydrophobicContact CD-CE1 3.48Å; K14-F67 VanDerWaalsContact CD-CE1 3.48Å; K14-F67 HydrophobicContact CG-CE1 4.06Å
15	L	82.5	Confident	75.8	Confident	82 Å²	82	93 Å²	93	43%	0.429	47%	0.468	S	S	.	.	H	α-helix	trans	-63	-46.6	178.7	-163.1	92.4	0	0	0	110.4	L11 G12 R17 C18 I19	L11-L15 VanDerWaalsContact O-CB 3.3Å; L11-L15 WeakPolarHBondContact O-CB 3.01Å; L11-L15 PolarHBondContact O-N 3.09Å; G12-L15 PolarHBondContact O-N 2.81Å; L15-R17 PolarHBondContact O-N 3.36Å; L15-C18 PolarHBondContact O-N 3.38Å; L15-I19 HydrophobicContact CD2-CD1 3.6Å; L15-I19 HydrophobicContact CG-CD1 3.6Å; L15-I19 HydrophobicContact CG-CG1 4.28Å; L15-I19 VanDerWaalsContact O-CB 3.26Å; L15-I19 WeakPolarHBondContact O-CB 3.31Å; L15-I19 WeakPolarHBondContact O-CG1 3.23Å; L15-I19 PolarHBondContact O-N 2.93Å
16	D	84.1	Confident	77.1	Confident	103 Å²	103	89.3 Å²	89.3	55%	0.551	45%	0.452	S	S	*	.	H	α-helix	trans	-59.2	-44.9	177.3	-176.6	-98.6	0	0	0	111.5	G12 S20	G12-D16 WeakPolarHBondContact O-CB 3.06Å; G12-D16 PolarHBondContact O-N 3.47Å; D16-S20 WeakPolarHBondContact O-CB 3.29Å; D16-S20 PolarHBondContact O-N 3.01Å; D16-S20 PolarHBondContact O-OG 3.21Å
17	R	79.1	Confident	78.5	Confident	139 Å²	139	81.7 Å²	81.7	53%	0.525	43%	0.425	S	S	.	.	H	α-helix	trans	-65.2	-44.5	176.2	-170.7	165.1	-170.3	-113.8	2.1	112.4	F13 K14 L15 D21	F13-R17 WeakPolarHBondContact O-CB 3.45Å; F13-R17 PolarHBondContact O-N 2.75Å; K14-R17 PolarHBondContact O-N 3.49Å; L15-R17 PolarHBondContact O-N 3.36Å; R17-D21 WeakPolarHBondContact O-CB 3.47Å; R17-D21 PolarHBondContact O-N 2.91Å
18	C	84.3	Confident	79.7	Confident	6 Å²	6	82.3 Å²	82.3	4%	0.041	43%	0.434	C	S	.	.	H	α-helix	trans	-64.6	-46.5	177.3	179.1	0	0	0	0	111.7	K14 L15 S20 D21 T22 C63	K14-C18 WeakPolarHBondContact O-CB 3.49Å; K14-C18 PolarHBondContact O-N 3.04Å; L15-C18 PolarHBondContact O-N 3.38Å; C18-S20 VanDerWaalsContact C-N 3.32Å; C18-S20 PolarHBondContact O-N 3.33Å; C18-D21 PolarHBondContact O-N 2.76Å; C18-T22 WeakPolarHBondContact O-CB 3.41Å; C18-T22 PolarHBondContact O-N 3.45Å; C18-T22 PolarHBondContact O-OG1 3.4Å; C18-C63 HydrophobicContact CB-CB 4.03Å; C18-C63 WeakPolarHBondContact CB-SG 3.14Å; C18-C63 WeakPolarHBondContact SG-CA 2.89Å; C18-C63 WeakPolarHBondContact SG-CB 3.36Å; C18-C63 CovalentContact SG-SG 2.05Å; C18-C63 PolarHBondContact SG-SG 3.28Å
19	I	85.7	Confident	80.9	Confident	84 Å²	84	80.4 Å²	80.4	43%	0.431	44%	0.439	S	S	.	.	H	α-helix	trans	-62	-44.5	179.4	-72.1	170.8	0	0	0	109.2	L15 T22 L23	L15-I19 HydrophobicContact CD2-CD1 3.6Å; L15-I19 HydrophobicContact CG-CD1 3.6Å; L15-I19 HydrophobicContact CG-CG1 4.28Å; L15-I19 VanDerWaalsContact O-CB 3.26Å; L15-I19 WeakPolarHBondContact O-CB 3.31Å; L15-I19 WeakPolarHBondContact O-CG1 3.23Å; L15-I19 PolarHBondContact O-N 2.93Å; I19-T22 PolarHBondContact O-N 3.36Å; I19-L23 WeakPolarHBondContact O-CA 3.08Å; I19-L23 WeakPolarHBondContact O-CB 3.25Å; I19-L23 PolarHBondContact O-N 3.44Å
20	S	85.7	Confident	81.6	Confident	48 Å²	48	79.4 Å²	79.4	34%	0.336	43%	0.434	S	S	.	.	H	α-helix	trans	-61.2	-49	178.2	-66.2	0	0	0	0	111.8	D16 C18 L23 I24	D16-S20 WeakPolarHBondContact O-CB 3.29Å; D16-S20 PolarHBondContact O-N 3.01Å; D16-S20 PolarHBondContact O-OG 3.21Å; C18-S20 VanDerWaalsContact C-N 3.32Å; C18-S20 PolarHBondContact O-N 3.33Å; S20-L23 PolarHBondContact O-N 2.72Å; S20-I24 WeakPolarHBondContact O-CB 3.2Å; S20-I24 WeakPolarHBondContact O-CD1 3.26Å; S20-I24 WeakPolarHBondContact O-CG1 3.31Å; S20-I24 PolarHBondContact O-N 3.29Å
21	D	82.2	Confident	82.5	Confident	42 Å²	42	80.2 Å²	80.2	23%	0.225	43%	0.432	C	S	.	.	H	α-helix	trans	-62.8	-46.4	179	-164.6	-95.4	0	0	0	111.7	R17 C18 L23 I24 K25 Q83	R17-D21 WeakPolarHBondContact O-CB 3.47Å; R17-D21 PolarHBondContact O-N 2.91Å; C18-D21 PolarHBondContact O-N 2.76Å; D21-L23 PolarHBondContact O-N 2.83Å; D21-I24 PolarHBondContact O-N 3.19Å; D21-K25 WeakPolarHBondContact O-CB 3.02Å; D21-K25 PolarHBondContact O-N 2.81Å; D21-Q83 VanDerWaalsContact OD2-CB 3.3Å; D21-Q83 WeakPolarHBondContact OD2-CB 3.39Å; D21-Q83 VanDerWaalsContact OD2-CG 3.26Å; D21-Q83 WeakPolarHBondContact OD2-CG 3.49Å; D21-Q83 PolarHBondContact OD2-OE1 2.63Å
22	T	84.3	Confident	83.3	Confident	19 Å²	19	77.7 Å²	77.7	12%	0.117	43%	0.429	C	S	.	.	H	α-helix	trans	-63.6	-42.8	177.6	-57.7	0	0	0	0	110.7	C18 I19 T26 N62	C18-T22 WeakPolarHBondContact O-CB 3.41Å; C18-T22 PolarHBondContact O-N 3.45Å; C18-T22 PolarHBondContact O-OG1 3.4Å; I19-T22 PolarHBondContact O-N 3.36Å; T22-T26 WeakPolarHBondContact O-CA 3.05Å; T22-T26 WeakPolarHBondContact O-CB 3.39Å; T22-T26 PolarHBondContact O-N 3.43Å; T22-T26 PolarHBondContact O-OG1 3.37Å; T22-N62 PolarHBondContact OG1-ND2 2.92Å
23	L	86	Confident	83.7	Confident	117 Å²	117	78.1 Å²	78.1	61%	0.613	43%	0.434	S	S	*	.	H	α-helix	trans	-68	-39.1	-179.4	-177	67	0	0	0	111.1	I19 S20 D21 G27	I19-L23 WeakPolarHBondContact O-CA 3.08Å; I19-L23 WeakPolarHBondContact O-CB 3.25Å; I19-L23 PolarHBondContact O-N 3.44Å; S20-L23 PolarHBondContact O-N 2.72Å; D21-L23 PolarHBondContact O-N 2.83Å; L23-G27 WeakPolarHBondContact O-CA 3.26Å; L23-G27 PolarHBondContact O-N 2.83Å
24	I	86.2	Confident	84	Confident	83 Å²	83	76.2 Å²	76.2	43%	0.426	43%	0.428	S	S	.	.	H	α-helix	trans	-69.4	-48.1	177.7	-68.3	164.7	0	0	0	109.9	S20 D21 A28 P85	S20-I24 WeakPolarHBondContact O-CB 3.2Å; S20-I24 WeakPolarHBondContact O-CD1 3.26Å; S20-I24 WeakPolarHBondContact O-CG1 3.31Å; S20-I24 PolarHBondContact O-N 3.29Å; D21-I24 PolarHBondContact O-N 3.19Å; I24-A28 PolarHBondContact O-N 2.82Å; I24-P85 HydrophobicContact CG2-CG 3.22Å
25	K	80.6	Confident	84.5	Confident	149 Å²	149	75.4 Å²	75.4	65%	0.648	43%	0.428	S	S	*	.	H	α-helix	trans	-68.9	-42.9	-177.4	-165.8	173.6	-146.2	148.9	0	112.9	D21	D21-K25 WeakPolarHBondContact O-CB 3.02Å; D21-K25 PolarHBondContact O-N 2.81Å
26	T	82	Confident	84.7	Confident	66 Å²	66	78 Å²	78	41%	0.405	44%	0.436	S	S	.	.	H	α-helix	trans	-85.2	-38.1	-178.8	-39.4	0	0	0	0	110.5	T22 A28 G29 L30	T22-T26 WeakPolarHBondContact O-CA 3.05Å; T22-T26 WeakPolarHBondContact O-CB 3.39Å; T22-T26 PolarHBondContact O-N 3.43Å; T22-T26 PolarHBondContact O-OG1 3.37Å; T26-A28 PolarHBondContact O-N 3Å; T26-G29 PolarHBondContact O-N 3.1Å; T26-L30 WeakPolarHBondContact O-CA 3.4Å; T26-L30 WeakPolarHBondContact O-CB 3Å; T26-L30 PolarHBondContact O-N 3.32Å
27	G	85.4	Confident	84.7	Confident	21 Å²	21	74.9 Å²	74.9	22%	0.216	42%	0.423	C	S	.	.	H	α-helix	trans	-64.8	-37.3	-174.4	0	0	0	0	0	113.6	L23 F31	L23-G27 WeakPolarHBondContact O-CA 3.26Å; L23-G27 PolarHBondContact O-N 2.83Å; G27-F31 WeakPolarHBondContact O-CB 3.3Å; G27-F31 PolarHBondContact O-N 3.04Å
28	A	86.4	Confident	84.9	Confident	80 Å²	80	72.4 Å²	72.4	66%	0.661	42%	0.423	S	S	*	.	H	α-helix	trans	-61.1	-48.8	175.8	0	0	0	0	0	112.1	I24 T26 G32	I24-A28 PolarHBondContact O-N 2.82Å; T26-A28 PolarHBondContact O-N 3Å; A28-G32 PolarHBondContact O-N 3.27Å
29	G	83.8	Confident	84.8	Confident	54 Å²	54	77 Å²	77	56%	0.557	45%	0.45	S	S	*	.	H	α-helix	trans	-72.4	-39.4	178.4	0	0	0	0	0	113	T26 G32 G33	T26-G29 PolarHBondContact O-N 3.1Å; G29-G32 PolarHBondContact O-N 3.08Å; G29-G33 PolarHBondContact O-N 2.8Å
30	L	84.5	Confident	84.4	Confident	99 Å²	99	78.7 Å²	78.7	52%	0.518	46%	0.46	S	S	.	.	H	α-helix	trans	-66.2	-39.9	178.1	-174.1	67.4	0	0	0	110.8	T26 G33 I34	T26-L30 WeakPolarHBondContact O-CA 3.4Å; T26-L30 WeakPolarHBondContact O-CB 3Å; T26-L30 PolarHBondContact O-N 3.32Å; L30-G33 CarbonylContact O-C 3.57Å; L30-G33 PolarHBondContact O-N 2.92Å; L30-I34 HydrophobicContact CD1-CD1 4.25Å; L30-I34 HydrophobicContact CD1-CG1 4.2Å; L30-I34 HydrophobicContact CD2-CD1 4.22Å; L30-I34 HydrophobicContact CG-CD1 3.71Å; L30-I34 HydrophobicContact CG-CG1 4.12Å; L30-I34 VanDerWaalsContact O-CB 3.31Å; L30-I34 WeakPolarHBondContact O-CB 3.32Å; L30-I34 WeakPolarHBondContact O-CG1 3.43Å; L30-I34 PolarHBondContact O-N 2.91Å
31	F	87.3	Confident	83.8	Confident	143 Å²	143	78 Å²	78	63%	0.627	46%	0.456	S	S	*	.	H	α-helix	trans	-61.2	-47.6	177.1	-172.7	-101.4	0	0	0	111.3	G27 I34 I35	G27-F31 WeakPolarHBondContact O-CB 3.3Å; G27-F31 PolarHBondContact O-N 3.04Å; F31-I34 PolarHBondContact O-N 3.39Å; F31-I35 HydrophobicContact CD1-CD1 3.94Å; F31-I35 HydrophobicContact CE1-CD1 3.68Å; F31-I35 HydrophobicContact CZ-CD1 4.2Å; F31-I35 WeakPolarHBondContact O-CG1 3.24Å; F31-I35 PolarHBondContact O-N 2.63Å
32	G	87.7	Confident	83.2	Confident	39 Å²	39	84.8 Å²	84.8	40%	0.402	48%	0.484	S	S	.	.	H	α-helix	trans	-62.6	-43.6	173.5	0	0	0	0	0	112.9	A28 G29 I34 I35 F36	A28-G32 PolarHBondContact O-N 3.27Å; G29-G32 PolarHBondContact O-N 3.08Å; G32-I34 PolarHBondContact O-N 2.77Å; G32-I35 PolarHBondContact O-N 2.72Å; G32-F36 WeakPolarHBondContact O-CB 3.28Å; G32-F36 PolarHBondContact O-N 3.44Å
33	G	84.9	Confident	82.6	Confident	36 Å²	36	95 Å²	95	37%	0.371	52%	0.52	S	S	.	.	H	α-helix	trans	-66	-34.1	178.4	0	0	0	0	0	113.6	G29 L30 S37	G29-G33 PolarHBondContact O-N 2.8Å; L30-G33 CarbonylContact O-C 3.57Å; L30-G33 PolarHBondContact O-N 2.92Å; G33-S37 WeakPolarHBondContact O-CA 3.17Å; G33-S37 WeakPolarHBondContact O-CB 3.07Å; G33-S37 PolarHBondContact O-N 3.47Å
34	I	84.7	Confident	82.1	Confident	82 Å²	82	98.5 Å²	98.5	42%	0.421	53%	0.525	S	S	.	.	H	α-helix	trans	-66.5	-47.8	174.6	-74.6	166	0	0	0	109.6	L30 F31 G32 F36 S37 V38	L30-I34 HydrophobicContact CD1-CD1 4.25Å; L30-I34 HydrophobicContact CD1-CG1 4.2Å; L30-I34 HydrophobicContact CD2-CD1 4.22Å; L30-I34 HydrophobicContact CG-CD1 3.71Å; L30-I34 HydrophobicContact CG-CG1 4.12Å; L30-I34 VanDerWaalsContact O-CB 3.31Å; L30-I34 WeakPolarHBondContact O-CB 3.32Å; L30-I34 WeakPolarHBondContact O-CG1 3.43Å; L30-I34 PolarHBondContact O-N 2.91Å; F31-I34 PolarHBondContact O-N 3.39Å; G32-I34 PolarHBondContact O-N 2.77Å; I34-F36 VanDerWaalsContact C-N 3.28Å; I34-F36 PolarHBondContact O-N 2.9Å; I34-S37 PolarHBondContact O-N 2.94Å; I34-V38 HydrophobicContact CG2-CG2 4.23Å; I34-V38 WeakPolarHBondContact O-CB 3.46Å; I34-V38 VanDerWaalsContact O-CG2 3.29Å; I34-V38 WeakPolarHBondContact O-CG2 3.41Å; I34-V38 PolarHBondContact O-N 3.33Å
35	I	87.8	Confident	81.7	Confident	92 Å²	92	98.3 Å²	98.3	47%	0.472	53%	0.529	S	S	.	.	H	α-helix	trans	-57.3	-47.9	177.7	-64.6	163.1	0	0	0	109.4	F31 G32 V38 V39	F31-I35 HydrophobicContact CD1-CD1 3.94Å; F31-I35 HydrophobicContact CE1-CD1 3.68Å; F31-I35 HydrophobicContact CZ-CD1 4.2Å; F31-I35 WeakPolarHBondContact O-CG1 3.24Å; F31-I35 PolarHBondContact O-N 2.63Å; G32-I35 PolarHBondContact O-N 2.72Å; I35-V38 PolarHBondContact O-N 3.37Å; I35-V39 WeakPolarHBondContact O-CG2 3.19Å; I35-V39 PolarHBondContact O-N 2.84Å; I35-V39 VanDerWaalsContact O-N 3.09Å
36	F	86.2	Confident	81.9	Confident	135 Å²	135	99.4 Å²	99.4	59%	0.592	53%	0.53	S	S	*	.	H	α-helix	trans	-62.9	-43.7	177.1	-173.6	-107.1	0	0	0	113	G32 I34 V39 L40	G32-F36 WeakPolarHBondContact O-CB 3.28Å; G32-F36 PolarHBondContact O-N 3.44Å; I34-F36 VanDerWaalsContact C-N 3.28Å; I34-F36 PolarHBondContact O-N 2.9Å; F36-V39 PolarHBondContact O-N 3.04Å; F36-L40 HydrophobicContact CD1-CD1 3.94Å; F36-L40 HydrophobicContact CE1-CD1 3.27Å; F36-L40 HydrophobicContact CE1-CG 4.24Å; F36-L40 HydrophobicContact CE2-CD1 3.98Å; F36-L40 HydrophobicContact CE2-CG 4.33Å; F36-L40 HydrophobicContact CZ-CD1 3.31Å; F36-L40 HydrophobicContact CZ-CG 4.14Å; F36-L40 PolarHBondContact O-N 3.01Å
37	S	84.8	Confident	81.9	Confident	39 Å²	39	98.3 Å²	98.3	27%	0.273	52%	0.524	S	S	.	.	H	α-helix	trans	-64.2	-42.2	179.1	-175.9	0	0	0	0	111.5	G33 I34 V39 L40 A41	G33-S37 WeakPolarHBondContact O-CA 3.17Å; G33-S37 WeakPolarHBondContact O-CB 3.07Å; G33-S37 PolarHBondContact O-N 3.47Å; I34-S37 PolarHBondContact O-N 2.94Å; S37-V39 VanDerWaalsContact C-N 3.34Å; S37-V39 PolarHBondContact O-N 3.48Å; S37-L40 PolarHBondContact O-N 2.99Å; S37-A41 WeakPolarHBondContact O-CA 3.01Å; S37-A41 WeakPolarHBondContact O-CB 3.44Å; S37-A41 PolarHBondContact O-N 3.49Å
38	V	81.5	Confident	81.8	Confident	87 Å²	87	102.2 Å²	102.2	53%	0.527	54%	0.539	S	S	.	.	H	α-helix	trans	-64.8	-40.1	176	171.2	0	0	0	0	111.1	I34 I35 K42	I34-V38 HydrophobicContact CG2-CG2 4.23Å; I34-V38 WeakPolarHBondContact O-CB 3.46Å; I34-V38 VanDerWaalsContact O-CG2 3.29Å; I34-V38 WeakPolarHBondContact O-CG2 3.41Å; I34-V38 PolarHBondContact O-N 3.33Å; I35-V38 PolarHBondContact O-N 3.37Å; V38-K42 PolarHBondContact O-N 2.95Å
39	V	83.8	Confident	81.9	Confident	101 Å²	101	103.8 Å²	103.8	61%	0.612	54%	0.535	S	S	*	.	H	α-helix	trans	-64.1	-45.8	178.2	170.4	0	0	0	0	111.2	I35 F36 S37	I35-V39 WeakPolarHBondContact O-CG2 3.19Å; I35-V39 PolarHBondContact O-N 2.84Å; I35-V39 VanDerWaalsContact O-N 3.09Å; F36-V39 PolarHBondContact O-N 3.04Å; S37-V39 VanDerWaalsContact C-N 3.34Å; S37-V39 PolarHBondContact O-N 3.48Å
40	L	77.4	Confident	82	Confident	121 Å²	121	106.9 Å²	106.9	63%	0.634	53%	0.534	S	S	*	.	H	α-helix	trans	-80.2	-39.4	-179.2	-68.3	-172.9	0	0	0	113.9	F36 S37 K42	F36-L40 HydrophobicContact CD1-CD1 3.94Å; F36-L40 HydrophobicContact CE1-CD1 3.27Å; F36-L40 HydrophobicContact CE1-CG 4.24Å; F36-L40 HydrophobicContact CE2-CD1 3.98Å; F36-L40 HydrophobicContact CE2-CG 4.33Å; F36-L40 HydrophobicContact CZ-CD1 3.31Å; F36-L40 HydrophobicContact CZ-CG 4.14Å; F36-L40 PolarHBondContact O-N 3.01Å; S37-L40 PolarHBondContact O-N 2.99Å; L40-K42 VanDerWaalsContact C-N 3.31Å; L40-K42 PolarHBondContact O-N 2.95Å
41	A	71.7	Confident	82.1	Confident	32 Å²	32	104 Å²	104	26%	0.264	53%	0.527	S	S	.	.			trans	-92.1	18.6	-170.5	0	0	0	0	0	114.1	S37 R43 R44 P47	S37-A41 WeakPolarHBondContact O-CA 3.01Å; S37-A41 WeakPolarHBondContact O-CB 3.44Å; S37-A41 PolarHBondContact O-N 3.49Å; A41-R43 PolarHBondContact O-N 3.47Å; A41-R44 PolarHBondContact O-N 2.88Å; A41-P47 HydrophobicContact CB-CG 3.62Å
42	K	70.3	Confident	82.1	Confident	185 Å²	185	101.2 Å²	101.2	80%	0.804	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	-41.9	-5.7	-175	-172.4	158	171.6	165.3	0	117.9	V38 L40	V38-K42 PolarHBondContact O-N 2.95Å; L40-K42 VanDerWaalsContact C-N 3.31Å; L40-K42 PolarHBondContact O-N 2.95Å
43	R	71.2	Confident	82.2	Confident	235 Å²	235	101.4 Å²	101.4	89%	0.887	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-131.3	0.1	174	-84.1	-155.6	175.7	176.8	1	117.9	A41	A41-R43 PolarHBondContact O-N 3.47Å
44	R	76.5	Confident	82.3	Confident	189 Å²	189	105.7 Å²	105.7	71%	0.713	53%	0.533	S	S	*	.			trans	-127.1	119.7	-177.4	-132.2	67.1	-172.4	160.4	-2.3	112.2	A41 W46 P47	A41-R44 PolarHBondContact O-N 2.88Å; R44-W46 HydrophobicContact CG-CB 4.26Å; R44-W46 PolarHBondContact O-N 3.5Å; R44-P47 WeakPolarHBondContact O-CD 3.45Å; R44-P47 VanDerWaalsContact O-CG 3.3Å; R44-P47 WeakPolarHBondContact O-CG 3.43Å
45	P	76.8	Confident	82.4	Confident	79 Å²	79	103.7 Å²	103.7	51%	0.513	53%	0.532	S	S	.	.	S	Bend	trans	-74.5	-8.5	175.2	31.1	-35.5	0	0	0	112.7	L48 I49	P45-L48 WeakPolarHBondContact O-CB 3.41Å; P45-L48 PolarHBondContact O-N 2.82Å; P45-I49 PolarHBondContact O-N 2.71Å; P45-I49 VanDerWaalsContact O-N 3.1Å
46	W	85.5	Confident	82.3	Confident	172 Å²	172	104.8 Å²	104.8	65%	0.652	54%	0.539	S	S	*	.	H	α-helix	trans	-55.7	-46.6	-178.7	-153.1	78.9	0	0	0	114	R44 L48 I49 F50	R44-W46 HydrophobicContact CG-CB 4.26Å; R44-W46 PolarHBondContact O-N 3.5Å; W46-L48 VanDerWaalsContact C-N 3.27Å; W46-L48 PolarHBondContact O-N 2.97Å; W46-I49 PolarHBondContact O-N 3.46Å; W46-F50 HydrophobicContact CE3-CB 4.33Å; W46-F50 AromaticContact CH2-CD2 3.96Å; W46-F50 HydrophobicContact CH2-CD2 3.96Å; W46-F50 HydrophobicContact CH2-CE2 4.41Å; W46-F50 HydrophobicContact CH2-CG 4.48Å; W46-F50 HydrophobicContact CZ2-CD2 4.48Å; W46-F50 HydrophobicContact CZ3-CB 4.37Å; W46-F50 HydrophobicContact CZ3-CD2 4.17Å; W46-F50 HydrophobicContact CZ3-CG 4.24Å; W46-F50 VanDerWaalsContact O-CB 3.25Å; W46-F50 WeakPolarHBondContact O-CB 3.38Å; W46-F50 PolarHBondContact O-N 3.41Å
47	P	82.9	Confident	82.4	Confident	44 Å²	44	100.2 Å²	100.2	29%	0.286	53%	0.53	S	S	.	.	H	α-helix	trans	-62.2	-27.5	173	19.5	-33.4	0	0	0	114.6	A41 R44 G51	A41-P47 HydrophobicContact CB-CG 3.62Å; R44-P47 WeakPolarHBondContact O-CD 3.45Å; R44-P47 VanDerWaalsContact O-CG 3.3Å; R44-P47 WeakPolarHBondContact O-CG 3.43Å; P47-G51 VanDerWaalsContact O-CA 3.31Å; P47-G51 WeakPolarHBondContact O-CA 3.2Å; P47-G51 PolarHBondContact O-N 3.02Å
48	L	82.9	Confident	82.4	Confident	103 Å²	103	103.7 Å²	103.7	54%	0.539	54%	0.543	S	S	.	.	H	α-helix	trans	-70.7	-48.2	174	-66.5	174.3	0	0	0	110.3	P45 W46 G51 T52	P45-L48 WeakPolarHBondContact O-CB 3.41Å; P45-L48 PolarHBondContact O-N 2.82Å; W46-L48 VanDerWaalsContact C-N 3.27Å; W46-L48 PolarHBondContact O-N 2.97Å; L48-G51 PolarHBondContact O-N 3.49Å; L48-T52 WeakPolarHBondContact O-CB 3.35Å; L48-T52 VanDerWaalsContact O-CG2 3.26Å; L48-T52 WeakPolarHBondContact O-CG2 3.48Å; L48-T52 PolarHBondContact O-N 2.75Å; L48-T52 PolarHBondContact O-OG1 3.35Å; L48-T52 VanDerWaalsContact O-OG1 3.08Å
49	I	87.3	Confident	82.5	Confident	112 Å²	112	100.6 Å²	100.6	57%	0.574	53%	0.528	S	S	*	.	H	α-helix	trans	-65.7	-45.8	179.4	-60.7	163.1	0	0	0	111	P45 W46 G51 T52 G53	P45-I49 PolarHBondContact O-N 2.71Å; P45-I49 VanDerWaalsContact O-N 3.1Å; W46-I49 PolarHBondContact O-N 3.46Å; I49-G51 VanDerWaalsContact C-N 3.34Å; I49-T52 PolarHBondContact O-OG1 2.85Å; I49-G53 PolarHBondContact O-N 2.83Å
50	F	86.7	Confident	82.6	Confident	120 Å²	120	101.4 Å²	101.4	53%	0.526	53%	0.528	S	S	.	.	H	α-helix	trans	-64.5	-41.5	176.6	-172.5	-93.4	0	0	0	110.8	W46 G53 F54	W46-F50 HydrophobicContact CE3-CB 4.33Å; W46-F50 AromaticContact CH2-CD2 3.96Å; W46-F50 HydrophobicContact CH2-CD2 3.96Å; W46-F50 HydrophobicContact CH2-CE2 4.41Å; W46-F50 HydrophobicContact CH2-CG 4.48Å; W46-F50 HydrophobicContact CZ2-CD2 4.48Å; W46-F50 HydrophobicContact CZ3-CB 4.37Å; W46-F50 HydrophobicContact CZ3-CD2 4.17Å; W46-F50 HydrophobicContact CZ3-CG 4.24Å; W46-F50 VanDerWaalsContact O-CB 3.25Å; W46-F50 WeakPolarHBondContact O-CB 3.38Å; W46-F50 PolarHBondContact O-N 3.41Å; F50-G53 PolarHBondContact O-N 2.76Å; F50-F54 VanDerWaalsContact O-CB 3.23Å; F50-F54 WeakPolarHBondContact O-CB 3.48Å; F50-F54 PolarHBondContact O-N 3.06Å
51	G	87	Confident	83	Confident	37 Å²	37	98.9 Å²	98.9	38%	0.381	52%	0.52	S	S	.	.	H	α-helix	trans	-66.9	-41.5	178	0	0	0	0	0	113.3	P47 L48 I49 G55	P47-G51 VanDerWaalsContact O-CA 3.31Å; P47-G51 WeakPolarHBondContact O-CA 3.2Å; P47-G51 PolarHBondContact O-N 3.02Å; L48-G51 PolarHBondContact O-N 3.49Å; I49-G51 VanDerWaalsContact C-N 3.34Å; G51-G55 PolarHBondContact O-N 3.2Å
52	T	87	Confident	83.5	Confident	86 Å²	86	100.8 Å²	100.8	53%	0.528	53%	0.526	S	S	.	.	H	α-helix	trans	-66.2	-42.8	175.1	55.2	0	0	0	0	111	L48 I49 G55 L56	L48-T52 WeakPolarHBondContact O-CB 3.35Å; L48-T52 VanDerWaalsContact O-CG2 3.26Å; L48-T52 WeakPolarHBondContact O-CG2 3.48Å; L48-T52 PolarHBondContact O-N 2.75Å; L48-T52 PolarHBondContact O-OG1 3.35Å; L48-T52 VanDerWaalsContact O-OG1 3.08Å; I49-T52 PolarHBondContact O-OG1 2.85Å; T52-G55 PolarHBondContact O-N 3.22Å; T52-L56 VanDerWaalsContact O-CB 3.28Å; T52-L56 WeakPolarHBondContact O-CB 3.26Å; T52-L56 WeakPolarHBondContact O-CD1 3.16Å; T52-L56 VanDerWaalsContact O-CG 3.24Å; T52-L56 WeakPolarHBondContact O-CG 2.99Å; T52-L56 PolarHBondContact O-N 3.42Å
53	G	89.1	Confident	84	Confident	43 Å²	43	92.7 Å²	92.7	44%	0.443	49%	0.493	S	S	.	.	H	α-helix	trans	-61.6	-48.8	174.6	0	0	0	0	0	112.7	I49 F50 G57	I49-G53 PolarHBondContact O-N 2.83Å; F50-G53 PolarHBondContact O-N 2.76Å; G53-G57 PolarHBondContact O-N 3.01Å
54	F	88	Confident	84.5	Confident	126 Å²	126	85.6 Å²	85.6	55%	0.553	47%	0.472	S	S	*	.	H	α-helix	trans	-62.5	-44.1	177.8	-172.6	-98.3	0	0	0	111.6	F50 G57 M58	F50-F54 VanDerWaalsContact O-CB 3.23Å; F50-F54 WeakPolarHBondContact O-CB 3.48Å; F50-F54 PolarHBondContact O-N 3.06Å; F54-G57 PolarHBondContact O-N 3.47Å; F54-M58 HydrophobicContact CE1-CE 4.25Å; F54-M58 HydrophobicContact CE1-SD 3.72Å; F54-M58 HydrophobicContact CZ-CE 4.2Å; F54-M58 HydrophobicContact CZ-SD 4.17Å; F54-M58 PolarHBondContact O-N 3.45Å
55	G	85.4	Confident	84.6	Confident	39 Å²	39	82 Å²	82	40%	0.402	47%	0.467	S	S	.	.	H	α-helix	trans	-65	-44.5	178.5	0	0	0	0	0	113.2	G51 T52 G57 M58 G59	G51-G55 PolarHBondContact O-N 3.2Å; T52-G55 PolarHBondContact O-N 3.22Å; G55-G57 VanDerWaalsContact C-N 3.34Å; G55-G57 PolarHBondContact O-N 3.17Å; G55-M58 PolarHBondContact O-N 2.97Å; G55-G59 PolarHBondContact O-N 2.97Å
56	L	86.3	Confident	84.4	Confident	116 Å²	116	81.3 Å²	81.3	61%	0.607	46%	0.459	S	S	*	.	H	α-helix	trans	-58.7	-45.9	174	-79.1	163.9	0	0	0	111	T52 G59 I60	T52-L56 VanDerWaalsContact O-CB 3.28Å; T52-L56 WeakPolarHBondContact O-CB 3.26Å; T52-L56 WeakPolarHBondContact O-CD1 3.16Å; T52-L56 VanDerWaalsContact O-CG 3.24Å; T52-L56 WeakPolarHBondContact O-CG 2.99Å; T52-L56 PolarHBondContact O-N 3.42Å; L56-G59 PolarHBondContact O-N 3.14Å; L56-I60 WeakPolarHBondContact O-CB 3.15Å; L56-I60 WeakPolarHBondContact O-CD1 3.17Å; L56-I60 WeakPolarHBondContact O-CG1 3.49Å; L56-I60 PolarHBondContact O-N 3.42Å; L56-I60 VanDerWaalsContact O-N 3.08Å
57	G	88	Confident	83.7	Confident	39 Å²	39	76.2 Å²	76.2	40%	0.402	44%	0.442	S	S	.	.	H	α-helix	trans	-62.2	-43.6	177.3	0	0	0	0	0	113.3	G53 F54 G55 S61	G53-G57 PolarHBondContact O-N 3.01Å; F54-G57 PolarHBondContact O-N 3.47Å; G55-G57 VanDerWaalsContact C-N 3.34Å; G55-G57 PolarHBondContact O-N 3.17Å; G57-S61 WeakPolarHBondContact O-CB 3.26Å; G57-S61 PolarHBondContact O-N 3.01Å; G57-S61 PolarHBondContact O-OG 3.08Å
58	M	84.7	Confident	82.9	Confident	111 Å²	111	80.7 Å²	80.7	55%	0.547	46%	0.457	S	S	.	.	H	α-helix	trans	-66.2	-42.6	179.2	-126	-178.5	-174.7	0	0	112	F54 G55 S61 N62	F54-M58 HydrophobicContact CE1-CE 4.25Å; F54-M58 HydrophobicContact CE1-SD 3.72Å; F54-M58 HydrophobicContact CZ-CE 4.2Å; F54-M58 HydrophobicContact CZ-SD 4.17Å; F54-M58 PolarHBondContact O-N 3.45Å; G55-M58 PolarHBondContact O-N 2.97Å; M58-S61 WeakPolarHBondContact CA-OG 3.2Å; M58-S61 PolarHBondContact O-N 3.21Å; M58-S61 PolarHBondContact O-OG 2.93Å; M58-N62 WeakPolarHBondContact O-CB 3.49Å; M58-N62 PolarHBondContact O-N 3.39Å
59	G	84.5	Confident	81.8	Confident	22 Å²	22	81.2 Å²	81.2	23%	0.227	46%	0.457	C	S	.	.	H	α-helix	trans	-64.1	-44.9	177.9	0	0	0	0	0	112.7	G55 L56 S61 N62 C63	G55-G59 PolarHBondContact O-N 2.97Å; L56-G59 PolarHBondContact O-N 3.14Å; G59-S61 PolarHBondContact O-N 3.48Å; G59-N62 PolarHBondContact O-N 2.87Å; G59-C63 PolarHBondContact O-N 2.05Å; G59-C63 VanDerWaalsContact O-N 3.14Å
60	I	84.9	Confident	80.2	Confident	119 Å²	119	81.3 Å²	81.3	61%	0.61	47%	0.465	S	S	*	.	H	α-helix	trans	-63.8	-42.3	178.9	-66.7	166	0	0	0	111	L56 N64	L56-I60 WeakPolarHBondContact O-CB 3.15Å; L56-I60 WeakPolarHBondContact O-CD1 3.17Å; L56-I60 WeakPolarHBondContact O-CG1 3.49Å; L56-I60 PolarHBondContact O-N 3.42Å; L56-I60 VanDerWaalsContact O-N 3.08Å; I60-N64 WeakPolarHBondContact O-CB 3.03Å; I60-N64 PolarHBondContact O-N 2.77Å
61	S	85.6	Confident	78.5	Confident	67 Å²	67	81.6 Å²	81.6	47%	0.469	47%	0.471	S	S	.	.	H	α-helix	trans	-70.2	-37.7	179.2	50.3	0	0	0	0	113	G57 M58 G59 N64 N65	G57-S61 WeakPolarHBondContact O-CB 3.26Å; G57-S61 PolarHBondContact O-N 3.01Å; G57-S61 PolarHBondContact O-OG 3.08Å; M58-S61 WeakPolarHBondContact CA-OG 3.2Å; M58-S61 PolarHBondContact O-N 3.21Å; M58-S61 PolarHBondContact O-OG 2.93Å; G59-S61 PolarHBondContact O-N 3.48Å; S61-N64 PolarHBondContact O-N 3.46Å; S61-N65 WeakPolarHBondContact O-CB 3.23Å; S61-N65 PolarHBondContact O-N 3.27Å
62	N	82.5	Confident	76.9	Confident	72 Å²	72	85.5 Å²	85.5	39%	0.385	49%	0.49	S	S	.	.	H	α-helix	trans	-61.5	-44.9	176.1	-160.5	48.1	0	0	0	111.1	T22 M58 G59 N65 D66	T22-N62 PolarHBondContact OG1-ND2 2.92Å; M58-N62 WeakPolarHBondContact O-CB 3.49Å; M58-N62 PolarHBondContact O-N 3.39Å; G59-N62 PolarHBondContact O-N 2.87Å; N62-N65 PolarHBondContact O-N 2.81Å; N62-D66 PolarHBondContact O-N 3.48Å; N62-D66 VanDerWaalsContact O-N 3.17Å
63	C	81	Confident	75.3	Confident	16 Å²	16	87.7 Å²	87.7	11%	0.108	50%	0.497	C	S	.	.	H	α-helix	trans	-67.4	-45.9	175.4	-64.8	0	0	0	0	112.6	C18 G59 N65 D66 F67	C18-C63 HydrophobicContact CB-CB 4.03Å; C18-C63 WeakPolarHBondContact CB-SG 3.14Å; C18-C63 WeakPolarHBondContact SG-CA 2.89Å; C18-C63 WeakPolarHBondContact SG-CB 3.36Å; C18-C63 CovalentContact SG-SG 2.05Å; C18-C63 PolarHBondContact SG-SG 3.28Å; G59-C63 PolarHBondContact O-N 2.05Å; G59-C63 VanDerWaalsContact O-N 3.14Å; C63-N65 PolarHBondContact O-N 2.81Å; C63-D66 PolarHBondContact O-N 2.76Å; C63-F67 HydrophobicContact CB-CD2 4.32Å; C63-F67 HydrophobicContact CB-CE2 4.06Å; C63-F67 WeakPolarHBondContact O-CD2 3.48Å; C63-F67 PolarHBondContact O-N 2.93Å
64	N	81.3	Confident	73.5	Confident	85 Å²	85	91.5 Å²	91.5	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-58.8	-34.4	178.7	-174.6	56.6	0	0	0	112.4	I60 S61 F67 K68	I60-N64 WeakPolarHBondContact O-CB 3.03Å; I60-N64 PolarHBondContact O-N 2.77Å; S61-N64 PolarHBondContact O-N 3.46Å; N64-F67 PolarHBondContact O-N 3.43Å; N64-K68 VanDerWaalsContact O-CB 3.23Å; N64-K68 WeakPolarHBondContact O-CB 3.3Å; N64-K68 WeakPolarHBondContact O-CG 3.49Å; N64-K68 PolarHBondContact O-N 3.07Å
65	N	78.5	Confident	71.8	Confident	113 Å²	113	90.5 Å²	90.5	60%	0.604	52%	0.52	S	S	*	.	H	α-helix	trans	-66.3	-43.4	173	-175.5	72.3	0	0	0	112.2	S61 N62 C63 F67 K68 Q69	S61-N65 WeakPolarHBondContact O-CB 3.23Å; S61-N65 PolarHBondContact O-N 3.27Å; N62-N65 PolarHBondContact O-N 2.81Å; C63-N65 PolarHBondContact O-N 2.81Å; N65-F67 VanDerWaalsContact C-N 3.3Å; N65-F67 PolarHBondContact O-N 2.69Å; N65-K68 PolarHBondContact O-N 3.49Å; N65-Q69 PolarHBondContact O-N 2.87Å
66	D	73.8	Confident	70.1	Confident	65 Å²	65	95.2 Å²	95.2	35%	0.348	53%	0.532	S	S	.	.	H	α-helix	trans	-62.4	-36.5	175.6	-167.6	-104.1	0	0	0	111.9	N62 C63 Q69	N62-D66 PolarHBondContact O-N 3.48Å; N62-D66 VanDerWaalsContact O-N 3.17Å; C63-D66 PolarHBondContact O-N 2.76Å; D66-Q69 VanDerWaalsContact O-CG 3.26Å; D66-Q69 WeakPolarHBondContact O-CG 3.1Å; D66-Q69 PolarHBondContact O-NE2 2.63Å; D66-Q69 PolarHBondContact OD2-NE2 3.32Å
67	F	69.5	Low	68.5	Low	65 Å²	65	100.3 Å²	100.3	29%	0.285	54%	0.543	S	S	.	.	H	α-helix	trans	-72.8	-35.4	173.2	-71.4	-74.2	0	0	0	113.7	L11 K14 C63 N64 N65 Q69	L11-F67 HydrophobicContact CD1-CE1 4.4Å; K14-F67 HydrophobicContact CB-CD1 4.35Å; K14-F67 HydrophobicContact CB-CE1 3.34Å; K14-F67 HydrophobicContact CB-CZ 3.67Å; K14-F67 HydrophobicContact CD-CD1 3.81Å; K14-F67 HydrophobicContact CD-CE1 3.48Å; K14-F67 VanDerWaalsContact CD-CE1 3.48Å; K14-F67 HydrophobicContact CG-CE1 4.06Å; C63-F67 HydrophobicContact CB-CD2 4.32Å; C63-F67 HydrophobicContact CB-CE2 4.06Å; C63-F67 WeakPolarHBondContact O-CD2 3.48Å; C63-F67 PolarHBondContact O-N 2.93Å; N64-F67 PolarHBondContact O-N 3.43Å; N65-F67 VanDerWaalsContact C-N 3.3Å; N65-F67 PolarHBondContact O-N 2.69Å; F67-Q69 VanDerWaalsContact C-N 3.31Å; F67-Q69 PolarHBondContact O-N 3.01Å
68	K	66.5	Low	66.5	Low	138 Å²	138	104.3 Å²	104.3	60%	0.6	55%	0.554	S	S	*	*	H	α-helix	trans	-73	-19.9	-177.6	-95.7	176.8	174.2	-74.5	0	113.6	N64 N65 P70	N64-K68 VanDerWaalsContact O-CB 3.23Å; N64-K68 WeakPolarHBondContact O-CB 3.3Å; N64-K68 WeakPolarHBondContact O-CG 3.49Å; N64-K68 PolarHBondContact O-N 3.07Å; N65-K68 PolarHBondContact O-N 3.49Å; K68-P70 WeakPolarHBondContact O-CD 3.09Å; K68-P70 WeakPolarHBondContact O-CG 2.92Å
69	Q	61.3	Low	65.1	Low	115 Å²	115	104.8 Å²	104.8	54%	0.537	56%	0.563	S	S	.	*			trans	-56.5	101	173.9	82.5	-168.4	-97.6	0	0	107.8	N65 D66 F67 L71	N65-Q69 PolarHBondContact O-N 2.87Å; D66-Q69 VanDerWaalsContact O-CG 3.26Å; D66-Q69 WeakPolarHBondContact O-CG 3.1Å; D66-Q69 PolarHBondContact O-NE2 2.63Å; D66-Q69 PolarHBondContact OD2-NE2 3.32Å; F67-Q69 VanDerWaalsContact C-N 3.31Å; F67-Q69 PolarHBondContact O-N 3.01Å; Q69-L71 PolarHBondContact O-N 3.23Å; Q69-L71 VanDerWaalsContact O-N 3.07Å
70	P	52.4	Low	63.6	Low	114 Å²	114	107.7 Å²	107.7	74%	0.74	58%	0.579	S	S	*	*			trans	-95.7	68.4	-168.9	32.8	-18.3	0	0	0	105.1	K68	K68-P70 WeakPolarHBondContact O-CD 3.09Å; K68-P70 WeakPolarHBondContact O-CG 2.92Å
71	L	52	Low	62.5	Low	125 Å²	125	106.4 Å²	106.4	65%	0.654	58%	0.581	S	S	*	*			trans	-130.8	118.9	174.3	-71.2	172.8	0	0	0	108.8	Q69 L73	Q69-L71 PolarHBondContact O-N 3.23Å; Q69-L71 VanDerWaalsContact O-N 3.07Å; L71-L73 HydrophobicContact CB-CD2 4.3Å; L71-L73 HydrophobicContact CB-CG 4.26Å; L71-L73 PolarHBondContact O-N 2.75Å
72	P	52.7	Low	61.2	Low	120 Å²	120	109.1 Å²	109.1	78%	0.779	59%	0.59	S	S	*	*			trans	-72.5	66.3	169.8	34.6	-33.2	0	0	0	107.1	V74	P72-V74 PolarHBondContact O-N 3.29Å
73	L	53	Low	59.6	Low	132 Å²	132	111 Å²	111	69%	0.691	60%	0.597	S	S	*	*			trans	-74.1	100.5	157.3	-56.8	-155.3	0	0	0	102.7	L71 S75	L71-L73 HydrophobicContact CB-CD2 4.3Å; L71-L73 HydrophobicContact CB-CG 4.26Å; L71-L73 PolarHBondContact O-N 2.75Å; L73-S75 PolarHBondContact O-N 2.77Å
74	V	52.5	Low	58.1	Low	123 Å²	123	116.1 Å²	116.1	75%	0.745	63%	0.627	S	S	*	*			trans	-43.2	75.8	138.1	177.1	0	0	0	0	105.7	P72 H76	P72-V74 PolarHBondContact O-N 3.29Å; V74-H76 PolarHBondContact O-N 3.12Å
75	S	52.4	Low	56.4	Low	104 Å²	104	116.3 Å²	116.3	73%	0.727	63%	0.633	S	S	*	*			trans	-76.7	86.3	175.5	-163.6	0	0	0	0	101.3	L73 R77	L73-S75 PolarHBondContact O-N 2.77Å; S75-R77 PolarHBondContact O-N 3.07Å
76	H	48.6	Very low	55.2	Low	139 Å²	139	119.7 Å²	119.7	64%	0.644	65%	0.645	S	S	*	*			trans	-33.8	119.9	171.2	-112.8	-96.3	0	0	0	107.2	V74 I78	V74-H76 PolarHBondContact O-N 3.12Å; H76-I78 HydrophobicContact CB-CD1 3.97Å; H76-I78 HydrophobicContact CB-CG1 4Å; H76-I78 WeakPolarHBondContact ND1-CD1 3.39Å; H76-I78 PolarHBondContact O-N 2.92Å
77	R	52.3	Low	53.8	Low	222 Å²	222	124.3 Å²	124.3	84%	0.838	67%	0.665	S	S	*	*	S	Bend	trans	-57.4	74.6	168.5	-80.9	-97.5	-160.1	-139.8	2.7	108.2	S75	S75-R77 PolarHBondContact O-N 3.07Å
78	I	47.4	Very low	52.4	Low	123 Å²	123	130.6 Å²	130.6	63%	0.631	69%	0.692	S	S	*	*	S	Bend	trans	-150.5	88.9	173.2	-25.4	163.1	0	0	0	106.8	H76	H76-I78 HydrophobicContact CB-CD1 3.97Å; H76-I78 HydrophobicContact CB-CG1 4Å; H76-I78 WeakPolarHBondContact ND1-CD1 3.39Å; H76-I78 PolarHBondContact O-N 2.92Å
79	V	53.7	Low	51.1	Low	122 Å²	122	132.4 Å²	132.4	74%	0.739	70%	0.7	S	S	*	*			trans	57.7	77.1	150	-166	0	0	0	0	116.4
80	S	53.8	Low	50	Low	82 Å²	82	132.4 Å²	132.4	57%	0.573	71%	0.713	S	S	*	*			trans	-133.7	92.8	145.9	-179.4	0	0	0	0	105.5	N82	S80-N82 VanDerWaalsContact C-N 3.27Å
81	S	61.4	Low	49.7	Very low	92 Å²	92	134.7 Å²	134.7	64%	0.643	73%	0.731	S	S	*	*			cis	55.7	14.8	29.2	-153.1	0	0	0	0	116.9
82	N	58	Low	49.6	Very low	125 Å²	125	135.2 Å²	135.2	67%	0.668	74%	0.735	S	S	*	*			trans	-145.3	39.6	171.7	-83.7	-50.6	0	0	0	114.8	S80	S80-N82 VanDerWaalsContact C-N 3.27Å
83	Q	50.4	Low	49.4	Very low	112 Å²	112	135.9 Å²	135.9	52%	0.523	73%	0.732	S	S	.	*			trans	-133.5	32.8	154.8	-50.8	-84.2	-89	0	0	110.3	D21 P85	D21-Q83 VanDerWaalsContact OD2-CB 3.3Å; D21-Q83 WeakPolarHBondContact OD2-CB 3.39Å; D21-Q83 VanDerWaalsContact OD2-CG 3.26Å; D21-Q83 WeakPolarHBondContact OD2-CG 3.49Å; D21-Q83 PolarHBondContact OD2-OE1 2.63Å; Q83-P85 WeakPolarHBondContact O-CD 3.22Å
84	V	49.1	Very low	49.2	Very low	123 Å²	123	136.2 Å²	136.2	75%	0.745	74%	0.735	S	S	*	*			trans	-83.6	101.9	154.3	169.8	0	0	0	0	104.9	E86	V84-E86 VanDerWaalsContact C-N 3.26Å; V84-E86 PolarHBondContact O-N 2.98Å
85	P	46	Very low	49	Very low	89 Å²	89	136.9 Å²	136.9	58%	0.578	73%	0.734	S	S	*	*			trans	-66.6	102.6	156.6	21.5	-16.5	0	0	0	106.4	I24 Q83 E87	I24-P85 HydrophobicContact CG2-CG 3.22Å; Q83-P85 WeakPolarHBondContact O-CD 3.22Å; P85-E87 VanDerWaalsContact C-N 3.26Å; P85-E87 PolarHBondContact O-N 3.3Å
86	E	52.8	Low	48.8	Very low	183 Å²	183	139 Å²	139	86%	0.855	73%	0.734	S	S	*	*			trans	-53.1	84.7	158.7	-172.4	-161.4	122.3	0	0	109.4	V84	V84-E86 VanDerWaalsContact C-N 3.26Å; V84-E86 PolarHBondContact O-N 2.98Å
87	E	44.2	Very low	48.8	Very low	162 Å²	162	139 Å²	139	76%	0.757	74%	0.741	S	S	*	*			trans	-166.5	77.9	158.6	-130.5	-106.7	85.9	0	0	113.7	P85	P85-E87 VanDerWaalsContact C-N 3.26Å; P85-E87 PolarHBondContact O-N 3.3Å
88	K	41	Very low	48.5	Very low	198 Å²	198	133.1 Å²	133.1	86%	0.861	73%	0.734	S	S	*	*				-146.2	77	129	-98.7	-163.7	-170	-66.4	0	107.1	S90	K88-S90 VanDerWaalsContact C-N 3.32Å; K88-S90 PolarHBondContact O-N 3.42Å
89	K	37.4	Very low	48.6	Very low	176 Å²	176	133.8 Å²	133.8	77%	0.765	74%	0.742	S	S	*	*			trans	-62.5	98	161.3	179.9	168.6	177	-72.2	0	107	S91	K89-S91 VanDerWaalsContact C-N 3.25Å; K89-S91 PolarHBondContact NZ-O 2.97Å; K89-S91 PolarHBondContact O-N 3.12Å
90	S	39.4	Very low	48.2	Very low	115 Å²	115	134.8 Å²	134.8	80%	0.804	74%	0.742	S	S	*	*			trans	-73	80.1	167.7	176.4	0	0	0	0	109.2	K88	K88-S90 VanDerWaalsContact C-N 3.32Å; K88-S90 PolarHBondContact O-N 3.42Å
91	S	45.1	Very low	47.7	Very low	161 Å²	161	139.6 Å²	139.6	100%	1.126	76%	0.757	S	S	*	*			trans	167.5	0	152	-82	0	0	0	0	110.6	K89	K89-S91 VanDerWaalsContact C-N 3.25Å; K89-S91 PolarHBondContact NZ-O 2.97Å; K89-S91 PolarHBondContact O-N 3.12Å

Retrieved 91 of 91 residues in 221.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).