A0A146MHZ9_SCHMA Loading...

Protein BRICK1 AlphaSync

AlphaFold DB , UniProt , Accession A0A146MHZ9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 92 aa.

						>A0A146MHZ9_SCHMA|A0A146MHZ9
MASTFRAAKEIKDDWGNRERIDVITTNIKSLVNFLNRFDSSCRTKLSQLDSKLTNAEKHVDLLEAHVHRILSQQNHQRPTLKSPQHSLTPND
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	70.6	Confident	90.1	Very high	208 Å²	208	112.5 Å²	112.5	100%	1.025	61%	0.605	S	S	*	*				0	-34.4	0	-71	-167	-94.8	0	0	113.8	T4 F5	M1-T4 PolarHBondContact O-OG1 3.49Å; M1-F5 PolarHBondContact O-N 2.99Å
2	A	81.9	Confident	90.6	Very high	83 Å²	83	116.1 Å²	116.1	69%	0.686	61%	0.611	S	S	*	*	H	α-helix	trans	-63.6	-42.9	177.8	0	0	0	0	0	113.8	T4 F5 R6	A2-T4 VanDerWaalsContact C-N 3.31Å; A2-T4 PolarHBondContact O-N 3.2Å; A2-F5 PolarHBondContact O-N 3.25Å; A2-R6 PolarHBondContact O-N 3.1Å
3	S	87.3	Confident	91.1	Very high	101 Å²	101	113.5 Å²	113.5	71%	0.706	60%	0.598	S	S	*	*	H	α-helix	trans	-62.4	-35.8	-179.2	-42.7	0	0	0	0	113.1	R6 A7	S3-R6 PolarHBondContact O-N 3.33Å; S3-A7 WeakPolarHBondContact O-CB 3.12Å; S3-A7 PolarHBondContact O-N 3.46Å
4	T	90.7	Very high	91.6	Very high	98 Å²	98	110 Å²	110	60%	0.601	58%	0.58	S	S	*	*	H	α-helix	trans	-69.9	-37.8	178.2	50.2	0	0	0	0	111.8	M1 A2 A8	M1-T4 PolarHBondContact O-OG1 3.49Å; A2-T4 VanDerWaalsContact C-N 3.31Å; A2-T4 PolarHBondContact O-N 3.2Å; T4-A8 WeakPolarHBondContact O-CB 3.39Å; T4-A8 PolarHBondContact O-N 2.8Å
5	F	92.2	Very high	92.1	Very high	158 Å²	158	114.3 Å²	114.3	69%	0.693	59%	0.586	S	S	*	*	H	α-helix	trans	-67	-42.3	174.8	-178.4	-96.8	0	0	0	111.9	M1 A2 A8 K9	M1-F5 PolarHBondContact O-N 2.99Å; A2-F5 PolarHBondContact O-N 3.25Å; F5-A8 PolarHBondContact O-N 3.05Å; F5-K9 PolarHBondContact O-N 2.99Å
6	R	92.6	Very high	92.4	Very high	170 Å²	170	108.9 Å²	108.9	64%	0.642	57%	0.568	S	S	*	*	H	α-helix	trans	-60.6	-47.8	174.6	-178.9	175.7	176.5	163.3	2.9	111.4	A2 S3 A8 K9 E10	A2-R6 PolarHBondContact O-N 3.1Å; S3-R6 PolarHBondContact O-N 3.33Å; R6-A8 VanDerWaalsContact C-N 3.32Å; R6-A8 PolarHBondContact O-N 3.45Å; R6-K9 PolarHBondContact O-N 2.96Å; R6-E10 HydrophobicContact CG-CG 4.43Å; R6-E10 WeakPolarHBondContact CG-OE1 3.44Å; R6-E10 IonicContact CZ-OE1 3.65Å; R6-E10 IonicContact NE-OE1 2.82Å; R6-E10 PolarHBondContact NE-OE1 2.86Å; R6-E10 IonicContact NH2-OE1 3.6Å; R6-E10 WeakPolarHBondContact O-CG 3.28Å; R6-E10 PolarHBondContact O-N 3.34Å
7	A	92.9	Very high	92.8	Very high	39 Å²	39	106.6 Å²	106.6	32%	0.322	56%	0.556	S	S	.	*	H	α-helix	trans	-59.5	-42.6	176.1	0	0	0	0	0	111.8	S3 K9 E10 I11	S3-A7 WeakPolarHBondContact O-CB 3.12Å; S3-A7 PolarHBondContact O-N 3.46Å; A7-K9 VanDerWaalsContact C-N 3.33Å; A7-K9 PolarHBondContact O-N 3.49Å; A7-E10 PolarHBondContact O-N 3.13Å; A7-I11 WeakPolarHBondContact O-CB 3.37Å; A7-I11 WeakPolarHBondContact O-CD1 3.42Å; A7-I11 WeakPolarHBondContact O-CG1 3.43Å; A7-I11 PolarHBondContact O-N 3.2Å
8	A	94.3	Very high	93.1	Very high	57 Å²	57	109.1 Å²	109.1	47%	0.471	56%	0.557	S	S	.	*	H	α-helix	trans	-62.4	-39.2	176.7	0	0	0	0	0	112.6	T4 F5 R6 K12	T4-A8 WeakPolarHBondContact O-CB 3.39Å; T4-A8 PolarHBondContact O-N 2.8Å; F5-A8 PolarHBondContact O-N 3.05Å; R6-A8 VanDerWaalsContact C-N 3.32Å; R6-A8 PolarHBondContact O-N 3.45Å; A8-K12 WeakPolarHBondContact O-CB 3.44Å; A8-K12 PolarHBondContact O-N 3.14Å
9	K	95	Very high	93.4	Very high	124 Å²	124	110.5 Å²	110.5	54%	0.539	56%	0.561	S	S	.	*	H	α-helix	trans	-65.3	-48.4	173.9	-176.8	-178.6	175.3	-174.8	0	111.4	F5 R6 A7 I11 K12 D13	F5-K9 PolarHBondContact O-N 2.99Å; R6-K9 PolarHBondContact O-N 2.96Å; A7-K9 VanDerWaalsContact C-N 3.33Å; A7-K9 PolarHBondContact O-N 3.49Å; K9-I11 VanDerWaalsContact C-N 3.29Å; K9-I11 PolarHBondContact O-N 3.2Å; K9-K12 PolarHBondContact O-N 3.02Å; K9-K12 VanDerWaalsContact O-N 3.12Å; K9-D13 VanDerWaalsContact O-CG 3.3Å; K9-D13 PolarHBondContact O-N 3.47Å
10	E	96.5	Very high	93.6	Very high	101 Å²	101	112.1 Å²	112.1	47%	0.472	56%	0.56	S	S	.	*	H	α-helix	trans	-59	-40.9	178.1	-72.9	170.9	-179.3	0	0	111.4	R6 A7 D13 D14	R6-E10 HydrophobicContact CG-CG 4.43Å; R6-E10 WeakPolarHBondContact CG-OE1 3.44Å; R6-E10 IonicContact CZ-OE1 3.65Å; R6-E10 IonicContact NE-OE1 2.82Å; R6-E10 PolarHBondContact NE-OE1 2.86Å; R6-E10 IonicContact NH2-OE1 3.6Å; R6-E10 WeakPolarHBondContact O-CG 3.28Å; R6-E10 PolarHBondContact O-N 3.34Å; A7-E10 PolarHBondContact O-N 3.13Å; E10-D13 PolarHBondContact O-N 3.42Å; E10-D14 WeakPolarHBondContact O-CB 3.45Å; E10-D14 PolarHBondContact O-N 3.21Å
11	I	96.6	Very high	93.9	Very high	98 Å²	98	111.8 Å²	111.8	50%	0.503	56%	0.559	S	S	.	*	H	α-helix	trans	-62.2	-48.5	173.4	-70.3	163.9	0	0	0	110.6	A7 K9 D13 D14 W15	A7-I11 WeakPolarHBondContact O-CB 3.37Å; A7-I11 WeakPolarHBondContact O-CD1 3.42Å; A7-I11 WeakPolarHBondContact O-CG1 3.43Å; A7-I11 PolarHBondContact O-N 3.2Å; K9-I11 VanDerWaalsContact C-N 3.29Å; K9-I11 PolarHBondContact O-N 3.2Å; I11-D13 VanDerWaalsContact C-N 3.31Å; I11-D13 PolarHBondContact O-N 2.96Å; I11-D14 WeakPolarHBondContact O-CB 3.48Å; I11-D14 PolarHBondContact O-N 3.44Å; I11-W15 PolarHBondContact O-N 3.15Å
12	K	96.6	Very high	95.2	Very high	156 Å²	156	106.4 Å²	106.4	68%	0.678	53%	0.534	S	S	*	.	H	α-helix	trans	-59.8	-41.5	178.9	-174.7	179.3	178.1	-178.4	0	112.1	A8 K9 D14 W15 G16	A8-K12 WeakPolarHBondContact O-CB 3.44Å; A8-K12 PolarHBondContact O-N 3.14Å; K9-K12 PolarHBondContact O-N 3.02Å; K9-K12 VanDerWaalsContact O-N 3.12Å; K12-D14 VanDerWaalsContact C-N 3.35Å; K12-W15 WeakPolarHBondContact O-CB 3.38Å; K12-W15 PolarHBondContact O-N 3.37Å; K12-G16 PolarHBondContact O-N 3.41Å
13	D	97.5	Very high	96	Very high	82 Å²	82	106 Å²	106	44%	0.439	52%	0.524	S	S	.	.	H	α-helix	trans	-67.2	-37.2	177.6	-66.5	-16.9	0	0	0	110.9	K9 E10 I11 G16 N17	K9-D13 VanDerWaalsContact O-CG 3.3Å; K9-D13 PolarHBondContact O-N 3.47Å; E10-D13 PolarHBondContact O-N 3.42Å; I11-D13 VanDerWaalsContact C-N 3.31Å; I11-D13 PolarHBondContact O-N 2.96Å; D13-G16 PolarHBondContact O-N 3.41Å; D13-N17 VanDerWaalsContact O-CG 3.27Å; D13-N17 PolarHBondContact O-N 3.02Å
14	D	97.9	Very high	96.5	Very high	65 Å²	65	105.5 Å²	105.5	35%	0.348	51%	0.512	S	S	.	.	H	α-helix	trans	-61.8	-42	172.8	-172.4	55.4	0	0	0	112.1	E10 I11 K12 G16 N17 R18	E10-D14 WeakPolarHBondContact O-CB 3.45Å; E10-D14 PolarHBondContact O-N 3.21Å; I11-D14 WeakPolarHBondContact O-CB 3.48Å; I11-D14 PolarHBondContact O-N 3.44Å; K12-D14 VanDerWaalsContact C-N 3.35Å; D14-G16 PolarHBondContact O-N 3Å; D14-N17 PolarHBondContact O-N 3.05Å; D14-R18 WeakPolarHBondContact O-CG 3.33Å; D14-R18 PolarHBondContact O-N 3.26Å; D14-R18 IonicContact OD1-NE 3.77Å; D14-R18 IonicContact OD2-CZ 3.16Å; D14-R18 IonicContact OD2-NE 2.77Å; D14-R18 PolarHBondContact OD2-NE 3Å; D14-R18 IonicContact OD2-NH2 2.8Å; D14-R18 PolarHBondContact OD2-NH2 2.96Å
15	W	98.3	Very high	96.9	Very high	174 Å²	174	103.2 Å²	103.2	66%	0.659	50%	0.498	S	S	*	.	H	α-helix	trans	-57	-47.8	173.7	-73.7	106	0	0	0	112	I11 K12 N17 R18 E19	I11-W15 PolarHBondContact O-N 3.15Å; K12-W15 WeakPolarHBondContact O-CB 3.38Å; K12-W15 PolarHBondContact O-N 3.37Å; W15-N17 VanDerWaalsContact C-N 3.31Å; W15-N17 PolarHBondContact O-N 3.42Å; W15-R18 PolarHBondContact O-N 2.92Å; W15-E19 PolarHBondContact O-N 2.89Å
16	G	98.1	Very high	97.2	Very high	29 Å²	29	99.1 Å²	99.1	30%	0.299	49%	0.486	S	S	.	.	H	α-helix	trans	-65.8	-32.9	178.1	0	0	0	0	0	113.3	K12 D13 D14 R20	K12-G16 PolarHBondContact O-N 3.41Å; D13-G16 PolarHBondContact O-N 3.41Å; D14-G16 PolarHBondContact O-N 3Å; G16-R20 PolarHBondContact O-N 2.74Å
17	N	98.4	Very high	97.5	Very high	70 Å²	70	95.5 Å²	95.5	37%	0.374	48%	0.479	S	S	.	.	H	α-helix	trans	-69.1	-42.4	174.1	-71.5	-17.4	0	0	0	112.1	D13 D14 W15 R20 I21	D13-N17 VanDerWaalsContact O-CG 3.27Å; D13-N17 PolarHBondContact O-N 3.02Å; D14-N17 PolarHBondContact O-N 3.05Å; W15-N17 VanDerWaalsContact C-N 3.31Å; W15-N17 PolarHBondContact O-N 3.42Å; N17-R20 PolarHBondContact O-N 3.47Å; N17-R20 PolarHBondContact OD1-NH1 3.49Å; N17-R20 PolarHBondContact OD1-NH2 3.37Å; N17-I21 WeakPolarHBondContact O-CG1 3.48Å; N17-I21 PolarHBondContact O-N 3.04Å
18	R	98.6	Very high	97.8	Very high	150 Å²	150	98.1 Å²	98.1	57%	0.566	49%	0.487	S	S	*	.	H	α-helix	trans	-62.6	-43.8	176.2	-71.8	180	-167.9	-149.1	5.7	112	D14 W15 R20 I21 D22	D14-R18 WeakPolarHBondContact O-CG 3.33Å; D14-R18 PolarHBondContact O-N 3.26Å; D14-R18 IonicContact OD1-NE 3.77Å; D14-R18 IonicContact OD2-CZ 3.16Å; D14-R18 IonicContact OD2-NE 2.77Å; D14-R18 PolarHBondContact OD2-NE 3Å; D14-R18 IonicContact OD2-NH2 2.8Å; D14-R18 PolarHBondContact OD2-NH2 2.96Å; W15-R18 PolarHBondContact O-N 2.92Å; R18-R20 VanDerWaalsContact C-N 3.34Å; R18-R20 PolarHBondContact O-N 3.38Å; R18-I21 PolarHBondContact O-N 3.19Å; R18-D22 PolarHBondContact O-N 3.04Å
19	E	98.3	Very high	98	Very high	137 Å²	137	101.3 Å²	101.3	64%	0.64	49%	0.49	S	S	*	.	H	α-helix	trans	-58.3	-46.1	175.1	-177.2	179.1	-161.3	0	0	111.2	W15 I21 D22 V23	W15-E19 PolarHBondContact O-N 2.89Å; E19-I21 VanDerWaalsContact C-N 3.34Å; E19-I21 PolarHBondContact O-N 2.85Å; E19-D22 PolarHBondContact O-N 2.98Å; E19-D22 VanDerWaalsContact O-N 3.16Å; E19-V23 WeakPolarHBondContact O-CG2 3.47Å; E19-V23 PolarHBondContact O-N 3Å
20	R	98.4	Very high	98.1	Very high	141 Å²	141	99 Å²	99	53%	0.532	49%	0.49	S	S	.	.	H	α-helix	trans	-59.5	-43.8	176.7	-167.1	-173.8	-50.8	104.8	7.1	112.4	G16 N17 R18 D22 I24	G16-R20 PolarHBondContact O-N 2.74Å; N17-R20 PolarHBondContact O-N 3.47Å; N17-R20 PolarHBondContact OD1-NH1 3.49Å; N17-R20 PolarHBondContact OD1-NH2 3.37Å; R18-R20 VanDerWaalsContact C-N 3.34Å; R18-R20 PolarHBondContact O-N 3.38Å; R20-D22 VanDerWaalsContact C-N 3.32Å; R20-I24 HydrophobicContact CG-CD1 4.27Å; R20-I24 VanDerWaalsContact O-CG1 3.31Å; R20-I24 WeakPolarHBondContact O-CG1 3.36Å; R20-I24 PolarHBondContact O-N 3.15Å; R20-I24 VanDerWaalsContact O-N 3.13Å
21	I	98.5	Very high	98.3	Very high	106 Å²	106	99.5 Å²	99.5	54%	0.544	50%	0.495	S	S	.	.	H	α-helix	trans	-63.7	-39.5	177.2	-69.4	167.1	0	0	0	110.7	N17 R18 E19 I24 T25	N17-I21 WeakPolarHBondContact O-CG1 3.48Å; N17-I21 PolarHBondContact O-N 3.04Å; R18-I21 PolarHBondContact O-N 3.19Å; E19-I21 VanDerWaalsContact C-N 3.34Å; E19-I21 PolarHBondContact O-N 2.85Å; I21-I24 PolarHBondContact O-N 3.26Å; I21-T25 VanDerWaalsContact O-CB 3.28Å; I21-T25 WeakPolarHBondContact O-CB 3.25Å; I21-T25 PolarHBondContact O-N 3.02Å; I21-T25 PolarHBondContact O-OG1 2.93Å
22	D	98.5	Very high	98.4	Very high	95 Å²	95	98.1 Å²	98.1	51%	0.508	49%	0.491	S	S	.	.	H	α-helix	trans	-67.5	-40.9	179.7	-170.5	53.5	0	0	0	112.4	R18 E19 R20 I24 T25 T26	R18-D22 PolarHBondContact O-N 3.04Å; E19-D22 PolarHBondContact O-N 2.98Å; E19-D22 VanDerWaalsContact O-N 3.16Å; R20-D22 VanDerWaalsContact C-N 3.32Å; D22-I24 PolarHBondContact O-N 3.07Å; D22-T25 PolarHBondContact O-N 3.26Å; D22-T26 WeakPolarHBondContact O-CB 3.34Å; D22-T26 PolarHBondContact O-N 2.92Å; D22-T26 PolarHBondContact O-OG1 3.37Å
23	V	98.5	Very high	98.4	Very high	76 Å²	76	95.3 Å²	95.3	46%	0.461	48%	0.483	S	S	.	.	H	α-helix	trans	-59.5	-48.1	172.8	175	0	0	0	0	111	E19 T25 T26 N27	E19-V23 WeakPolarHBondContact O-CG2 3.47Å; E19-V23 PolarHBondContact O-N 3Å; V23-T25 VanDerWaalsContact C-N 3.34Å; V23-T25 PolarHBondContact O-N 2.98Å; V23-T26 PolarHBondContact O-N 3.11Å; V23-N27 VanDerWaalsContact O-CG 3.28Å; V23-N27 PolarHBondContact O-N 3.17Å; V23-N27 PolarHBondContact O-ND2 3.49Å
24	I	98.5	Very high	98.5	Very high	89 Å²	89	97.2 Å²	97.2	46%	0.456	49%	0.488	S	S	.	.	H	α-helix	trans	-61	-45.9	177.9	-67.3	166.3	0	0	0	110.4	R20 I21 D22 T26 N27 I28	R20-I24 HydrophobicContact CG-CD1 4.27Å; R20-I24 VanDerWaalsContact O-CG1 3.31Å; R20-I24 WeakPolarHBondContact O-CG1 3.36Å; R20-I24 PolarHBondContact O-N 3.15Å; R20-I24 VanDerWaalsContact O-N 3.13Å; I21-I24 PolarHBondContact O-N 3.26Å; D22-I24 PolarHBondContact O-N 3.07Å; I24-T26 VanDerWaalsContact C-N 3.32Å; I24-T26 PolarHBondContact O-N 3.41Å; I24-N27 PolarHBondContact O-N 3.05Å; I24-I28 HydrophobicContact CG2-CD1 3.85Å; I24-I28 HydrophobicContact CG2-CG1 4.46Å; I24-I28 WeakPolarHBondContact O-CG1 3.45Å; I24-I28 PolarHBondContact O-N 2.97Å
25	T	98.7	Very high	98.5	Very high	51 Å²	51	98.9 Å²	98.9	31%	0.313	50%	0.496	S	S	.	.	H	α-helix	trans	-60.4	-42.7	179.3	-61.7	0	0	0	0	111.6	I21 D22 V23 I28 K29	I21-T25 VanDerWaalsContact O-CB 3.28Å; I21-T25 WeakPolarHBondContact O-CB 3.25Å; I21-T25 PolarHBondContact O-N 3.02Å; I21-T25 PolarHBondContact O-OG1 2.93Å; D22-T25 PolarHBondContact O-N 3.26Å; V23-T25 VanDerWaalsContact C-N 3.34Å; V23-T25 PolarHBondContact O-N 2.98Å; T25-I28 PolarHBondContact O-N 3.05Å; T25-K29 HydrophobicContact CG2-CD 4.29Å; T25-K29 WeakPolarHBondContact O-CG 3.47Å; T25-K29 PolarHBondContact O-N 3.25Å
26	T	98.7	Very high	98.6	Very high	71 Å²	71	95.1 Å²	95.1	44%	0.436	49%	0.489	S	S	.	.	H	α-helix	trans	-64.9	-42.2	177.4	-64.5	0	0	0	0	111.5	D22 V23 I24 K29 S30	D22-T26 WeakPolarHBondContact O-CB 3.34Å; D22-T26 PolarHBondContact O-N 2.92Å; D22-T26 PolarHBondContact O-OG1 3.37Å; V23-T26 PolarHBondContact O-N 3.11Å; I24-T26 VanDerWaalsContact C-N 3.32Å; I24-T26 PolarHBondContact O-N 3.41Å; T26-K29 PolarHBondContact O-N 3.31Å; T26-S30 PolarHBondContact O-N 2.98Å
27	N	98.6	Very high	98.6	Very high	94 Å²	94	103 Å²	103	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-63.5	-42.8	175.7	-70.9	-16.3	0	0	0	111.8	V23 I24 S30 L31	V23-N27 VanDerWaalsContact O-CG 3.28Å; V23-N27 PolarHBondContact O-N 3.17Å; V23-N27 PolarHBondContact O-ND2 3.49Å; I24-N27 PolarHBondContact O-N 3.05Å; N27-S30 WeakPolarHBondContact O-CB 3.48Å; N27-S30 PolarHBondContact O-N 3.31Å; N27-L31 WeakPolarHBondContact O-CG 3.48Å; N27-L31 PolarHBondContact O-N 3.11Å
28	I	98.7	Very high	98.6	Very high	95 Å²	95	105 Å²	105	49%	0.487	52%	0.515	S	S	.	.	H	α-helix	trans	-61.5	-46	175	-69	169.4	0	0	0	110.7	I24 T25 S30 L31 V32	I24-I28 HydrophobicContact CG2-CD1 3.85Å; I24-I28 HydrophobicContact CG2-CG1 4.46Å; I24-I28 WeakPolarHBondContact O-CG1 3.45Å; I24-I28 PolarHBondContact O-N 2.97Å; T25-I28 PolarHBondContact O-N 3.05Å; I28-S30 VanDerWaalsContact C-N 3.29Å; I28-S30 PolarHBondContact O-N 2.85Å; I28-L31 PolarHBondContact O-N 3.42Å; I28-V32 HydrophobicContact CG2-CG2 4.39Å; I28-V32 WeakPolarHBondContact O-CG2 3.43Å; I28-V32 PolarHBondContact O-N 2.84Å
29	K	98.6	Very high	98.6	Very high	124 Å²	124	101.8 Å²	101.8	54%	0.539	51%	0.509	S	S	.	.	H	α-helix	trans	-57.9	-41.8	175.6	-74.2	169.6	-178.1	166.8	0	111.8	T25 T26 V32 N33	T25-K29 HydrophobicContact CG2-CD 4.29Å; T25-K29 WeakPolarHBondContact O-CG 3.47Å; T25-K29 PolarHBondContact O-N 3.25Å; T26-K29 PolarHBondContact O-N 3.31Å; K29-V32 PolarHBondContact O-N 3.16Å; K29-N33 WeakPolarHBondContact O-CB 3.48Å; K29-N33 VanDerWaalsContact O-CG 3.25Å; K29-N33 PolarHBondContact O-N 2.96Å; K29-N33 PolarHBondContact O-ND2 2.84Å
30	S	98.6	Very high	98.6	Very high	75 Å²	75	98.5 Å²	98.5	52%	0.524	50%	0.502	S	S	.	.	H	α-helix	trans	-62.4	-46.3	176.5	-171.3	0	0	0	0	112	T26 N27 I28 V32 N33 F34	T26-S30 PolarHBondContact O-N 2.98Å; N27-S30 WeakPolarHBondContact O-CB 3.48Å; N27-S30 PolarHBondContact O-N 3.31Å; I28-S30 VanDerWaalsContact C-N 3.29Å; I28-S30 PolarHBondContact O-N 2.85Å; S30-V32 PolarHBondContact O-N 2.84Å; S30-N33 PolarHBondContact O-N 2.86Å; S30-F34 PolarHBondContact O-N 3.14Å
31	L	98.7	Very high	98.6	Very high	111 Å²	111	94 Å²	94	58%	0.581	49%	0.492	S	S	*	.	H	α-helix	trans	-61	-44.1	176.4	-70.7	172.9	0	0	0	112.2	N27 I28 F34 L35	N27-L31 WeakPolarHBondContact O-CG 3.48Å; N27-L31 PolarHBondContact O-N 3.11Å; I28-L31 PolarHBondContact O-N 3.42Å; L31-F34 WeakPolarHBondContact O-CB 3.47Å; L31-F34 PolarHBondContact O-N 3.48Å; L31-L35 WeakPolarHBondContact O-CG 3.43Å; L31-L35 PolarHBondContact O-N 3.01Å
32	V	98.8	Very high	98.6	Very high	69 Å²	69	91 Å²	91	42%	0.418	48%	0.479	S	S	.	.	H	α-helix	trans	-62.9	-44.3	176.5	171.8	0	0	0	0	111	I28 K29 S30 F34 L35 N36	I28-V32 HydrophobicContact CG2-CG2 4.39Å; I28-V32 WeakPolarHBondContact O-CG2 3.43Å; I28-V32 PolarHBondContact O-N 2.84Å; K29-V32 PolarHBondContact O-N 3.16Å; S30-V32 PolarHBondContact O-N 2.84Å; V32-F34 VanDerWaalsContact C-N 3.31Å; V32-F34 PolarHBondContact O-N 3.24Å; V32-L35 PolarHBondContact O-N 3.38Å; V32-N36 VanDerWaalsContact O-CG 3.29Å; V32-N36 PolarHBondContact O-N 2.96Å; V32-N36 PolarHBondContact O-ND2 3.36Å
33	N	98.6	Very high	98.6	Very high	97 Å²	97	94.7 Å²	94.7	52%	0.519	49%	0.486	S	S	.	.	H	α-helix	trans	-61.2	-39.4	175.7	-76.2	-25.8	0	0	0	112.3	K29 S30 R37	K29-N33 WeakPolarHBondContact O-CB 3.48Å; K29-N33 VanDerWaalsContact O-CG 3.25Å; K29-N33 PolarHBondContact O-N 2.96Å; K29-N33 PolarHBondContact O-ND2 2.84Å; S30-N33 PolarHBondContact O-N 2.86Å; N33-R37 WeakPolarHBondContact O-CG 3.29Å; N33-R37 PolarHBondContact O-N 2.94Å; N33-R37 VanDerWaalsContact O-N 3.13Å
34	F	98.7	Very high	98.6	Very high	122 Å²	122	94.9 Å²	94.9	54%	0.535	49%	0.488	S	S	.	.	H	α-helix	trans	-61.8	-49.1	173	169.4	-97.2	0	0	0	111.3	S30 L31 V32 N36 R37 F38	S30-F34 PolarHBondContact O-N 3.14Å; L31-F34 WeakPolarHBondContact O-CB 3.47Å; L31-F34 PolarHBondContact O-N 3.48Å; V32-F34 VanDerWaalsContact C-N 3.31Å; V32-F34 PolarHBondContact O-N 3.24Å; F34-N36 VanDerWaalsContact C-N 3.33Å; F34-N36 PolarHBondContact O-N 2.83Å; F34-R37 PolarHBondContact O-N 3.15Å; F34-F38 HydrophobicContact CE1-CB 4.4Å; F34-F38 HydrophobicContact CZ-CB 4.43Å; F34-F38 HydrophobicContact CZ-CD2 4.36Å; F34-F38 VanDerWaalsContact O-CB 3.29Å; F34-F38 WeakPolarHBondContact O-CB 3.48Å; F34-F38 PolarHBondContact O-N 3.39Å
35	L	98.8	Very high	98.6	Very high	101 Å²	101	96.6 Å²	96.6	53%	0.529	49%	0.492	S	S	.	.	H	α-helix	trans	-61	-40.3	-179.9	-71.5	174.6	0	0	0	112.2	L31 V32 R37 F38 D39	L31-L35 WeakPolarHBondContact O-CG 3.43Å; L31-L35 PolarHBondContact O-N 3.01Å; V32-L35 PolarHBondContact O-N 3.38Å; L35-R37 PolarHBondContact O-N 3.31Å; L35-F38 PolarHBondContact O-N 2.84Å; L35-D39 WeakPolarHBondContact O-CB 3.35Å; L35-D39 PolarHBondContact O-N 3.25Å
36	N	98.4	Very high	98.6	Very high	94 Å²	94	99.6 Å²	99.6	50%	0.503	51%	0.505	S	S	.	.	H	α-helix	trans	-63.5	-42.4	176.1	-70.6	-23.8	0	0	0	112.2	V32 F34 S40	V32-N36 VanDerWaalsContact O-CG 3.29Å; V32-N36 PolarHBondContact O-N 2.96Å; V32-N36 PolarHBondContact O-ND2 3.36Å; F34-N36 VanDerWaalsContact C-N 3.33Å; F34-N36 PolarHBondContact O-N 2.83Å; N36-S40 WeakPolarHBondContact O-CB 3.49Å; N36-S40 PolarHBondContact O-N 2.78Å; N36-S40 VanDerWaalsContact O-N 3.11Å; N36-S40 PolarHBondContact O-OG 3.45Å
37	R	98.6	Very high	98.6	Very high	195 Å²	195	99.6 Å²	99.6	74%	0.736	51%	0.508	S	S	*	.	H	α-helix	trans	-68.5	-37.9	175.8	-72.3	177.1	178	-85.3	0.3	111.8	N33 F34 L35 S41	N33-R37 WeakPolarHBondContact O-CG 3.29Å; N33-R37 PolarHBondContact O-N 2.94Å; N33-R37 VanDerWaalsContact O-N 3.13Å; F34-R37 PolarHBondContact O-N 3.15Å; L35-R37 PolarHBondContact O-N 3.31Å; R37-S41 WeakPolarHBondContact O-CB 3.48Å; R37-S41 PolarHBondContact O-N 2.93Å
38	F	98.7	Very high	98.6	Very high	112 Å²	112	100.3 Å²	100.3	49%	0.491	51%	0.509	S	S	.	.	H	α-helix	trans	-64.3	-49	177.3	-179.9	-101.7	0	0	0	111	F34 L35 S40 S41 C42	F34-F38 HydrophobicContact CE1-CB 4.4Å; F34-F38 HydrophobicContact CZ-CB 4.43Å; F34-F38 HydrophobicContact CZ-CD2 4.36Å; F34-F38 VanDerWaalsContact O-CB 3.29Å; F34-F38 WeakPolarHBondContact O-CB 3.48Å; F34-F38 PolarHBondContact O-N 3.39Å; L35-F38 PolarHBondContact O-N 2.84Å; F38-S40 PolarHBondContact O-N 3.13Å; F38-S41 PolarHBondContact O-N 3.44Å; F38-C42 VanDerWaalsContact CZ-SG 3.55Å; F38-C42 WeakPolarHBondContact O-CB 3.33Å; F38-C42 PolarHBondContact O-N 3.5Å; F38-C42 PolarHBondContact O-SG 3.48Å; F38-C42 VanDerWaalsContact O-SG 3.39Å
39	D	98.5	Very high	98.6	Very high	83 Å²	83	101.1 Å²	101.1	44%	0.444	51%	0.513	S	S	.	.	H	α-helix	trans	-55.5	-51.1	174.5	178.2	66.9	0	0	0	111.3	L35 S41 C42 R43	L35-D39 WeakPolarHBondContact O-CB 3.35Å; L35-D39 PolarHBondContact O-N 3.25Å; D39-S41 VanDerWaalsContact C-N 3.34Å; D39-S41 PolarHBondContact O-N 3.13Å; D39-C42 PolarHBondContact O-N 3.11Å; D39-C42 VanDerWaalsContact O-N 3.13Å; D39-R43 WeakPolarHBondContact O-CG 3.43Å; D39-R43 PolarHBondContact O-N 3.28Å; D39-R43 WeakPolarHBondContact OD2-CD 3.45Å
40	S	98.4	Very high	98.6	Very high	68 Å²	68	99.9 Å²	99.9	48%	0.476	51%	0.513	S	S	.	.	H	α-helix	trans	-56.8	-46.9	178.3	-60.2	0	0	0	0	111.8	N36 F38 R43 T44	N36-S40 WeakPolarHBondContact O-CB 3.49Å; N36-S40 PolarHBondContact O-N 2.78Å; N36-S40 VanDerWaalsContact O-N 3.11Å; N36-S40 PolarHBondContact O-OG 3.45Å; F38-S40 PolarHBondContact O-N 3.13Å; S40-R43 PolarHBondContact O-N 3.35Å; S40-T44 PolarHBondContact O-N 2.9Å; S40-T44 PolarHBondContact O-OG1 2.91Å
41	S	98.5	Very high	98.6	Very high	47 Å²	47	99.4 Å²	99.4	33%	0.329	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-44.3	176.4	166.4	0	0	0	0	112	R37 F38 D39 T44 K45	R37-S41 WeakPolarHBondContact O-CB 3.48Å; R37-S41 PolarHBondContact O-N 2.93Å; F38-S41 PolarHBondContact O-N 3.44Å; D39-S41 VanDerWaalsContact C-N 3.34Å; D39-S41 PolarHBondContact O-N 3.13Å; S41-T44 PolarHBondContact O-N 2.9Å; S41-K45 WeakPolarHBondContact O-CB 3.42Å; S41-K45 WeakPolarHBondContact O-CG 3.39Å; S41-K45 PolarHBondContact O-N 2.86Å
42	C	98.7	Very high	98.6	Very high	41 Å²	41	101.1 Å²	101.1	28%	0.277	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-46.4	177.4	-76.8	0	0	0	0	111.2	F38 D39 T44 K45 L46	F38-C42 VanDerWaalsContact CZ-SG 3.55Å; F38-C42 WeakPolarHBondContact O-CB 3.33Å; F38-C42 PolarHBondContact O-N 3.5Å; F38-C42 PolarHBondContact O-SG 3.48Å; F38-C42 VanDerWaalsContact O-SG 3.39Å; D39-C42 PolarHBondContact O-N 3.11Å; D39-C42 VanDerWaalsContact O-N 3.13Å; C42-T44 PolarHBondContact O-N 2.86Å; C42-K45 PolarHBondContact O-N 3.22Å; C42-L46 WeakPolarHBondContact O-CB 3.48Å; C42-L46 WeakPolarHBondContact O-CG 3.36Å; C42-L46 PolarHBondContact O-N 3.26Å
43	R	98.7	Very high	98.6	Very high	173 Å²	173	102.4 Å²	102.4	65%	0.653	52%	0.516	S	S	*	.	H	α-helix	trans	-59.7	-44	176.8	-70.1	177	67	162.7	2.5	112.2	D39 S40 L46 S47	D39-R43 WeakPolarHBondContact O-CG 3.43Å; D39-R43 PolarHBondContact O-N 3.28Å; D39-R43 WeakPolarHBondContact OD2-CD 3.45Å; S40-R43 PolarHBondContact O-N 3.35Å; R43-L46 PolarHBondContact O-N 3.41Å; R43-S47 WeakPolarHBondContact O-CB 3.35Å; R43-S47 PolarHBondContact O-N 3.39Å
44	T	98.7	Very high	98.6	Very high	80 Å²	80	100 Å²	100	49%	0.491	50%	0.504	S	S	.	.	H	α-helix	trans	-62.1	-46.4	175.2	-59.6	0	0	0	0	111.7	S40 S41 C42 S47 Q48	S40-T44 PolarHBondContact O-N 2.9Å; S40-T44 PolarHBondContact O-OG1 2.91Å; S41-T44 PolarHBondContact O-N 2.9Å; C42-T44 PolarHBondContact O-N 2.86Å; T44-S47 PolarHBondContact O-N 3.19Å; T44-Q48 WeakPolarHBondContact O-CG 3.4Å; T44-Q48 PolarHBondContact O-N 3.46Å
45	K	98.7	Very high	98.6	Very high	125 Å²	125	99.4 Å²	99.4	54%	0.543	51%	0.507	S	S	.	.	H	α-helix	trans	-64.2	-41.9	178.9	-72.7	178.1	-176.6	-178.1	0	112.2	S41 C42 Q48 L49	S41-K45 WeakPolarHBondContact O-CB 3.42Å; S41-K45 WeakPolarHBondContact O-CG 3.39Å; S41-K45 PolarHBondContact O-N 2.86Å; C42-K45 PolarHBondContact O-N 3.22Å; K45-Q48 PolarHBondContact O-N 2.94Å; K45-L49 WeakPolarHBondContact O-CG 3.5Å; K45-L49 PolarHBondContact O-N 2.94Å
46	L	98.8	Very high	98.6	Very high	115 Å²	115	97.1 Å²	97.1	60%	0.602	50%	0.503	S	S	*	.	H	α-helix	trans	-62.4	-45.3	175.3	-74.5	172	0	0	0	111.3	C42 R43 Q48 L49 D50	C42-L46 WeakPolarHBondContact O-CB 3.48Å; C42-L46 WeakPolarHBondContact O-CG 3.36Å; C42-L46 PolarHBondContact O-N 3.26Å; R43-L46 PolarHBondContact O-N 3.41Å; L46-Q48 VanDerWaalsContact C-N 3.3Å; L46-Q48 PolarHBondContact O-N 3.35Å; L46-L49 PolarHBondContact O-N 2.97Å; L46-L49 VanDerWaalsContact O-N 3.16Å; L46-D50 WeakPolarHBondContact O-CB 3.41Å; L46-D50 PolarHBondContact O-N 2.96Å
47	S	98.7	Very high	98.6	Very high	70 Å²	70	97.4 Å²	97.4	49%	0.49	50%	0.501	S	S	.	.	H	α-helix	trans	-61.3	-36.7	175.8	175.3	0	0	0	0	112.8	R43 T44 S51	R43-S47 WeakPolarHBondContact O-CB 3.35Å; R43-S47 PolarHBondContact O-N 3.39Å; T44-S47 PolarHBondContact O-N 3.19Å; S47-S51 WeakPolarHBondContact O-CB 3.34Å; S47-S51 PolarHBondContact O-N 3.25Å; S47-S51 PolarHBondContact O-OG 3.28Å
48	Q	98.7	Very high	98.7	Very high	110 Å²	110	93.6 Å²	93.6	51%	0.514	49%	0.49	S	S	.	.	H	α-helix	trans	-67	-41.3	173.6	-72.7	173.8	-5.2	0	0	112.4	T44 K45 L46 K52	T44-Q48 WeakPolarHBondContact O-CG 3.4Å; T44-Q48 PolarHBondContact O-N 3.46Å; K45-Q48 PolarHBondContact O-N 2.94Å; L46-Q48 VanDerWaalsContact C-N 3.3Å; L46-Q48 PolarHBondContact O-N 3.35Å; Q48-K52 WeakPolarHBondContact O-CG 3.43Å; Q48-K52 PolarHBondContact O-N 3.32Å
49	L	98.8	Very high	98.6	Very high	111 Å²	111	93.7 Å²	93.7	58%	0.581	49%	0.491	S	S	*	.	H	α-helix	trans	-65.9	-43.8	176.1	-72.8	174.4	0	0	0	111.4	K45 L46 S51 K52 L53	K45-L49 WeakPolarHBondContact O-CG 3.5Å; K45-L49 PolarHBondContact O-N 2.94Å; L46-L49 PolarHBondContact O-N 2.97Å; L46-L49 VanDerWaalsContact O-N 3.16Å; L49-S51 PolarHBondContact O-N 2.95Å; L49-K52 WeakPolarHBondContact O-CB 3.34Å; L49-K52 PolarHBondContact O-N 2.84Å; L49-L53 WeakPolarHBondContact O-CB 3.34Å; L49-L53 PolarHBondContact O-N 3.25Å
50	D	98.7	Very high	98.7	Very high	99 Å²	99	93.2 Å²	93.2	53%	0.529	49%	0.491	S	S	.	.	H	α-helix	trans	-57.6	-48.1	175	-171.8	60	0	0	0	111	L46 K52 L53 T54	L46-D50 WeakPolarHBondContact O-CB 3.41Å; L46-D50 PolarHBondContact O-N 2.96Å; D50-K52 VanDerWaalsContact C-N 3.31Å; D50-K52 PolarHBondContact O-N 3.42Å; D50-L53 WeakPolarHBondContact O-CB 3.35Å; D50-L53 PolarHBondContact O-N 3.4Å; D50-L53 VanDerWaalsContact O-N 3.14Å; D50-T54 PolarHBondContact O-N 2.93Å; D50-T54 PolarHBondContact O-OG1 3.23Å; D50-T54 VanDerWaalsContact O-OG1 3.11Å
51	S	98.6	Very high	98.7	Very high	65 Å²	65	94.6 Å²	94.6	46%	0.455	49%	0.493	S	S	.	.	H	α-helix	trans	-60.1	-39	175.7	-59.8	0	0	0	0	113	S47 L49 N55	S47-S51 WeakPolarHBondContact O-CB 3.34Å; S47-S51 PolarHBondContact O-N 3.25Å; S47-S51 PolarHBondContact O-OG 3.28Å; L49-S51 PolarHBondContact O-N 2.95Å; S51-N55 WeakPolarHBondContact O-CB 3.48Å; S51-N55 PolarHBondContact O-N 2.94Å
52	K	98.7	Very high	98.7	Very high	147 Å²	147	98.2 Å²	98.2	64%	0.639	51%	0.508	S	S	*	.	H	α-helix	trans	-67.9	-41.5	176.2	-75.9	177.6	-179.7	-176.4	0	111.5	Q48 L49 D50 N55 A56	Q48-K52 WeakPolarHBondContact O-CG 3.43Å; Q48-K52 PolarHBondContact O-N 3.32Å; L49-K52 WeakPolarHBondContact O-CB 3.34Å; L49-K52 PolarHBondContact O-N 2.84Å; D50-K52 VanDerWaalsContact C-N 3.31Å; D50-K52 PolarHBondContact O-N 3.42Å; K52-N55 PolarHBondContact O-N 2.95Å; K52-A56 WeakPolarHBondContact O-CB 3.45Å; K52-A56 PolarHBondContact O-N 3.33Å
53	L	98.8	Very high	98.6	Very high	96 Å²	96	100.6 Å²	100.6	50%	0.503	52%	0.518	S	S	.	.	H	α-helix	trans	-62.4	-51.5	176.5	179.2	61	0	0	0	110.5	L49 D50 N55 A56 E57	L49-L53 WeakPolarHBondContact O-CB 3.34Å; L49-L53 PolarHBondContact O-N 3.25Å; D50-L53 WeakPolarHBondContact O-CB 3.35Å; D50-L53 PolarHBondContact O-N 3.4Å; D50-L53 VanDerWaalsContact O-N 3.14Å; L53-N55 VanDerWaalsContact C-N 3.28Å; L53-N55 PolarHBondContact O-N 3.47Å; L53-A56 WeakPolarHBondContact O-CA 3.44Å; L53-A56 WeakPolarHBondContact O-CB 3.38Å; L53-A56 PolarHBondContact O-N 2.99Å; L53-E57 HydrophobicContact CD1-CG 4.34Å; L53-E57 HydrophobicContact CG-CG 4.48Å; L53-E57 WeakPolarHBondContact O-CG 3.33Å; L53-E57 PolarHBondContact O-N 3.36Å
54	T	98.7	Very high	98.6	Very high	45 Å²	45	97.4 Å²	97.4	28%	0.276	51%	0.511	S	S	.	.	H	α-helix	trans	-57	-39.3	176.4	-59.1	0	0	0	0	112.6	D50 K58	D50-T54 PolarHBondContact O-N 2.93Å; D50-T54 PolarHBondContact O-OG1 3.23Å; D50-T54 VanDerWaalsContact O-OG1 3.11Å; T54-K58 HydrophobicContact CG2-CD 4.28Å; T54-K58 WeakPolarHBondContact O-CB 3.37Å; T54-K58 VanDerWaalsContact O-CG 3.29Å; T54-K58 WeakPolarHBondContact O-CG 3.47Å; T54-K58 PolarHBondContact O-N 2.92Å
55	N	98.7	Very high	98.6	Very high	111 Å²	111	96.1 Å²	96.1	59%	0.594	51%	0.508	S	S	*	.	H	α-helix	trans	-68.2	-38.1	175.4	-94.4	0	0	0	0	112.5	S51 K52 L53 H59	S51-N55 WeakPolarHBondContact O-CB 3.48Å; S51-N55 PolarHBondContact O-N 2.94Å; K52-N55 PolarHBondContact O-N 2.95Å; L53-N55 VanDerWaalsContact C-N 3.28Å; L53-N55 PolarHBondContact O-N 3.47Å; N55-H59 WeakPolarHBondContact O-CB 3.4Å; N55-H59 PolarHBondContact O-N 3.46Å
56	A	98.7	Very high	98.5	Very high	52 Å²	52	95.3 Å²	95.3	43%	0.43	51%	0.506	S	S	.	.	H	α-helix	trans	-65.4	-45.2	176	0	0	0	0	0	111.2	K52 L53 H59 V60	K52-A56 WeakPolarHBondContact O-CB 3.45Å; K52-A56 PolarHBondContact O-N 3.33Å; L53-A56 WeakPolarHBondContact O-CA 3.44Å; L53-A56 WeakPolarHBondContact O-CB 3.38Å; L53-A56 PolarHBondContact O-N 2.99Å; A56-H59 WeakPolarHBondContact O-CB 3.4Å; A56-H59 PolarHBondContact O-N 3.16Å; A56-H59 VanDerWaalsContact O-N 3.15Å; A56-V60 WeakPolarHBondContact O-CG2 3.29Å; A56-V60 PolarHBondContact O-N 3.45Å
57	E	98.7	Very high	98.5	Very high	100 Å²	100	93.6 Å²	93.6	47%	0.467	50%	0.5	S	S	.	.	H	α-helix	trans	-56.4	-51.6	174.9	-70.2	169.9	158.2	0	0	111.1	L53 H59 V60 D61	L53-E57 HydrophobicContact CD1-CG 4.34Å; L53-E57 HydrophobicContact CG-CG 4.48Å; L53-E57 WeakPolarHBondContact O-CG 3.33Å; L53-E57 PolarHBondContact O-N 3.36Å; E57-H59 VanDerWaalsContact C-N 3.26Å; E57-H59 PolarHBondContact O-N 3.39Å; E57-V60 WeakPolarHBondContact O-CB 3.35Å; E57-V60 PolarHBondContact O-N 3.3Å; E57-V60 VanDerWaalsContact O-N 3.11Å; E57-D61 PolarHBondContact O-N 2.91Å
58	K	98.6	Very high	98.4	Very high	116 Å²	116	96.5 Å²	96.5	50%	0.504	51%	0.505	S	S	.	.	H	α-helix	trans	-58.4	-37	176	-74	173	-178.1	173.2	0	113.1	T54 L62	T54-K58 HydrophobicContact CG2-CD 4.28Å; T54-K58 WeakPolarHBondContact O-CB 3.37Å; T54-K58 VanDerWaalsContact O-CG 3.29Å; T54-K58 WeakPolarHBondContact O-CG 3.47Å; T54-K58 PolarHBondContact O-N 2.92Å; K58-L62 WeakPolarHBondContact O-CB 3.44Å; K58-L62 VanDerWaalsContact O-CG 3.25Å; K58-L62 WeakPolarHBondContact O-CG 3.28Å; K58-L62 PolarHBondContact O-N 3.4Å
59	H	98.5	Very high	98.2	Very high	113 Å²	113	98.8 Å²	98.8	52%	0.523	51%	0.509	S	S	.	.	H	α-helix	trans	-68	-40.9	178.5	-167.8	78.8	0	0	0	111.3	N55 A56 E57 L62 L63	N55-H59 WeakPolarHBondContact O-CB 3.4Å; N55-H59 PolarHBondContact O-N 3.46Å; A56-H59 WeakPolarHBondContact O-CB 3.4Å; A56-H59 PolarHBondContact O-N 3.16Å; A56-H59 VanDerWaalsContact O-N 3.15Å; E57-H59 VanDerWaalsContact C-N 3.26Å; E57-H59 PolarHBondContact O-N 3.39Å; H59-L62 PolarHBondContact O-N 3.24Å; H59-L63 WeakPolarHBondContact O-CG 3.31Å; H59-L63 PolarHBondContact O-N 3.13Å
60	V	98.6	Very high	98.1	Very high	73 Å²	73	96.8 Å²	96.8	44%	0.442	50%	0.498	S	S	.	.	H	α-helix	trans	-61.3	-49.7	173.3	172.6	0	0	0	0	110.3	A56 E57 L62 L63 E64	A56-V60 WeakPolarHBondContact O-CG2 3.29Å; A56-V60 PolarHBondContact O-N 3.45Å; E57-V60 WeakPolarHBondContact O-CB 3.35Å; E57-V60 PolarHBondContact O-N 3.3Å; E57-V60 VanDerWaalsContact O-N 3.11Å; V60-L62 VanDerWaalsContact C-N 3.28Å; V60-L62 PolarHBondContact O-N 2.85Å; V60-L63 WeakPolarHBondContact O-CB 3.37Å; V60-L63 PolarHBondContact O-N 2.75Å; V60-E64 HydrophobicContact CG1-CG 4.24Å; V60-E64 WeakPolarHBondContact O-CG 3.34Å; V60-E64 PolarHBondContact O-N 3.3Å
61	D	98.5	Very high	97.9	Very high	97 Å²	97	96.2 Å²	96.2	52%	0.519	50%	0.495	S	S	.	.	H	α-helix	trans	-55.6	-42.5	178	-68	-23.1	0	0	0	112.3	E57 E64 A65	E57-D61 PolarHBondContact O-N 2.91Å; D61-E64 PolarHBondContact O-N 2.88Å; D61-A65 WeakPolarHBondContact O-CB 3.36Å; D61-A65 PolarHBondContact O-N 3.49Å
62	L	98.5	Very high	97.6	Very high	123 Å²	123	95.7 Å²	95.7	64%	0.644	49%	0.491	S	S	*	.	H	α-helix	trans	-65.6	-40.5	177.2	-74.2	173	0	0	0	112.3	K58 H59 V60 H66	K58-L62 WeakPolarHBondContact O-CB 3.44Å; K58-L62 VanDerWaalsContact O-CG 3.25Å; K58-L62 WeakPolarHBondContact O-CG 3.28Å; K58-L62 PolarHBondContact O-N 3.4Å; H59-L62 PolarHBondContact O-N 3.24Å; V60-L62 VanDerWaalsContact C-N 3.28Å; V60-L62 PolarHBondContact O-N 2.85Å; L62-H66 WeakPolarHBondContact O-CB 3.34Å; L62-H66 PolarHBondContact O-N 3.21Å
63	L	98.4	Very high	97.3	Very high	91 Å²	91	94.1 Å²	94.1	48%	0.476	49%	0.486	S	S	.	.	H	α-helix	trans	-66.2	-44.3	175.9	-72.5	174.5	0	0	0	111.1	H59 V60 A65 H66 V67	H59-L63 WeakPolarHBondContact O-CG 3.31Å; H59-L63 PolarHBondContact O-N 3.13Å; V60-L63 WeakPolarHBondContact O-CB 3.37Å; V60-L63 PolarHBondContact O-N 2.75Å; L63-A65 PolarHBondContact O-N 3.02Å; L63-H66 WeakPolarHBondContact O-CB 3.35Å; L63-H66 PolarHBondContact O-N 3.17Å; L63-V67 WeakPolarHBondContact O-CG2 3.45Å; L63-V67 PolarHBondContact O-N 3.01Å
64	E	98.1	Very high	96.7	Very high	107 Å²	107	95.1 Å²	95.1	50%	0.5	49%	0.488	S	S	.	.	H	α-helix	trans	-59.5	-46.1	175.5	-71.4	-175.9	171.7	0	0	111.4	V60 D61 H66 V67 H68	V60-E64 HydrophobicContact CG1-CG 4.24Å; V60-E64 WeakPolarHBondContact O-CG 3.34Å; V60-E64 PolarHBondContact O-N 3.3Å; D61-E64 PolarHBondContact O-N 2.88Å; E64-H66 VanDerWaalsContact C-N 3.31Å; E64-H66 PolarHBondContact O-N 3.32Å; E64-V67 PolarHBondContact O-N 3.01Å; E64-H68 WeakPolarHBondContact O-CB 3.5Å; E64-H68 PolarHBondContact O-N 3.43Å
65	A	98.1	Very high	95.8	Very high	52 Å²	52	98.7 Å²	98.7	43%	0.43	51%	0.506	S	S	.	.	H	α-helix	trans	-61.7	-37.2	175.7	0	0	0	0	0	112.7	D61 L63 R69	D61-A65 WeakPolarHBondContact O-CB 3.36Å; D61-A65 PolarHBondContact O-N 3.49Å; L63-A65 PolarHBondContact O-N 3.02Å; A65-R69 WeakPolarHBondContact O-CB 3.2Å; A65-R69 PolarHBondContact O-N 2.96Å
66	H	97.7	Very high	94.6	Very high	108 Å²	108	101.4 Å²	101.4	50%	0.5	51%	0.514	S	S	.	.	H	α-helix	trans	-65.4	-48.9	175	-164.6	138.8	0	0	0	110.8	L62 L63 E64 H68 R69 I70	L62-H66 WeakPolarHBondContact O-CB 3.34Å; L62-H66 PolarHBondContact O-N 3.21Å; L63-H66 WeakPolarHBondContact O-CB 3.35Å; L63-H66 PolarHBondContact O-N 3.17Å; E64-H66 VanDerWaalsContact C-N 3.31Å; E64-H66 PolarHBondContact O-N 3.32Å; H66-H68 PolarHBondContact O-N 3.44Å; H66-R69 WeakPolarHBondContact O-CB 3.45Å; H66-R69 PolarHBondContact O-N 3.23Å; H66-R69 VanDerWaalsContact O-N 3.14Å; H66-I70 WeakPolarHBondContact CD2-CD1 3.41Å; H66-I70 PolarHBondContact O-N 3.35Å
67	V	97.3	Very high	92.8	Very high	79 Å²	79	106.6 Å²	106.6	48%	0.479	53%	0.53	S	S	.	.	H	α-helix	trans	-59.4	-46	178.3	171.8	0	0	0	0	110.8	L63 E64 R69 I70 L71	L63-V67 WeakPolarHBondContact O-CG2 3.45Å; L63-V67 PolarHBondContact O-N 3.01Å; E64-V67 PolarHBondContact O-N 3.01Å; V67-R69 VanDerWaalsContact C-N 3.31Å; V67-R69 PolarHBondContact O-N 3.32Å; V67-I70 PolarHBondContact O-N 2.99Å; V67-L71 HydrophobicContact CG1-CD1 3.89Å; V67-L71 HydrophobicContact CG1-CG 4.34Å; V67-L71 WeakPolarHBondContact O-CG 3.42Å; V67-L71 PolarHBondContact O-N 2.87Å
68	H	96.6	Very high	90.9	Very high	131 Å²	131	111.6 Å²	111.6	61%	0.606	54%	0.544	S	S	*	.	H	α-helix	trans	-58.6	-40.5	175.1	-76.9	-167	0	0	0	112.5	E64 H66 L71 S72	E64-H68 WeakPolarHBondContact O-CB 3.5Å; E64-H68 PolarHBondContact O-N 3.43Å; H66-H68 PolarHBondContact O-N 3.44Å; H68-L71 PolarHBondContact O-N 3.41Å; H68-S72 WeakPolarHBondContact O-CB 3.47Å; H68-S72 PolarHBondContact O-N 3.12Å; H68-S72 PolarHBondContact O-OG 2.95Å
69	R	96.3	Very high	88.8	Confident	158 Å²	158	111.4 Å²	111.4	60%	0.596	56%	0.555	S	S	*	*	H	α-helix	trans	-62.6	-45.6	175.3	-172.5	-172.3	-62.6	175.1	0.5	111.8	A65 H66 V67 S72 Q73	A65-R69 WeakPolarHBondContact O-CB 3.2Å; A65-R69 PolarHBondContact O-N 2.96Å; H66-R69 WeakPolarHBondContact O-CB 3.45Å; H66-R69 PolarHBondContact O-N 3.23Å; H66-R69 VanDerWaalsContact O-N 3.14Å; V67-R69 VanDerWaalsContact C-N 3.31Å; V67-R69 PolarHBondContact O-N 3.32Å; R69-S72 WeakPolarHBondContact CA-OG 3.39Å; R69-S72 PolarHBondContact O-N 2.77Å; R69-S72 PolarHBondContact O-OG 2.8Å; R69-Q73 VanDerWaalsContact O-CG 3.28Å; R69-Q73 WeakPolarHBondContact O-CG 3.39Å; R69-Q73 PolarHBondContact O-N 3.33Å
70	I	95.3	Very high	86.9	Confident	69 Å²	69	111.5 Å²	111.5	35%	0.354	56%	0.564	S	S	.	*	H	α-helix	trans	-61.8	-47.9	177.8	-68.8	171.7	0	0	0	110.8	H66 V67 S72 Q73 Q74	H66-I70 WeakPolarHBondContact CD2-CD1 3.41Å; H66-I70 PolarHBondContact O-N 3.35Å; V67-I70 PolarHBondContact O-N 2.99Å; I70-S72 VanDerWaalsContact C-N 3.35Å; I70-S72 PolarHBondContact O-N 3.38Å; I70-Q73 PolarHBondContact O-N 2.76Å; I70-Q74 HydrophobicContact CG2-CG 4.47Å; I70-Q74 WeakPolarHBondContact O-CG 3.37Å; I70-Q74 PolarHBondContact O-N 3.18Å
71	L	94.7	Very high	84.7	Confident	87 Å²	87	116.2 Å²	116.2	46%	0.455	59%	0.586	S	S	.	*	H	α-helix	trans	-63.4	-40.2	-178.7	-68.8	174.3	0	0	0	112.1	V67 H68 Q74 N75	V67-L71 HydrophobicContact CG1-CD1 3.89Å; V67-L71 HydrophobicContact CG1-CG 4.34Å; V67-L71 WeakPolarHBondContact O-CG 3.42Å; V67-L71 PolarHBondContact O-N 2.87Å; H68-L71 PolarHBondContact O-N 3.41Å; L71-Q74 PolarHBondContact O-N 2.98Å; L71-N75 PolarHBondContact O-N 3.45Å; L71-N75 VanDerWaalsContact O-N 3.15Å
72	S	93	Very high	82.7	Confident	54 Å²	54	120.2 Å²	120.2	38%	0.378	60%	0.599	S	S	.	*	H	α-helix	trans	-65.8	-39.3	174.7	59.5	0	0	0	0	112.2	H68 R69 I70 N75 H76	H68-S72 WeakPolarHBondContact O-CB 3.47Å; H68-S72 PolarHBondContact O-N 3.12Å; H68-S72 PolarHBondContact O-OG 2.95Å; R69-S72 WeakPolarHBondContact CA-OG 3.39Å; R69-S72 PolarHBondContact O-N 2.77Å; R69-S72 PolarHBondContact O-OG 2.8Å; I70-S72 VanDerWaalsContact C-N 3.35Å; I70-S72 PolarHBondContact O-N 3.38Å; S72-N75 PolarHBondContact O-N 3.43Å; S72-H76 PolarHBondContact O-N 3.24Å; S72-H76 PolarHBondContact O-ND1 3.18Å
73	Q	91.5	Very high	80.6	Confident	115 Å²	115	119.1 Å²	119.1	54%	0.537	60%	0.601	S	S	.	*	H	α-helix	trans	-64.8	-39.2	174.9	-72.9	174.6	-8.7	0	0	112.7	R69 I70 H76 Q77	R69-Q73 VanDerWaalsContact O-CG 3.28Å; R69-Q73 WeakPolarHBondContact O-CG 3.39Å; R69-Q73 PolarHBondContact O-N 3.33Å; I70-Q73 PolarHBondContact O-N 2.76Å; Q73-H76 PolarHBondContact O-N 3.31Å; Q73-Q77 PolarHBondContact O-N 2.86Å
74	Q	85.8	Confident	78.6	Confident	117 Å²	117	120.5 Å²	120.5	55%	0.547	62%	0.616	S	S	.	*	H	α-helix	trans	-64.2	-39.5	176.3	-73.8	-179.9	-5.9	0	0	112.5	I70 L71 H76 Q77	I70-Q74 HydrophobicContact CG2-CG 4.47Å; I70-Q74 WeakPolarHBondContact O-CG 3.37Å; I70-Q74 PolarHBondContact O-N 3.18Å; L71-Q74 PolarHBondContact O-N 2.98Å; Q74-H76 VanDerWaalsContact C-N 3.29Å; Q74-H76 PolarHBondContact O-N 3.41Å; Q74-Q77 PolarHBondContact O-N 2.78Å; Q74-Q77 VanDerWaalsContact O-N 3.13Å
75	N	79.5	Confident	76.6	Confident	120 Å²	120	124.4 Å²	124.4	64%	0.642	63%	0.634	S	S	*	*	H	α-helix	trans	-64.2	-31	177.6	-80.9	-27.3	0	0	0	113.3	L71 S72 Q77	L71-N75 PolarHBondContact O-N 3.45Å; L71-N75 VanDerWaalsContact O-N 3.15Å; S72-N75 PolarHBondContact O-N 3.43Å; N75-Q77 VanDerWaalsContact C-N 3.32Å
76	H	74	Confident	74.7	Confident	167 Å²	167	129.8 Å²	129.8	77%	0.773	65%	0.65	S	S	*	*	H	α-helix	trans	-74.5	-20.8	175.4	-70.6	83.4	0	0	0	113.2	S72 Q73 Q74	S72-H76 PolarHBondContact O-N 3.24Å; S72-H76 PolarHBondContact O-ND1 3.18Å; Q73-H76 PolarHBondContact O-N 3.31Å; Q74-H76 VanDerWaalsContact C-N 3.29Å; Q74-H76 PolarHBondContact O-N 3.41Å
77	Q	61.2	Low	72.8	Confident	162 Å²	162	129.5 Å²	129.5	76%	0.757	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-4.3	177.8	-70.4	-169.1	-6.2	0	0	113.9	Q73 Q74 N75 P79	Q73-Q77 PolarHBondContact O-N 2.86Å; Q74-Q77 PolarHBondContact O-N 2.78Å; Q74-Q77 VanDerWaalsContact O-N 3.13Å; N75-Q77 VanDerWaalsContact C-N 3.32Å; Q77-P79 WeakPolarHBondContact O-CD 3.37Å
78	R	58.3	Low	71.3	Confident	204 Å²	204	133.1 Å²	133.1	77%	0.77	68%	0.676	S	S	*	*			trans	-77.2	107	177.7	-158.4	175	-157.6	-174.4	5.3	109.4	T80	R78-T80 PolarHBondContact O-N 3.35Å
79	P	54.8	Low	69.9	Low	112 Å²	112	132.4 Å²	132.4	73%	0.727	68%	0.681	S	S	*	*			trans	-65.9	124.5	175.5	-9.7	27.3	0	0	0	107.2	Q77 L81	Q77-P79 WeakPolarHBondContact O-CD 3.37Å; P79-L81 PolarHBondContact O-N 3.42Å
80	T	58.1	Low	68.4	Low	116 Å²	116	130.8 Å²	130.8	71%	0.712	69%	0.69	S	S	*	*			trans	-59.8	109.8	167	55.3	0	0	0	0	107.2	R78 K82	R78-T80 PolarHBondContact O-N 3.35Å; T80-K82 PolarHBondContact O-N 3.31Å
81	L	53.2	Low	66.9	Low	171 Å²	171	134.7 Å²	134.7	90%	0.895	71%	0.712	S	S	*	*			trans	-69.2	81.4	171.4	-156.2	83.6	0	0	0	106.7	P79 S83	P79-L81 PolarHBondContact O-N 3.42Å; L81-S83 PolarHBondContact O-N 2.94Å
82	K	56.9	Low	65	Low	182 Å²	182	142 Å²	142	79%	0.791	75%	0.751	S	S	*	*			trans	-70.2	110.6	168.5	-75.4	-172.7	178	-176.6	0	107	T80	T80-K82 PolarHBondContact O-N 3.31Å
83	S	54	Low	63.6	Low	100 Å²	100	146.4 Å²	146.4	70%	0.699	77%	0.77	S	S	*	*			trans	-48.3	136.1	171.5	-58.5	0	0	0	0	110.8	L81 Q85	L81-S83 PolarHBondContact O-N 2.94Å; S83-Q85 PolarHBondContact O-N 2.89Å
84	P	56.9	Low	62.2	Low	120 Å²	120	148 Å²	148	78%	0.779	78%	0.782	S	S	*	*			trans	-67.5	107.9	172.3	-11	25.3	0	0	0	109	H86	P84-H86 PolarHBondContact O-N 2.94Å; P84-H86 VanDerWaalsContact O-N 3.1Å
85	Q	56.4	Low	60.9	Low	189 Å²	189	149.7 Å²	149.7	88%	0.883	80%	0.796	S	S	*	*			trans	-71.5	97	160.6	-74.4	-165.9	-25.5	0	0	107.5	S83 S87	S83-Q85 PolarHBondContact O-N 2.89Å; Q85-S87 PolarHBondContact O-N 3.04Å
86	H	57	Low	59.8	Low	164 Å²	164	151.5 Å²	151.5	76%	0.759	81%	0.805	S	S	*	*			trans	-80.5	90.1	166.6	-124.2	-66.9	0	0	0	107.9	P84 L88	P84-H86 PolarHBondContact O-N 2.94Å; P84-H86 VanDerWaalsContact O-N 3.1Å; H86-L88 PolarHBondContact O-N 3.48Å
87	S	57.7	Low	58.9	Low	102 Å²	102	150.5 Å²	150.5	71%	0.713	81%	0.807	S	S	*	*			trans	-77	100	161.5	53.3	0	0	0	0	108.2	Q85 T89	Q85-S87 PolarHBondContact O-N 3.04Å; S87-T89 PolarHBondContact O-N 2.82Å
88	L	66.7	Low	58.7	Low	156 Å²	156	149.7 Å²	149.7	82%	0.817	81%	0.81	S	S	*	*			trans	-79.3	108.7	162	-84.4	141.4	0	0	0	107.5	H86	H86-L88 PolarHBondContact O-N 3.48Å
89	T	67.6	Low	58.8	Low	116 Å²	116	145.9 Å²	145.9	71%	0.712	81%	0.813	S	S	*	*			trans	-74.8	137	162.9	48.1	0	0	0	0	108.9	S87	S87-T89 PolarHBondContact O-N 2.82Å
90	P	64	Low	59.1	Low	123 Å²	123	148.5 Å²	148.5	80%	0.799	82%	0.819	S	S	*	*			trans	-76.4	131.3	175.2	-1.2	18.6	0	0	0	110.1
91	N	63.9	Low	59.2	Low	151 Å²	151	151.2 Å²	151.2	81%	0.807	83%	0.828	S	S	*	*			trans	-101.8	104	160.2	-91.3	-7.6	0	0	0	107.1
92	D	55.6	Low	59.7	Low	240 Å²	240	149.4 Å²	149.4	100%	1.283	82%	0.822	S	S	*	*			trans	167.1	0	140.2	-83.8	-20.8	0	0	0	110

Retrieved 92 of 92 residues in 264.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).